P07911 (UROM_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uromodulin Alternative name(s): Tamm-Horsfall urinary glycoprotein Short name=THP Cleaved into the following chain: | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 640 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Uromodulin: Functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure providing the water barrier permeability. May serve as a receptor for binding and endocytosis for cytokines (IL-1, IL-2) and TNF. Facilitates neutrophil migration across renal epithelial. Ref.10 Uromodulin, secreted form: Secreted into urine after proteolytically cleaveage. Into the urine, may contribute to colloid osmotic pressure, retards passage of positively charged electrolytes, prevents urinary tract infection and modulates formation of supersaturated salts and their crystals. Ref.10 |
| Subcellular location | Apical cell membrane; Lipid-anchor › GPI-anchor. Basolateral cell membrane; Lipid-anchor › GPI-anchor. Cell projection › cilium membrane. Note: Only a small fraction is sort to the basolateral pole of tubular epithelial cells compared to apical localization. Secreted into urine after cleavage. Colocalized with NPHP1 and KIF3A. Ref.8 Ref.9 Ref.10 Ref.11 |
| Tissue specificity | Synthesized exclusively in the kidney. Expressed exclusively by epithelial cells of the thick ascending limb of Henle's loop (TALH) and of distal convoluted tubule lumen. Most abundant protein in normal urine. Ref.8 |
| Domain | The ZP domain is involved in the polymerization of the protein to promote the formation of complex gel-like structure. |
| Post-translational modification | N-glycosylated. N-glycan heterogeneity at Asn-232: Hex7HexNAc6 (major) and dHex1Hex7HexNAc6 (minor); at Asn-322: dHex1Hex6HexNAc5 (minor), dHex1Hex7HexNAc6 (major) and dHex1Hex8HexNAc7 (minor); at Asn-396: Hex6HexNAc5 (major), dHex1Hex6HexNAc5 (minor) and Hex7HexNAc6 (minor). Ref.12 Proteolytically cleaved at a conserved C-terminal proteolytic cleavage site to generate the secreted form found into urine. Ref.7 |
| Involvement in disease | Familial juvenile hyperuricemic nephropathy 1 (HNFJ1) [MIM:162000]: A renal disease characterized by juvenile onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis. Medullary cystic kidney disease 2 (MCKD2) [MIM:603860]: A form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade. Glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) [MIM:609886]: A renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability. |
| Miscellaneous | A specific, but as yet unidentified, protease(s) cleaves off and releases UMOD into urine. |
| Sequence similarities | Contains 3 EGF-like domains. Contains 1 ZP domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P07911-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P07911-2) The sequence of this isoform differs from the canonical sequence as follows: 67-199: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P07911-3) The sequence of this isoform differs from the canonical sequence as follows: 205-234: FVGQGGARMAETCVPVLRCNTAAPMWLNGT → P | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P07911-4) The sequence of this isoform differs from the canonical sequence as follows: 133-154: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | |||||||||
| Chain | 25 – 614 | 590 | Uromodulin | PRO_0000041671 | |||||||
| Chain | 25 – 587 | 563 | Uromodulin, secreted form | PRO_0000407909 | |||||||
| Propeptide | 615 – 640 | 26 | Removed in mature form Potential | PRO_0000041672 | |||||||
Regions | |||||||||||
| Domain | 28 – 64 | 37 | EGF-like 1 | ||||||||
| Domain | 65 – 107 | 43 | EGF-like 2; calcium-binding Potential | ||||||||
