P07741 (APT_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 151.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Adenine phosphoribosyltransferase Short name=APRT EC=2.4.2.7 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 180 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. |
| Catalytic activity | AMP + diphosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate. |
| Pathway | Purine metabolism; AMP biosynthesis via salvage pathway; AMP from adenine: step 1/1. |
| Subunit structure | Homodimer. |
| Subcellular location | |
| Involvement in disease | Adenine phosphoribosyltransferase deficiency (APRTD) [MIM:614723]: An enzymatic deficiency that can lead to urolithiasis and renal failure. Patients have 2,8-dihydroxyadenine (DHA) urinary stones. |
| Sequence similarities | Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P07741-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P07741-2) The sequence of this isoform differs from the canonical sequence as follows: 134-180: GTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE → V | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.8 Ref.9 | ||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 180 | 179 | Adenine phosphoribosyltransferase | PRO_0000149504 | |||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.9 Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 4 | 1 | Phosphoserine Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 15 | 1 | Phosphoserine Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 60 | 1 | Phosphotyrosine Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 66 | 1 | Phosphoserine Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 114 | 1 | N6-acetyllysine Ref.11 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 135 | 1 | Phosphothreonine Ref.10 | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 134 – 180 | 47 | GTMNA…LLQYE → V in isoform 2. | VSP_045705 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 33 | 1 | L → P in APRTD. Ref.21 | VAR_069049 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 65 | 1 | D → V in APRTD; Icelandic type. Ref.14 | VAR_006747 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 84 | 1 | V → M in APRTD. Ref.20 Corresponds to variant rs200392753 [ dbSNP | Ensembl ]. | VAR_069050 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 110 | 1 | L → P in APRTD; Newfoundland type. Ref.15 | VAR_006748 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 121 | 1 | Q → R. Ref.4 Corresponds to variant rs8191494 [ dbSNP | Ensembl ]. | VAR_019055 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 133 | 1 | G → D in APRTD. Ref.20 | VAR_069051 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 136 | 1 | M → T in APRTD; Japanese type; allele APRT*J; most common mutation. Ref.16 Ref.17 Ref.18 Ref.21 Corresponds to variant rs28999113 [ dbSNP | Ensembl ]. | VAR_006749 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 150 | 1 | V → F in APRTD. Ref.19 | VAR_022608 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 153 | 1 | C → R in APRTD. Ref.19 | VAR_022609 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 173 | 1 | Missing in APRTD. Ref.17 | VAR_037575 | |||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Helix | 4 – 10 | 7 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 14 – 17 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 19 – 21 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 25 – 28 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 30 – 34 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 36 – 54 | 19 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 64 | 5 | |||||||||||||||||||||||||||||||||||||||
| Turn | 65 – 67 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 68 – 79 | 12 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 82 – 88 | 7 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 94 – 103 | 10 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 106 – 113 | 8 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 122 – 133 | 12 | |||||||||||||||||||||||||||||||||||||||
| Helix | 134 – 145 | 12 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 149 – 159 | 11 | |||||||||||||||||||||||||||||||||||||||
| Helix | 160 – 162 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 164 – 168 | 5 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 173 – 179 | 7 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nucleotide sequence of the human APRT gene." Hidaka Y., Tarle S.A., Toole T.E.O., Kelley W.N., Palella T.D. Nucleic Acids Res. 15:9086-9086(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Liver. |
| [2] | "Comparative anatomy of the human APRT gene and enzyme: nucleotide sequence divergence and conservation of a nonrandom CpG dinucleotide arrangement." Broderick T.P., Schaff D.A., Bertino A.M., Dush M.K., Tischfield J.A., Stambrook P.J. Proc. Natl. Acad. Sci. U.S.A. 84:3349-3353(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterine endothelium. |
| [4] | NIEHS SNPs program Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ARG-121. |
| [5] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Astrocytoma. |
| [8] | "Human adenine phosphoribosyltransferase. Complete amino acid sequence of the erythrocyte enzyme." Wilson J.M., O'Toole T.E., Argos P., Shewach D.S., Daddona P.E., Kelley W.N. J. Biol. Chem. 261:13677-13683(1986) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-180. |
| [9] | "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-12, ACETYLATION AT ALA-2. Tissue: Platelet. |
| [10] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4; SER-15; TYR-60; SER-66 AND THR-135, MASS SPECTROMETRY. |
| [11] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-114, MASS SPECTROMETRY. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "Three-dimensional structure of human adenine phosphoribosyltransferase and its relation to DHA-urolithiasis." Silva M., Silva C.H., Iulek J., Thiemann O.H. Biochemistry 43:7663-7671(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS). |
| [14] | "Identification of a single missense mutation in the adenine phosphoribosyltransferase (APRT) gene from five Icelandic patients and a British patient." Chen J., Sahota A., Laxdal T., Scrine M., Bowman S., Cui C., Stambrook P.J., Tischfield J.A. Am. J. Hum. Genet. 49:1306-1311(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT APRTD VAL-65. |
