Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P07288

- KLK3_HUMAN

UniProt

P07288 - KLK3_HUMAN

Protein

Prostate-specific antigen

Gene

KLK3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 172 (01 Oct 2014)
      Sequence version 2 (01 Jul 1989)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

    Catalytic activityi

    Preferential cleavage: -Tyr-|-Xaa-.

    Enzyme regulationi

    Inhibited by SERPINA5. Activity is strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders.2 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei65 – 651Charge relay system1 Publication
    Active sitei120 – 1201Charge relay system1 Publication
    Active sitei213 – 2131Charge relay system1 Publication

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. serine-type endopeptidase activity Source: InterPro
    3. serine-type peptidase activity Source: ProtInc

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. negative regulation of angiogenesis Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase, Protease, Serine protease

    Enzyme and pathway databases

    BRENDAi3.4.21.77. 2681.
    ReactomeiREACT_15428. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

    Protein family/group databases

    MEROPSiS01.162.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Prostate-specific antigen (EC:3.4.21.77)
    Short name:
    PSA
    Alternative name(s):
    Gamma-seminoprotein
    Short name:
    Seminin
    Kallikrein-3
    P-30 antigen
    Semenogelase
    Gene namesi
    Name:KLK3
    Synonyms:APS
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:6364. KLK3.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB
    2. nucleus Source: UniProt

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164741810.

    Protein family/group databases

    Allergomei2836. Hom s PSA.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 17171 PublicationAdd
    BLAST
    Propeptidei18 – 247Activation peptide2 PublicationsPRO_0000027931
    Chaini25 – 261237Prostate-specific antigenPRO_0000027932Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi31 ↔ 1731 PublicationPROSITE-ProRule annotation
    Disulfide bondi50 ↔ 661 PublicationPROSITE-ProRule annotation
    Glycosylationi69 – 691N-linked (GlcNAc...)
    Disulfide bondi152 ↔ 2191 PublicationPROSITE-ProRule annotation
    Disulfide bondi184 ↔ 1981 PublicationPROSITE-ProRule annotation
    Disulfide bondi209 ↔ 2341 PublicationPROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Zymogen

    Proteomic databases

    MaxQBiP07288.
    PaxDbiP07288.
    PRIDEiP07288.

    PTM databases

    PhosphoSiteiP07288.

    Miscellaneous databases

    PMAP-CutDBP07288.

    Expressioni

    Gene expression databases

    ArrayExpressiP07288.
    BgeeiP07288.
    CleanExiHS_KLK3.
    GenevestigatoriP07288.

    Organism-specific databases

    HPAiCAB000070.
    HPA000764.

    Interactioni

    Subunit structurei

    Forms a heterodimer with SERPINA5.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ARP102753EBI-1220791,EBI-608057

    Protein-protein interaction databases

    BioGridi106850. 4 interactions.
    IntActiP07288. 6 interactions.
    STRINGi9606.ENSP00000314151.

    Structurei

    Secondary structure

    1
    261
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi39 – 5618
    Beta strandi59 – 624
    Helixi64 – 663
    Beta strandi72 – 765
    Beta strandi78 – 825
    Beta strandi88 – 9710
    Helixi103 – 1064
    Beta strandi107 – 1104
    Beta strandi122 – 1287
    Beta strandi134 – 1363
    Beta strandi151 – 1577
    Beta strandi160 – 1645
    Beta strandi172 – 1798
    Helixi181 – 1877
    Beta strandi189 – 1913
    Beta strandi196 – 2005
    Beta strandi216 – 22914
    Beta strandi232 – 2354
    Beta strandi241 – 2455
    Helixi246 – 2494
    Helixi250 – 2589

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1PFAmodel-A10-261[»]
    2PSAmodel-A25-261[»]
    2ZCHX-ray2.83P25-261[»]
    2ZCKX-ray3.10P25-261[»]
    2ZCLX-ray3.25P25-261[»]
    3QUMX-ray3.20P/Q25-261[»]
    ProteinModelPortaliP07288.
    SMRiP07288. Positions 25-261.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP07288.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini25 – 258234Peptidase S1PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation
    Contains 1 peptidase S1 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG5640.
    HOGENOMiHOG000251820.
    HOVERGENiHBG013304.
    InParanoidiP07288.
    KOiK01351.
    OMAiLEIFICC.
    PhylomeDBiP07288.
    TreeFamiTF331065.

