Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P07288 (KLK3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 170. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Prostate-specific antigen

Short name=PSA
EC=3.4.21.77
Alternative name(s):
Gamma-seminoprotein
Short name=Seminin
Kallikrein-3
P-30 antigen
Semenogelase
Gene names
Name:KLK3
Synonyms:APS
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length261 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

Catalytic activity

Preferential cleavage: -Tyr-|-Xaa-.

Enzyme regulation

Inhibited by SERPINA5. Activity is strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders. Ref.20 Ref.23

Subunit structure

Forms a heterodimer with SERPINA5.

Subcellular location

Secreted.

Sequence similarities

Belongs to the peptidase S1 family. Kallikrein subfamily.

Contains 1 peptidase S1 domain.

Sequence caution

The sequence AAD14185.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence CAA32124.1 differs from that shown. Reason:

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P07288-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P07288-2)

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCN...WIKDTIVANP → WVILITELTMPALPMVLHGSLVPWRGGV
Note: No experimental confirmation available.
Isoform 3 (identifier: P07288-3)

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-112: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: P07288-4)

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-261: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: P07288-5)

The sequence of this isoform differs from the canonical sequence as follows:
     211-260: GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVAN → VSHPYSQDLEGKGEWG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1717 Ref.18
Propeptide18 – 247Activation peptide
PRO_0000027931
Chain25 – 261237Prostate-specific antigen
PRO_0000027932

Regions

Domain25 – 258234Peptidase S1

Sites

Active site651Charge relay system Ref.23
Active site1201Charge relay system Ref.23
Active site2131Charge relay system Ref.23

Amino acid modifications

Glycosylation691N-linked (GlcNAc...)
Disulfide bond31 ↔ 173 Ref.23
Disulfide bond50 ↔ 66 Ref.23
Disulfide bond152 ↔ 219 Ref.23
Disulfide bond184 ↔ 198 Ref.23
Disulfide bond209 ↔ 234 Ref.23

Natural variations

Alternative sequence691N → K in isoform 3 and isoform 4.
VSP_046169
Alternative sequence70 – 261192Missing in isoform 4.
VSP_046170
Alternative sequence70 – 11243Missing in isoform 3.
VSP_046171
Alternative sequence211 – 26151GDSGG…IVANP → WVILITELTMPALPMVLHGS LVPWRGGV in isoform 2.
VSP_045786
Alternative sequence211 – 26050GDSGG…TIVAN → VSHPYSQDLEGKGEWG in isoform 5.
VSP_047643
Natural variant321E → K.
Corresponds to variant rs2271092 [ dbSNP | Ensembl ].
VAR_021941
Natural variant1321L → I. Ref.19
Corresponds to variant rs2003783 [ dbSNP | Ensembl ].
VAR_021942
Natural variant1791I → T.
Corresponds to variant rs17632542 [ dbSNP | Ensembl ].
VAR_051852

Experimental info

Sequence conflict641A → T Ref.15
Sequence conflict691N → KC in AAA60193. Ref.6
Sequence conflict941H → T AA sequence Ref.16
Sequence conflict1361V → M Ref.15
Sequence conflict165 – 1684FLTP → HLLYDQM AA sequence Ref.16
Sequence conflict1751D → Q AA sequence Ref.16

Secondary structure

........................................ 261
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 1, 1989. Version 2.
Checksum: AE9E732AF872141A

FASTA26128,741
        10         20         30         40         50         60 
MWVPVVFLTL SVTWIGAAPL ILSRIVGGWE CEKHSQPWQV LVASRGRAVC GGVLVHPQWV 

        70         80         90        100        110        120 
LTAAHCIRNK SVILLGRHSL FHPEDTGQVF QVSHSFPHPL YDMSLLKNRF LRPGDDSSHD 

       130        140        150        160        170        180 
LMLLRLSEPA ELTDAVKVMD LPTQEPALGT TCYASGWGSI EPEEFLTPKK LQCVDLHVIS 

       190        200        210        220        230        240 
NDVCAQVHPQ KVTKFMLCAG RWTGGKSTCS GDSGGPLVCN GVLQGITSWG SEPCALPERP 

       250        260 
SLYTKVVHYR KWIKDTIVAN P 

« Hide

Isoform 2 [UniParc].

Checksum: D46C6C2B210F70A4
Show »

FASTA23826,317
Isoform 3 [UniParc].

Checksum: B62C82BD085CC492
Show »

FASTA21823,725
Isoform 4 [UniParc].

Checksum: 6781B491913E35B2
Show »

FASTA697,616
Isoform 5 [UniParc].