| [15] | "Missense mutation in the adenine phosphoribosyltransferase gene causing 2,8-dihydroxyadenine urolithiasis." Sahota A., Chen J., Boyadjiev S.A., Gault M.H., Tischfield J.A. Hum. Mol. Genet. 3:817-818(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT APRTD PRO-110. |
| [16] | "Human adenine phosphoribosyltransferase. Identification of allelic mutations at the nucleotide level as a cause of complete deficiency of the enzyme." Hidaka Y., Palella T.D., O'Toole T.E., Tarle S.A., Kelley W.N. J. Clin. Invest. 80:1409-1415(1987) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT APRTD THR-136. |
| [17] | "Human adenine phosphoribosyltransferase deficiency. Demonstration of a single mutant allele common to the Japanese." Hidaka Y., Tarle S.A., Fujimori S., Kamatani N., Kelley W.N. J. Clin. Invest. 81:945-950(1988) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS APRTD THR-136 AND PHE-173 DEL. |
| [18] | "Only three mutations account for almost all defective alleles causing adenine phosphoribosyltransferase deficiency in Japanese patients." Kamatani N., Hakoda M., Otsuka S., Yoshikawa H., Kashiwazaki S. J. Clin. Invest. 90:130-135(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT APRTD THR-136. |
| [19] | "2,8-Dihydroxyadenine urolithiasis in a patient with considerable residual adenine phosphoribosyltransferase activity in cell extracts but with mutations in both copies of APRT." Deng L., Yang M., Fruend S., Wessel T., De Abreu R.A., Tischfield J.A., Sahota A. Mol. Genet. Metab. 72:260-264(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS APRTD PHE-150 AND ARG-153. |
| [20] | "Identification of two novel mutations in adenine phosphoribosyltransferase gene in patients with 2,8-dihydroxyadenine urolithiasis." Taniguchi A., Tsuchida S., Kuno S., Mita M., Machida T., Ioritani N., Terai C., Yamanaka H., Kamatani N. Nucleosides Nucleotides Nucleic Acids 23:1141-1145(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS APRTD MET-84 AND ASP-133. |
| [21] | "A Japanese boy with adenine phosphoribosyltransferase (APRT) deficiency caused by compound heterozygosity including a novel missense mutation in APRT gene." Nozue H., Kamoda T., Saitoh H., Ichikawa K., Taniguchi A. Acta Paediatr. 100:E285-E288(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS APRTD PRO-33 AND THR-136. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| NIEHS-SNPs |
| Wikipedia Adenine phosphoribosyltransferase entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y00486 Genomic DNA. Translation: CAA68543.1. M16446 Genomic DNA. Translation: AAA51769.1. CR749423 mRNA. Translation: CAH18261.1. AY306126 Genomic DNA. Translation: AAP45051.1. AC092384 Genomic DNA. No translation available. CH471184 Genomic DNA. Translation: EAW66761.1. BC107151 mRNA. Translation: AAI07152.1. BM550173 mRNA. No translation available. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00218693. | ||||||||||||||||||||||||||||||||||||
| PIR | RTHUA. S06232. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000476.1. NM_000485.2. NP_001025189.1. NM_001030018.1. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.28914. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P07741. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| IntAct | P07741. 2 interactions. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000367615. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P07741. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 114074. | ||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||
| SWISS-2DPAGE | P07741. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | P07741. | ||||||||||||||||||||||||||||||||||||
| PRIDE | P07741. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000378364; ENSP00000367615; ENSG00000198931. ENST00000426324; ENSP00000397007; ENSG00000198931. | ||||||||||||||||||||||||||||||||||||
| GeneID | 353. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:353. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc002flv.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 353. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC16M088875. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:626. APRT. | ||||||||||||||||||||||||||||||||||||
| HPA | HPA026681. | ||||||||||||||||||||||||||||||||||||
| MIM | 102600. gene. 614723. phenotype. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P07741. | ||||||||||||||||||||||||||||||||||||
| Orphanet | 976. 2,8 dihydroxyadenine urolithiasis. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA24914. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | COG0503. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000036776. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG003144. | ||||||||||||||||||||||||||||||||||||
| InParanoid | P07741. | ||||||||||||||||||||||||||||||||||||
| KO | K00759. | ||||||||||||||||||||||||||||||||||||
| OMA | DYALEYG. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG48KRCC. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | P07741. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| BRENDA | 2.4.2.7. 2681. | ||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||||||||||||||||||||
| SABIO-RK | P07741. | ||||||||||||||||||||||||||||||||||||
| UniPathway | UPA00588; UER00646. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P07741. | ||||||||||||||||||||||||||||||||||||
| Bgee | P07741. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_APRT. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P07741. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000198931. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR005764. Ade_phspho_trans. IPR000836. PRibTrfase_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00156. Pribosyltran. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR01090. apt. 1 hit. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS00103. PUR_PYR_PR_TRANSFER. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| DrugBank | DB00173. Adenine. DB00131. Adenosine monophosphate. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P07741. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 353. | ||||||||||||||||||||||||||||||||||||
| NextBio | 1453. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | APT_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P07741 Secondary accession number(s): G5E9J2, Q3KP55, Q68DF9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