    Family and domain databases

    InterProiIPR001254. Peptidase_S1.
    IPR018114. Peptidase_S1_AS.
    IPR001314. Peptidase_S1A.
    IPR009003. Trypsin-like_Pept_dom.
    [Graphical view]
    PfamiPF00089. Trypsin. 1 hit.
    [Graphical view]
    PRINTSiPR00722. CHYMOTRYPSIN.
    SMARTiSM00020. Tryp_SPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF50494. SSF50494. 1 hit.
    PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
    PS00134. TRYPSIN_HIS. 1 hit.
    PS00135. TRYPSIN_SER. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P07288-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWVPVVFLTL SVTWIGAAPL ILSRIVGGWE CEKHSQPWQV LVASRGRAVC    50
    GGVLVHPQWV LTAAHCIRNK SVILLGRHSL FHPEDTGQVF QVSHSFPHPL 100
    YDMSLLKNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT 150
    TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHPQ KVTKFMLCAG 200
    RWTGGKSTCS GDSGGPLVCN GVLQGITSWG SEPCALPERP SLYTKVVHYR 250
    KWIKDTIVAN P 261
    Length:261
    Mass (Da):28,741
    Last modified:July 1, 1989 - v2
    Checksum:iAE9E732AF872141A
    GO
    Isoform 2 (identifier: P07288-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         211-261: GDSGGPLVCN...WIKDTIVANP → WVILITELTMPALPMVLHGSLVPWRGGV

    Note: No experimental confirmation available.

    Show »
    Length:238
    Mass (Da):26,317
    Checksum:iD46C6C2B210F70A4
    GO
    Isoform 3 (identifier: P07288-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         69-69: N → K
         70-112: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:218
    Mass (Da):23,725
    Checksum:iB62C82BD085CC492
    GO
    Isoform 4 (identifier: P07288-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         69-69: N → K
         70-261: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:69
    Mass (Da):7,616
    Checksum:i6781B491913E35B2
    GO
    Isoform 5 (identifier: P07288-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         211-260: GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVAN → VSHPYSQDLEGKGEWG

    Show »
    Length:227
    Mass (Da):25,116
    Checksum:i2E9B482F3CC3BA12
    GO

    Sequence cautioni

    The sequence CAA32124.1 differs from that shown. Reason:
    The sequence AAD14185.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti64 – 641A → T(PubMed:2456523)Curated
    Sequence conflicti69 – 691N → KC in AAA60193. (PubMed:2466464)Curated
    Sequence conflicti94 – 941H → T AA sequence (PubMed:2422647)Curated
    Sequence conflicti136 – 1361V → M(PubMed:2456523)Curated
    Sequence conflicti165 – 1684FLTP → HLLYDQM AA sequence (PubMed:2422647)Curated
    Sequence conflicti175 – 1751D → Q AA sequence (PubMed:2422647)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti32 – 321E → K.
    Corresponds to variant rs2271092 [ dbSNP | Ensembl ].
    VAR_021941
    Natural varianti132 – 1321L → I.1 Publication
    Corresponds to variant rs2003783 [ dbSNP | Ensembl ].
    VAR_021942
    Natural varianti179 – 1791I → T.
    Corresponds to variant rs17632542 [ dbSNP | Ensembl ].
    VAR_051852