Checksum: 2E9B482F3CC3BA12
Show »

FASTA22725,116

References

« Hide 'large scale' references
[1]"Molecular cloning of human prostate specific antigen cDNA."
Lundwall A., Lilja H.
FEBS Lett. 214:317-322(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 4-238 (ISOFORM 2), ALTERNATIVE SPLICING.
Tissue: Prostate.
[2]"Human prostate specific antigen (PSA) gene: structure and linkage to the kallikrein-like gene, hGK-1."
Digby M.R., Zhang X.Y., Richard R.I.
Nucleic Acids Res. 17:2137-2137(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Tissue: Prostate.
[3]"Genomic sequence of human prostate specific antigen (PSA)."
Klobeck H.-G., Combriato G., Schulz P., Arbusow V., Fittler F.
Nucleic Acids Res. 17:3981-3981(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[4]"Characterization of the gene for prostate-specific antigen, a human glandular kallikrein."
Lundwall A.
Biochem. Biophys. Res. Commun. 161:1151-1159(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Tissue: Leukocyte.
[5]"cDNA coding for the entire human prostate specific antigen shows high homologies to the human tissue kallikrein genes."
Henttu P., Vihko P.
Biochem. Biophys. Res. Commun. 160:903-910(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Prostate.
[6]"Characterization of the prostate-specific antigen gene: a novel human kallikrein-like gene."
Riegman P.H.J., Vlietstra R.J., van der Korput J.A.G.M., Romijn J.C., Trapman J.
Biochem. Biophys. Res. Commun. 159:95-102(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Tissue: Prostate.
[7]"A comparative analysis of prostate-specific antigen gene sequence in benign and malignant prostate tissue."
Baffa R., Moreno J.G., Monne M., Veronese M.L., Gomella L.G.
Urology 47:795-800(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Prostate.
[8]"Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region."
Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.
Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[9]"Complex alternative splicing of the hKLK3 gene coding for the tumour marker PSA (prostate-specific-antigen)."
Heuze-Vourc'h N., Courty Y.
Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING.
Tissue: Prostate.
[10]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[11]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[12]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[13]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
Tissue: PNS, Prostate and Sciatic nerve.
[14]"Molecular characterization of prostate-specific antigen messenger RNA expressed in breast tumors."
Monne M., Croce C.M., Yu H., Diamandis E.P.
Cancer Res. 54:6344-6347(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-176 (ISOFORM 1).
[15]"Sequence of a cDNA clone encompassing the complete mature human prostate specific antigen (PSA) and an unspliced leader sequence."
Schulz P., Stucka R., Feldmann H., Combriato G., Klobeck H.-G., Fittler F.
Nucleic Acids Res. 16:6226-6226(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-261 (ISOFORM 1).
[16]"Human prostate-specific antigen: structural and functional similarity with serine proteases."
Watt K.W.K., Lee P.J., M'Timkulu T., Chan W.P., Loor R.
Proc. Natl. Acad. Sci. U.S.A. 83:3166-3170(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 25-261.
[17]"Isolation, characterization and amino-acid sequence of gamma-seminoprotein, a glycoprotein from human seminal plasma."
Schaller J., Akiyama K., Tsuda R., Hara M., Marti T., Rickli E.E.
Eur. J. Biochem. 170:111-120(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 25-261.
[18]"Signal peptide prediction based on analysis of experimentally verified cleavage sites."
Zhang Z., Henzel W.J.
Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 18-32.
[19]"Identification of a novel proteoform of prostate specific antigen (SNP-L132I) in clinical samples by multiple reaction monitoring."
Vegvari A., Sjodin K., Rezeli M., Malm J., Lilja H., Laurell T., Marko-Varga G.
Mol. Cell. Proteomics 12:2761-2773(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 126-138, VARIANT ILE-132.
[20]"Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen."
Espana F., Gilabert J., Estelles A., Romeu A., Aznar J., Cabo A.
Thromb. Res. 64:309-320(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: ENZYME REGULATION, HETERODIMER WITH SERPINA5.
[21]"A structural model for the prostate disease marker, human prostate-specific antigen."
Villoutreix B.O., Getzoff E.D., Griffin J.H.
Protein Sci. 3:2033-2044(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: 3D-STRUCTURE MODELING.
[22]"Substrate specificity of prostate-specific antigen (PSA)."
Coombs G.S., Bergstrom R.C., Pellequer J.L., Baker S.I., Navre M., Smith M.M., Tainer J.A., Madison E.L., Corey D.R.
Chem. Biol. 5:475-488(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: 3D-STRUCTURE MODELING.
[23]"Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody."
Menez R., Michel S., Muller B.H., Bossus M., Ducancel F., Jolivet-Reynaud C., Stura E.A.
J. Mol. Biol. 376:1021-1033(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.83 ANGSTROMS) OF 25-261 IN COMPLEX WITH SUBSTRATE AND ACTIVATING ANTIBODY, ENZYME REGULATION, ACTIVE SITE, DISULFIDE BONDS.
+Additional computationally mapped references.