| Domain | 108 – 149 | 42 | EGF-like 3; calcium-binding Potential | ||||||||
| Domain | 334 – 589 | 256 | ZP | ||||||||
Sites | |||||||||||
| Site | 587 – 588 | 2 | Cleavage | ||||||||
Amino acid modifications | |||||||||||
| Lipidation | 614 | 1 | GPI-anchor amidated serine Potential | ||||||||
| Glycosylation | 38 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 76 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 80 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) (complex) Ref.12 | ||||||||
| Glycosylation | 275 | 1 | N-linked (GlcNAc...) | CAR_000178 | |||||||
| Glycosylation | 322 | 1 | N-linked (GlcNAc...) (complex) Ref.12 | ||||||||
| Glycosylation | 396 | 1 | N-linked (GlcNAc...) (complex) Ref.12 | ||||||||
| Disulfide bond | 32 ↔ 41 | By similarity | |||||||||
| Disulfide bond | 35 ↔ 50 | By similarity | |||||||||
| Disulfide bond | 52 ↔ 63 | By similarity | |||||||||
| Disulfide bond | 69 ↔ 83 | By similarity | |||||||||
| Disulfide bond | 77 ↔ 92 | By similarity | |||||||||
| Disulfide bond | 94 ↔ 106 | By similarity | |||||||||
| Disulfide bond | 112 ↔ 126 | By similarity | |||||||||
| Disulfide bond | 120 ↔ 135 | By similarity | |||||||||
| Disulfide bond | 137 ↔ 148 | By similarity | |||||||||
| Disulfide bond | 506 ↔ 566 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 67 – 199 | 133 | Missing in isoform 2. | VSP_017565 | |||||||
| Alternative sequence | 133 – 154 | 22 | Missing in isoform 4. | VSP_040973 | |||||||
| Alternative sequence | 205 – 234 | 30 | FVGQG…WLNGT → P in isoform 3. | VSP_017566 | |||||||
| Natural variant | 77 | 1 | C → Y in HNFJ1. Ref.15 | VAR_025950 | |||||||
| Natural variant | 93 – 97 | 5 | VCPEG → AASC in MCKD2. | VAR_025951 | |||||||
| Natural variant | 103 | 1 | G → C in MCKD2. Ref.3 Corresponds to variant rs28934584 [ dbSNP | Ensembl ]. | VAR_017666 | |||||||
| Natural variant | 126 | 1 | C → R in HNFJ1. Ref.15 | VAR_025952 | |||||||
| Natural variant | 128 | 1 | N → S in HNFJ1. Ref.15 | VAR_025953 | |||||||
| Natural variant | 148 | 1 | C → W in MCKD2/HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. Ref.14 | VAR_025954 | |||||||
| Natural variant | 148 | 1 | C → Y in HNFJ1. Ref.3 Corresponds to variant rs28934582 [ dbSNP | Ensembl ]. | VAR_017667 | |||||||
| Natural variant | 150 | 1 | C → S in MCKD2/HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. Ref.14 | VAR_025955 | |||||||
| Natural variant | 217 | 1 | C → R in HNFJ1. Ref.3 Corresponds to variant rs28934583 [ dbSNP | Ensembl ]. | VAR_017668 | |||||||
| Natural variant | 223 | 1 | C → Y in HNFJ1. Ref.13 | VAR_025956 | |||||||
| Natural variant | 225 | 1 | T → K in MCKD2. Ref.16 | VAR_025957 | |||||||
| Natural variant | 248 | 1 | C → W in MCKD2. Ref.16 | VAR_025958 | |||||||
| Natural variant | 255 | 1 | C → Y in HNFJ1. Ref.15 | VAR_025959 | |||||||
| Natural variant | 300 | 1 | C → G in HNFJ1. Ref.15 | VAR_025960 | |||||||
| Natural variant | 315 | 1 | C → R in GCKDHI; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. Ref.14 | VAR_025961 | |||||||
| Natural variant | 317 | 1 | C → Y in MCKD2/HNFJ1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. Ref.14 | VAR_025962 | |||||||
| Natural variant | 458 | 1 | V → L. Corresponds to variant rs55772253 [ dbSNP | Ensembl ]. | VAR_061993 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 288 | 1 | T → A in BAG51560. Ref.4 | ||||||||
| Sequence conflict | 503 | 1 | M → I in BAG51560. Ref.4 | ||||||||