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei69 – 691N → K in isoform 3 and isoform 4. 1 PublicationVSP_046169
    Alternative sequencei70 – 261192Missing in isoform 4. 1 PublicationVSP_046170Add
    BLAST
    Alternative sequencei70 – 11243Missing in isoform 3. 1 PublicationVSP_046171Add
    BLAST
    Alternative sequencei211 – 26151GDSGG…IVANP → WVILITELTMPALPMVLHGS LVPWRGGV in isoform 2. 1 PublicationVSP_045786Add
    BLAST
    Alternative sequencei211 – 26050GDSGG…TIVAN → VSHPYSQDLEGKGEWG in isoform 5. 1 PublicationVSP_047643Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M21896 mRNA. Translation: AAA59996.1.
    X05332 mRNA. Translation: CAA28947.1.
    X13940 Genomic DNA. Translation: CAA32123.1.
    X13941 Genomic DNA. Translation: CAA32124.1. Sequence problems.
    X13942 Genomic DNA. Translation: CAB46487.1.
    X13943 Genomic DNA. Translation: CAA32126.1.
    X13944 Genomic DNA. Translation: CAA32127.1.
    X14810 Genomic DNA. Translation: CAA32915.1.
    M27274 Genomic DNA. Translation: AAA60192.1.
    M26663 mRNA. Translation: AAA58802.1.
    M24543 Genomic DNA. Translation: AAA60193.1.
    U17040 mRNA. Translation: AAA56764.1.
    AF243527 Genomic DNA. Translation: AAG33355.1.
    AJ512346 mRNA. Translation: CAD54617.1.
    BT019862 mRNA. Translation: AAV38665.1.
    AC011523 Genomic DNA. No translation available.
    CH471135 Genomic DNA. Translation: EAW71929.1.
    CH471135 Genomic DNA. Translation: EAW71930.1.
    CH471135 Genomic DNA. Translation: EAW71936.1.
    BC005307 mRNA. Translation: AAH05307.1.
    BC050595 mRNA. Translation: AAH50595.2.
    BC056665 mRNA. Translation: AAH56665.1.
    BF679511 mRNA. No translation available.
    BQ932072 mRNA. No translation available.
    S75755 mRNA. Translation: AAD14185.1. Different initiation.
    X07730 mRNA. No translation available.
    CCDSiCCDS12807.1. [P07288-1]
    CCDS33083.1. [P07288-2]
    CCDS46155.1. [P07288-3]
    PIRiA32297.
    RefSeqiNP_001025218.1. NM_001030047.1. [P07288-2]
    NP_001025219.1. NM_001030048.1. [P07288-3]
    NP_001639.1. NM_001648.2. [P07288-1]
    UniGeneiHs.171995.

    Genome annotation databases

    EnsembliENST00000326003; ENSP00000314151; ENSG00000142515. [P07288-1]
    ENST00000360617; ENSP00000353829; ENSG00000142515. [P07288-2]
    ENST00000593997; ENSP00000472907; ENSG00000142515. [P07288-5]
    ENST00000595952; ENSP00000471155; ENSG00000142515. [P07288-3]
    GeneIDi354.
    KEGGihsa:354.
    UCSCiuc002ptr.1. human.
    uc002pts.1. human.
    uc010eof.2. human. [P07288-1]

    Polymorphism databases

    DMDMi130989.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Prostate-specific antigen entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M21896 mRNA. Translation: AAA59996.1 .
    X05332 mRNA. Translation: CAA28947.1 .
    X13940 Genomic DNA. Translation: CAA32123.1 .
    X13941 Genomic DNA. Translation: CAA32124.1 . Sequence problems.
    X13942 Genomic DNA. Translation: CAB46487.1 .
    X13943 Genomic DNA. Translation: CAA32126.1 .
    X13944 Genomic DNA. Translation: CAA32127.1 .
    X14810 Genomic DNA. Translation: CAA32915.1 .
    M27274 Genomic DNA. Translation: AAA60192.1 .
    M26663 mRNA. Translation: AAA58802.1 .
    M24543 Genomic DNA. Translation: AAA60193.1 .
    U17040 mRNA. Translation: AAA56764.1 .
    AF243527 Genomic DNA. Translation: AAG33355.1 .
    AJ512346 mRNA. Translation: CAD54617.1 .
    BT019862 mRNA. Translation: AAV38665.1 .
    AC011523 Genomic DNA. No translation available.
    CH471135 Genomic DNA. Translation: EAW71929.1 .
    CH471135 Genomic DNA. Translation: EAW71930.1 .
    CH471135 Genomic DNA. Translation: EAW71936.1 .
    BC005307 mRNA. Translation: AAH05307.1 .
    BC050595 mRNA. Translation: AAH50595.2 .
    BC056665 mRNA. Translation: AAH56665.1 .
    BF679511 mRNA. No translation available.
    BQ932072 mRNA. No translation available.
    S75755 mRNA. Translation: AAD14185.1 . Different initiation.
    X07730 mRNA. No translation available.
    CCDSi CCDS12807.1. [P07288-1 ]
    CCDS33083.1. [P07288-2 ]
    CCDS46155.1. [P07288-3 ]
    PIRi A32297.
    RefSeqi NP_001025218.1. NM_001030047.1. [P07288-2 ]
    NP_001025219.1. NM_001030048.1. [P07288-3 ]
    NP_001639.1. NM_001648.2. [P07288-1 ]
    UniGenei Hs.171995.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1PFA model - A 10-261 [» ]
    2PSA model - A 25-261 [» ]
    2ZCH X-ray 2.83 P 25-261 [» ]
    2ZCK X-ray 3.10 P 25-261 [» ]
    2ZCL X-ray 3.25 P 25-261 [» ]
    3QUM X-ray 3.20 P/Q 25-261 [» ]
    ProteinModelPortali P07288.
    SMRi P07288. Positions 25-261.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106850. 4 interactions.
    IntActi P07288. 6 interactions.
    STRINGi 9606.ENSP00000314151.