Web resources

Wikipedia

Prostate-specific antigen entry

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M21896 mRNA. Translation: AAA59996.1.
X05332 mRNA. Translation: CAA28947.1.
X13940 Genomic DNA. Translation: CAA32123.1.
X13941 Genomic DNA. Translation: CAA32124.1. Sequence problems.
X13942 Genomic DNA. Translation: CAB46487.1.
X13943 Genomic DNA. Translation: CAA32126.1.
X13944 Genomic DNA. Translation: CAA32127.1.
X14810 Genomic DNA. Translation: CAA32915.1.
M27274 Genomic DNA. Translation: AAA60192.1.
M26663 mRNA. Translation: AAA58802.1.
M24543 Genomic DNA. Translation: AAA60193.1.
U17040 mRNA. Translation: AAA56764.1.
AF243527 Genomic DNA. Translation: AAG33355.1.
AJ512346 mRNA. Translation: CAD54617.1.
BT019862 mRNA. Translation: AAV38665.1.
AC011523 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71929.1.
CH471135 Genomic DNA. Translation: EAW71930.1.
CH471135 Genomic DNA. Translation: EAW71936.1.
BC005307 mRNA. Translation: AAH05307.1.
BC050595 mRNA. Translation: AAH50595.2.
BC056665 mRNA. Translation: AAH56665.1.
BF679511 mRNA. No translation available.
BQ932072 mRNA. No translation available.
S75755 mRNA. Translation: AAD14185.1. Different initiation.
X07730 mRNA. No translation available.
CCDSCCDS12807.1. [P07288-1]
CCDS33083.1. [P07288-2]
CCDS46155.1. [P07288-3]
PIRA32297.
RefSeqNP_001025218.1. NM_001030047.1. [P07288-2]
NP_001025219.1. NM_001030048.1. [P07288-3]
NP_001639.1. NM_001648.2. [P07288-1]
UniGeneHs.171995.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1PFAmodel-A10-261[»]
2PSAmodel-A25-261[»]
2ZCHX-ray2.83P25-261[»]
2ZCKX-ray3.10P25-261[»]
2ZCLX-ray3.25P25-261[»]
3QUMX-ray3.20P/Q25-261[»]
ProteinModelPortalP07288.
SMRP07288. Positions 25-261.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid106850. 4 interactions.
IntActP07288. 4 interactions.
STRING9606.ENSP00000314151.

Chemistry

BindingDBP07288.
ChEMBLCHEMBL2099.

Protein family/group databases

Allergome2836. Hom s PSA.
MEROPSS01.162.

PTM databases

PhosphoSiteP07288.

Polymorphism databases

DMDM130989.

Proteomic databases

MaxQBP07288.
PaxDbP07288.
PRIDEP07288.

Protocols and materials databases

DNASU354.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000326003; ENSP00000314151; ENSG00000142515. [P07288-1]
ENST00000360617; ENSP00000353829; ENSG00000142515. [P07288-2]
ENST00000593997; ENSP00000472907; ENSG00000142515. [P07288-5]
ENST00000595952; ENSP00000471155; ENSG00000142515. [P07288-3]
GeneID354.
KEGGhsa:354.
UCSCuc002ptr.1. human.
uc002pts.1. human.
uc010eof.2. human. [P07288-1]

Organism-specific databases

CTD354.
GeneCardsGC19P051358.
HGNCHGNC:6364. KLK3.
HPACAB000070.
HPA000764.
MIM176820. gene.
neXtProtNX_P07288.
PharmGKBPA164741810.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5640.
HOGENOMHOG000251820.
HOVERGENHBG013304.
InParanoidP07288.
KOK01351.
OMALEIFICC.
PhylomeDBP07288.
TreeFamTF331065.

Enzyme and pathway databases

BRENDA3.4.21.77. 2681.
ReactomeREACT_17015. Metabolism of proteins.

Gene expression databases

ArrayExpressP07288.
BgeeP07288.
CleanExHS_KLK3.
GenevestigatorP07288.

Family and domain databases

InterProIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSPR00722. CHYMOTRYPSIN.
SMARTSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMSSF50494. SSF50494. 1 hit.
PROSITEPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKLK3. human.
EvolutionaryTraceP07288.
GeneWikiProstate-specific_antigen.
GenomeRNAi354.
NextBio1459.
PMAP-CutDBP07288.
PROP07288.
SOURCESearch...

Entry information

Entry nameKLK3_HUMAN
AccessionPrimary (citable) accession number: P07288
Secondary accession number(s): C9JXH3 expand/collapse secondary AC list , G3V0H4, G3XAE3, Q15096, Q16272, Q86TG8, Q8IXI4
Entry history
Integrated into UniProtKB/Swiss-Prot: April 1, 1988
Last sequence update: July 1, 1989
Last modified: July 9, 2014
This is version 170 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM