Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P07288

- KLK3_HUMAN

UniProt

P07288 - KLK3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Prostate-specific antigen

Gene

KLK3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

Catalytic activityi

Preferential cleavage: -Tyr-|-Xaa-.

Enzyme regulationi

Inhibited by SERPINA5. Activity is strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei65 – 651Charge relay system1 Publication
Active sitei120 – 1201Charge relay system1 Publication
Active sitei213 – 2131Charge relay system1 Publication

GO - Molecular functioni

  1. serine-type endopeptidase activity Source: InterPro
  2. serine-type peptidase activity Source: ProtInc

GO - Biological processi

  1. cellular protein metabolic process Source: Reactome
  2. negative regulation of angiogenesis Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Enzyme and pathway databases

BRENDAi3.4.21.77. 2681.
ReactomeiREACT_15428. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

Protein family/group databases

MEROPSiS01.162.

Names & Taxonomyi

Protein namesi
Recommended name:
Prostate-specific antigen (EC:3.4.21.77)
Short name:
PSA
Alternative name(s):
Gamma-seminoprotein
Short name:
Seminin
Kallikrein-3
P-30 antigen
Semenogelase
Gene namesi
Name:KLK3
Synonyms:APS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:6364. KLK3.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: UniProtKB
  2. extracellular vesicular exosome Source: UniProtKB
  3. nucleus Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164741810.

Protein family/group databases

Allergomei2836. Hom s PSA.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 17171 PublicationAdd
BLAST
Propeptidei18 – 247Activation peptide2 PublicationsPRO_0000027931
Chaini25 – 261237Prostate-specific antigenPRO_0000027932Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi31 ↔ 1731 PublicationPROSITE-ProRule annotation
Disulfide bondi50 ↔ 661 PublicationPROSITE-ProRule annotation
Glycosylationi69 – 691N-linked (GlcNAc...)
Disulfide bondi152 ↔ 2191 PublicationPROSITE-ProRule annotation
Disulfide bondi184 ↔ 1981 PublicationPROSITE-ProRule annotation
Disulfide bondi209 ↔ 2341 PublicationPROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

MaxQBiP07288.
PaxDbiP07288.
PRIDEiP07288.

PTM databases

PhosphoSiteiP07288.

Miscellaneous databases

PMAP-CutDBP07288.

Expressioni

Gene expression databases

BgeeiP07288.
CleanExiHS_KLK3.
ExpressionAtlasiP07288. baseline and differential.
GenevestigatoriP07288.

Organism-specific databases

HPAiCAB000070.
HPA000764.

Interactioni

Subunit structurei

Forms a heterodimer with SERPINA5.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ARP102753EBI-1220791,EBI-608057

Protein-protein interaction databases

BioGridi106850. 7 interactions.
IntActiP07288. 6 interactions.
STRINGi9606.ENSP00000314151.

Structurei

Secondary structure

1
261
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi39 – 5618Combined sources
Beta strandi59 – 624Combined sources
Helixi64 – 663Combined sources
Beta strandi72 – 765Combined sources
Beta strandi78 – 825Combined sources
Beta strandi88 – 9710Combined sources
Helixi103 – 1064Combined sources
Beta strandi107 – 1104Combined sources
Beta strandi122 – 1287Combined sources
Beta strandi134 – 1363Combined sources
Beta strandi151 – 1577Combined sources
Beta strandi160 – 1645Combined sources
Beta strandi172 – 1798Combined sources
Helixi181 – 1877Combined sources
Beta strandi189 – 1913Combined sources
Beta strandi196 – 2005Combined sources
Beta strandi216 – 22914Combined sources
Beta strandi232 – 2354Combined sources
Beta strandi241 – 2455Combined sources
Helixi246 – 2494Combined sources
Helixi250 – 2589Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1PFAmodel-A10-261[»]
2PSAmodel-A25-261[»]
2ZCHX-ray2.83P25-261[»]
2ZCKX-ray3.10P25-261[»]
2ZCLX-ray3.25P25-261[»]
3QUMX-ray3.20P/Q25-261[»]
ProteinModelPortaliP07288.
SMRiP07288. Positions 25-261.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP07288.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini25 – 258234Peptidase S1PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation
Contains 1 peptidase S1 domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG5640.
GeneTreeiENSGT00760000118862.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP07288.
KOiK01351.
OMAiLEIFICC.
PhylomeDBiP07288.
TreeFamiTF331065.