    Chemistry

    BindingDBi P07288.
    ChEMBLi CHEMBL2099.

    Protein family/group databases

    Allergomei 2836. Hom s PSA.
    MEROPSi S01.162.

    PTM databases

    PhosphoSitei P07288.

    Polymorphism databases

    DMDMi 130989.

    Proteomic databases

    MaxQBi P07288.
    PaxDbi P07288.
    PRIDEi P07288.

    Protocols and materials databases

    DNASUi 354.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000326003 ; ENSP00000314151 ; ENSG00000142515 . [P07288-1 ]
    ENST00000360617 ; ENSP00000353829 ; ENSG00000142515 . [P07288-2 ]
    ENST00000593997 ; ENSP00000472907 ; ENSG00000142515 . [P07288-5 ]
    ENST00000595952 ; ENSP00000471155 ; ENSG00000142515 . [P07288-3 ]
    GeneIDi 354.
    KEGGi hsa:354.
    UCSCi uc002ptr.1. human.
    uc002pts.1. human.
    uc010eof.2. human. [P07288-1 ]

    Organism-specific databases

    CTDi 354.
    GeneCardsi GC19P051358.
    HGNCi HGNC:6364. KLK3.
    HPAi CAB000070.
    HPA000764.
    MIMi 176820. gene.
    neXtProti NX_P07288.
    PharmGKBi PA164741810.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5640.
    HOGENOMi HOG000251820.
    HOVERGENi HBG013304.
    InParanoidi P07288.
    KOi K01351.
    OMAi LEIFICC.
    PhylomeDBi P07288.
    TreeFami TF331065.

    Enzyme and pathway databases

    BRENDAi 3.4.21.77. 2681.
    Reactomei REACT_15428. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

    Miscellaneous databases

    ChiTaRSi KLK3. human.
    EvolutionaryTracei P07288.
    GeneWikii Prostate-specific_antigen.
    GenomeRNAii 354.
    NextBioi 1459.
    PMAP-CutDB P07288.
    PROi P07288.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P07288.
    Bgeei P07288.
    CleanExi HS_KLK3.
    Genevestigatori P07288.