| Sequence conflict | 565 | 1 | H → D in AAA36799. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of human uromodulin as the Tamm-Horsfall urinary glycoprotein." Pennica D., Kohr W.J., Kuang W.-J., Glaister D., Aggarwal B.B., Chen E.Y., Goeddel D.V. Science 236:83-88(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Uromodulin (Tamm-Horsfall glycoprotein): a renal ligand for lymphokines." Hession C., Decker J.M., Sherblom A.P., Kumar S., Yue C.C., Mattaliano R.J., Tizard R., Kawashima E., Schmeissner U., Heletky S., Chow E.P., Burne C.A., Shaw A., Muchmore A.V. Science 237:1479-1484(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. |
| [3] | "Mutations of the UMOD gene are responsible for medullary cystic kidney disease 2 and familial juvenile hyperuricaemic nephropathy." Hart T.C., Gorry M.C., Hart P.S., Woodard A.S., Shihabi Z., Sandhu J., Shirts B., Xu L., Zhu H., Barmada M.M., Bleyer A.J. J. Med. Genet. 39:882-892(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HNFJ1 TYR-148 AND ARG-217, VARIANT MCKD2 CYS-103. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Kidney. |
| [5] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Kidney. |
| [7] | "Urinary uromodulin carries an intact ZP domain generated by a conserved C-terminal proteolytic cleavage." Santambrogio S., Cattaneo A., Bernascone I., Schwend T., Jovine L., Bachi A., Rampoldi L. Biochem. Biophys. Res. Commun. 370:410-413(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 578-587, PROTEOLYTIC CLEAVAGE, MASS SPECTROMETRY. |
| [8] | "Localization of Tamm-Horsfall glycoprotein in the human kidney using immuno-fluorescence and immuno-electron microscopical techniques." Sikri K.L., Foster C.L., MacHugh N., Marshall R.D. J. Anat. 132:597-605(1981) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [9] | "Uromodulin (Tamm-Horsfall glycoprotein/uromucoid) is a phosphatidylinositol-linked membrane protein." Rindler M.J., Naik S.S., Li N., Hoops T.C., Peraldi M.-N. J. Biol. Chem. 265:20784-20789(1990) [PubMed] [Europe PMC] [Abstract] Cited for: GPI-ANCHOR. |
| [10] | "Uromodulin facilitates neutrophil migration across renal epithelial monolayers." Schmid M., Prajczer S., Gruber L.N., Bertocchi C., Gandini R., Pfaller W., Jennings P., Joannidis M. Cell. Physiol. Biochem. 26:311-318(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [11] | "Uromodulin is expressed in renal primary cilia and UMOD mutations result in decreased ciliary uromodulin expression." Zaucke F., Boehnlein J.M., Steffens S., Polishchuk R.S., Rampoldi L., Fischer A., Pasch A., Boehm C.W., Baasner A., Attanasio M., Hoppe B., Hopfer H., Beck B.B., Sayer J.A., Hildebrandt F., Wolf M.T. Hum. Mol. Genet. 19:1985-1997(2010) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD." Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-232; ASN-322 AND ASN-396, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. |
| [13] | "Renal manifestations of a mutation in the uromodulin (Tamm Horsfall protein) gene." Bleyer A.J., Trachtman H., Sandhu J., Gorry M.C., Hart T.C. Am. J. Kidney Dis. 42:E20-E26(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HNFJ1 TYR-223. |
| [14] | "Allelism of MCKD, FJHN and GCKD caused by impairment of uromodulin export dynamics." Rampoldi L., Caridi G., Santon D., Boaretto F., Bernascone I., Lamorte G., Tardanico R., Dagnino M., Colussi G., Scolari F., Ghiggeri G.M., Amoroso A., Casari G. Hum. Mol. Genet. 12:3369-3384(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS MCKD2/HNFJ1 TRP-148; SER-150 AND TYR-317, VARIANT GCKDHI ARG-315, CHARACTERIZATION OF VARIANTS MCKD2/HNFJ1 TRP-148; SER-150 AND TYR-317, CHARACTERIZATION OF VARIANT GCKDHI ARG-315. |
| [15] | "UROMODULIN mutations cause familial juvenile hyperuricemic nephropathy." Turner J.J.O., Stacey J.M., Harding B., Kotanko P., Lhotta K., Puig J.G., Roberts I., Torres R.J., Thakker R.V. J. Clin. Endocrinol. Metab. 88:1398-1401(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HNFJ1 TYR-77; ARG-126; SER-128; TYR-255 AND GLY-300. |