Family and domain databases

InterProiIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P07288-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWVPVVFLTL SVTWIGAAPL ILSRIVGGWE CEKHSQPWQV LVASRGRAVC
60 70 80 90 100
GGVLVHPQWV LTAAHCIRNK SVILLGRHSL FHPEDTGQVF QVSHSFPHPL
110 120 130 140 150
YDMSLLKNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT
160 170 180 190 200
TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHPQ KVTKFMLCAG
210 220 230 240 250
RWTGGKSTCS GDSGGPLVCN GVLQGITSWG SEPCALPERP SLYTKVVHYR
260
KWIKDTIVAN P
Length:261
Mass (Da):28,741
Last modified:July 1, 1989 - v2
Checksum:iAE9E732AF872141A
GO
Isoform 2 (identifier: P07288-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCN...WIKDTIVANP → WVILITELTMPALPMVLHGSLVPWRGGV

Note: No experimental confirmation available.

Show »
Length:238
Mass (Da):26,317
Checksum:iD46C6C2B210F70A4
GO
Isoform 3 (identifier: P07288-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-112: Missing.

Note: No experimental confirmation available.

Show »
Length:218
Mass (Da):23,725
Checksum:iB62C82BD085CC492
GO
Isoform 4 (identifier: P07288-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-261: Missing.

Note: No experimental confirmation available.

Show »
Length:69
Mass (Da):7,616
Checksum:i6781B491913E35B2
GO
Isoform 5 (identifier: P07288-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-260: GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVAN → VSHPYSQDLEGKGEWG

Show »
Length:227
Mass (Da):25,116
Checksum:i2E9B482F3CC3BA12
GO

Sequence cautioni

The sequence AAD14185.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAA32124.1 differs from that shown. Reason: Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti64 – 641A → T(PubMed:2456523)Curated
Sequence conflicti69 – 691N → KC in AAA60193. (PubMed:2466464)Curated
Sequence conflicti94 – 941H → T AA sequence (PubMed:2422647)Curated
Sequence conflicti136 – 1361V → M(PubMed:2456523)Curated
Sequence conflicti165 – 1684FLTP → HLLYDQM AA sequence (PubMed:2422647)Curated
Sequence conflicti175 – 1751D → Q AA sequence (PubMed:2422647)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti32 – 321E → K.
Corresponds to variant rs2271092 [ dbSNP | Ensembl ].
VAR_021941
Natural varianti132 – 1321L → I.1 Publication
Corresponds to variant rs2003783 [ dbSNP | Ensembl ].
VAR_021942
Natural varianti179 – 1791I → T.
Corresponds to variant rs17632542 [ dbSNP | Ensembl ].
VAR_051852

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei69 – 691N → K in isoform 3 and isoform 4. 1 PublicationVSP_046169
Alternative sequencei70 – 261192Missing in isoform 4. 1 PublicationVSP_046170Add
BLAST
Alternative sequencei70 – 11243Missing in isoform 3. 1 PublicationVSP_046171Add
BLAST
Alternative sequencei211 – 26151GDSGG…IVANP → WVILITELTMPALPMVLHGS LVPWRGGV in isoform 2. 1 PublicationVSP_045786Add
BLAST
Alternative sequencei211 – 26050GDSGG…TIVAN → VSHPYSQDLEGKGEWG in isoform 5. 1 PublicationVSP_047643Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M21896 mRNA. Translation: AAA59996.1.
X05332 mRNA. Translation: CAA28947.1.
X13940 Genomic DNA. Translation: CAA32123.1.
X13941 Genomic DNA. Translation: CAA32124.1. Sequence problems.
X13942 Genomic DNA. Translation: CAB46487.1.
X13943 Genomic DNA. Translation: CAA32126.1.
X13944 Genomic DNA. Translation: CAA32127.1.
X14810 Genomic DNA. Translation: CAA32915.1.
M27274 Genomic DNA. Translation: AAA60192.1.
M26663 mRNA. Translation: AAA58802.1.
M24543 Genomic DNA. Translation: AAA60193.1.
U17040 mRNA. Translation: AAA56764.1.
AF243527 Genomic DNA. Translation: AAG33355.1.
AJ512346 mRNA. Translation: CAD54617.1.
BT019862 mRNA. Translation: AAV38665.1.
AC011523 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71929.1.
CH471135 Genomic DNA. Translation: EAW71930.1.
CH471135 Genomic DNA. Translation: EAW71936.1.
BC005307 mRNA. Translation: AAH05307.1.
BC050595 mRNA. Translation: AAH50595.2.
BC056665 mRNA. Translation: AAH56665.1.
BF679511 mRNA. No translation available.
BQ932072 mRNA. No translation available.
S75755 mRNA. Translation: AAD14185.1. Different initiation.
X07730 mRNA. No translation available.
CCDSiCCDS12807.1. [P07288-1]
CCDS33083.1. [P07288-2]
CCDS46155.1. [P07288-3]
PIRiA32297.
RefSeqiNP_001025218.1. NM_001030047.1. [P07288-2]
NP_001025219.1. NM_001030048.1. [P07288-3]
NP_001639.1. NM_001648.2. [P07288-1]
UniGeneiHs.171995.