    Family and domain databases

    InterProi IPR001254. Peptidase_S1.
    IPR018114. Peptidase_S1_AS.
    IPR001314. Peptidase_S1A.
    IPR009003. Trypsin-like_Pept_dom.
    [Graphical view ]
    Pfami PF00089. Trypsin. 1 hit.
    [Graphical view ]
    PRINTSi PR00722. CHYMOTRYPSIN.
    SMARTi SM00020. Tryp_SPc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50494. SSF50494. 1 hit.
    PROSITEi PS50240. TRYPSIN_DOM. 1 hit.
    PS00134. TRYPSIN_HIS. 1 hit.
    PS00135. TRYPSIN_SER. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of human prostate specific antigen cDNA."
      Lundwall A., Lilja H.
      FEBS Lett. 214:317-322(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 4-238 (ISOFORM 2), ALTERNATIVE SPLICING.
      Tissue: Prostate.
    2. "Human prostate specific antigen (PSA) gene: structure and linkage to the kallikrein-like gene, hGK-1."
      Digby M.R., Zhang X.Y., Richard R.I.
      Nucleic Acids Res. 17:2137-2137(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Tissue: Prostate.
    3. "Genomic sequence of human prostate specific antigen (PSA)."
      Klobeck H.-G., Combriato G., Schulz P., Arbusow V., Fittler F.
      Nucleic Acids Res. 17:3981-3981(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "Characterization of the gene for prostate-specific antigen, a human glandular kallikrein."
      Lundwall A.
      Biochem. Biophys. Res. Commun. 161:1151-1159(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Tissue: Leukocyte.
    5. "cDNA coding for the entire human prostate specific antigen shows high homologies to the human tissue kallikrein genes."
      Henttu P., Vihko P.
      Biochem. Biophys. Res. Commun. 160:903-910(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Prostate.
    6. "Characterization of the prostate-specific antigen gene: a novel human kallikrein-like gene."
      Riegman P.H.J., Vlietstra R.J., van der Korput J.A.G.M., Romijn J.C., Trapman J.
      Biochem. Biophys. Res. Commun. 159:95-102(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Tissue: Prostate.
    7. "A comparative analysis of prostate-specific antigen gene sequence in benign and malignant prostate tissue."
      Baffa R., Moreno J.G., Monne M., Veronese M.L., Gomella L.G.
      Urology 47:795-800(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Prostate.
    8. "Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region."
      Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.
      Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    9. "Complex alternative splicing of the hKLK3 gene coding for the tumour marker PSA (prostate-specific-antigen)."
      Heuze-Vourc'h N., Courty Y.
      Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING.
      Tissue: Prostate.
    10. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    11. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    12. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    13. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
      Tissue: PNS, Prostate and Sciatic nerve.
    14. "Molecular characterization of prostate-specific antigen messenger RNA expressed in breast tumors."
      Monne M., Croce C.M., Yu H., Diamandis E.P.
      Cancer Res. 54:6344-6347(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-176 (ISOFORM 1).
    15. "Sequence of a cDNA clone encompassing the complete mature human prostate specific antigen (PSA) and an unspliced leader sequence."
      Schulz P., Stucka R., Feldmann H., Combriato G., Klobeck H.-G., Fittler F.
      Nucleic Acids Res. 16:6226-6226(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-261 (ISOFORM 1).
    16. "Human prostate-specific antigen: structural and functional similarity with serine proteases."
      Watt K.W.K., Lee P.J., M'Timkulu T., Chan W.P., Loor R.
      Proc. Natl. Acad. Sci. U.S.A. 83:3166-3170(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 25-261.
    17. "Isolation, characterization and amino-acid sequence of gamma-seminoprotein, a glycoprotein from human seminal plasma."
      Schaller J., Akiyama K., Tsuda R., Hara M., Marti T., Rickli E.E.
      Eur. J. Biochem. 170:111-120(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 25-261.
    18. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 18-32.
    19. "Identification of a novel proteoform of prostate specific antigen (SNP-L132I) in clinical samples by multiple reaction monitoring."
      Vegvari A., Sjodin K., Rezeli M., Malm J., Lilja H., Laurell T., Marko-Varga G.
      Mol. Cell. Proteomics 12:2761-2773(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 126-138, VARIANT ILE-132.
    20. "Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen."
      Espana F., Gilabert J., Estelles A., Romeu A., Aznar J., Cabo A.
      Thromb. Res. 64:309-320(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: ENZYME REGULATION, HETERODIMER WITH SERPINA5.
    21. "A structural model for the prostate disease marker, human prostate-specific antigen."
      Villoutreix B.O., Getzoff E.D., Griffin J.H.
      Protein Sci. 3:2033-2044(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: 3D-STRUCTURE MODELING.
    22. Cited for: 3D-STRUCTURE MODELING.
    23. "Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody."
      Menez R., Michel S., Muller B.H., Bossus M., Ducancel F., Jolivet-Reynaud C., Stura E.A.
      J. Mol. Biol. 376:1021-1033(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.83 ANGSTROMS) OF 25-261 IN COMPLEX WITH SUBSTRATE AND ACTIVATING ANTIBODY, ENZYME REGULATION, ACTIVE SITE, DISULFIDE BONDS.

    Entry informationi

    Entry nameiKLK3_HUMAN
    AccessioniPrimary (citable) accession number: P07288
    Secondary accession number(s): C9JXH3
    , G3V0H4, G3XAE3, Q15096, Q16272, Q86TG8, Q8IXI4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 1, 1988
    Last sequence update: July 1, 1989
    Last modified: October 1, 2014
    This is version 172 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. Peptidase families
      Classification of peptidase families and list of entries
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3