| [16] | "Mutations of the Uromodulin gene in MCKD type 2 patients cluster in exon 4, which encodes three EGF-like domains." Wolf M.T.F., Mucha B.E., Attanasio M., Zalewski I., Karle S.M., Neumann H.P.H., Rahman N., Bader B., Baldamus C.A., Otto E., Witzgall R., Fuchshuber A., Hildebrandt F. Kidney Int. 64:1580-1587(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS MCKD2 93-VAL--GLY-97 DELINS ALA-ALA-SER-CYS; LYS-225 AND TRP-248. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M15881 mRNA. Translation: AAA36798.1. M17778 mRNA. Translation: AAA36799.1. AY162970 AY162969 Genomic DNA. Translation: AAO64446.1.AK127643 mRNA. Translation: BAC87070.1. AK055722 mRNA. Translation: BAG51560.1. AK091961 mRNA. Translation: BAG52451.1. AC106796 Genomic DNA. No translation available. BC035975 mRNA. Translation: AAH35975.1. |
| IPI | IPI00013945. IPI00744076. IPI00902653. IPI01013836. |
| PIR | A30452. |
| RefSeq | NP_001008390.1. NM_001008389.1. NP_003352.2. NM_003361.2. |
| UniGene | Hs.654425. |
3D structure databases | |
| ProteinModelPortal | P07911. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P07911. 2 interactions. |
| STRING | 9606.ENSP00000306279. |
PTM databases | |
| GlycoSuiteDB | P07911. |
Polymorphism databases | |
| DMDM | 137116. |
Proteomic databases | |
| PaxDb | P07911. |
| PRIDE | P07911. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000302509; ENSP00000306279; ENSG00000169344. ENST00000396142; ENSP00000379446; ENSG00000169344. ENST00000570689; ENSP00000460548; ENSG00000169344. |
| GeneID | 7369. |
| KEGG | hsa:7369. |
| UCSC | uc002dgz.3. human. |
Organism-specific databases | |
| CTD | 7369. |
| GeneCards | GC16M020344. |
| H-InvDB | HIX0012858. |
| HGNC | HGNC:12559. UMOD. |
| HPA | CAB009446. |
| MIM | 162000. phenotype. 191845. gene. 603860. phenotype. 609886. phenotype. |
| neXtProt | NX_P07911. |
| Orphanet | 34149. Autosomal dominant medullary cystic kidney disease with or without hyperuricemia. 209886. Familial juvenile hyperuricemic nephropathy type 1. |
| PharmGKB | PA37199. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG44010. |
| HOGENOM | HOG000293303. |
| HOVERGEN | HBG004349. |
| OrthoDB | EOG498V0G. |
| PhylomeDB | P07911. |
Gene expression databases | |
| ArrayExpress | P07911. |
| Bgee | P07911. |
| CleanEx | HS_UMOD. |
| Genevestigator | P07911. |
| GermOnline | ENSG00000169344. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.40.155.10. 1 hit. |
| InterPro | IPR000742. EG-like_dom. IPR001881. EGF-like_Ca-bd. IPR013032. EGF-like_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR018097. EGF_Ca-bd_CS. IPR024731. EGF_dom_MSP1-like. IPR023413. GFP_like. IPR009030. Growth_fac_rcpt. IPR001507. ZP_dom. IPR017977. ZP_dom_CS. [Graphical view] |
| Pfam | PF12947. EGF_3. 1 hit. PF07645. EGF_CA. 2 hits. PF00100. Zona_pellucida. 1 hit. [Graphical view] |
| PRINTS | PR00023. ZPELLUCIDA. |
| SMART | SM00181. EGF. 1 hit. SM00179. EGF_CA. 2 hits. SM00241. ZP. 1 hit. [Graphical view] |
| SUPFAM | SSF57184. Grow_fac_recept. 1 hit. |
| PROSITE | PS00010. ASX_HYDROXYL. 2 hits. PS00022. EGF_1. False negative. PS01186. EGF_2. 3 hits. PS50026. EGF_3. 3 hits. PS01187. EGF_CA. 2 hits. PS00682. ZP_1. 1 hit. PS51034. ZP_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 7369. |
| NextBio | 28856. |
| SOURCE | Search... |
Entry information
| Entry name | UROM_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P07911 Secondary accession number(s): B3KP48 Q8IYG0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