Genome annotation databases

EnsembliENST00000326003; ENSP00000314151; ENSG00000142515. [P07288-1]
ENST00000360617; ENSP00000353829; ENSG00000142515. [P07288-2]
ENST00000593997; ENSP00000472907; ENSG00000142515. [P07288-5]
ENST00000595952; ENSP00000471155; ENSG00000142515. [P07288-3]
GeneIDi354.
KEGGihsa:354.
UCSCiuc002ptr.1. human.
uc002pts.1. human.
uc010eof.2. human. [P07288-1]

Polymorphism databases

DMDMi130989.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Prostate-specific antigen entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M21896 mRNA. Translation: AAA59996.1 .
X05332 mRNA. Translation: CAA28947.1 .
X13940 Genomic DNA. Translation: CAA32123.1 .
X13941 Genomic DNA. Translation: CAA32124.1 . Sequence problems.
X13942 Genomic DNA. Translation: CAB46487.1 .
X13943 Genomic DNA. Translation: CAA32126.1 .
X13944 Genomic DNA. Translation: CAA32127.1 .
X14810 Genomic DNA. Translation: CAA32915.1 .
M27274 Genomic DNA. Translation: AAA60192.1 .
M26663 mRNA. Translation: AAA58802.1 .
M24543 Genomic DNA. Translation: AAA60193.1 .
U17040 mRNA. Translation: AAA56764.1 .
AF243527 Genomic DNA. Translation: AAG33355.1 .
AJ512346 mRNA. Translation: CAD54617.1 .
BT019862 mRNA. Translation: AAV38665.1 .
AC011523 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71929.1 .
CH471135 Genomic DNA. Translation: EAW71930.1 .
CH471135 Genomic DNA. Translation: EAW71936.1 .
BC005307 mRNA. Translation: AAH05307.1 .
BC050595 mRNA. Translation: AAH50595.2 .
BC056665 mRNA. Translation: AAH56665.1 .
BF679511 mRNA. No translation available.
BQ932072 mRNA. No translation available.
S75755 mRNA. Translation: AAD14185.1 . Different initiation.
X07730 mRNA. No translation available.
CCDSi CCDS12807.1. [P07288-1 ]
CCDS33083.1. [P07288-2 ]
CCDS46155.1. [P07288-3 ]
PIRi A32297.
RefSeqi NP_001025218.1. NM_001030047.1. [P07288-2 ]
NP_001025219.1. NM_001030048.1. [P07288-3 ]
NP_001639.1. NM_001648.2. [P07288-1 ]
UniGenei Hs.171995.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1PFA model - A 10-261 [» ]
2PSA model - A 25-261 [» ]
2ZCH X-ray 2.83 P 25-261 [» ]
2ZCK X-ray 3.10 P 25-261 [» ]
2ZCL X-ray 3.25 P 25-261 [» ]
3QUM X-ray 3.20 P/Q 25-261 [» ]
ProteinModelPortali P07288.
SMRi P07288. Positions 25-261.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 106850. 7 interactions.
IntActi P07288. 6 interactions.
STRINGi 9606.ENSP00000314151.

Chemistry

BindingDBi P07288.
ChEMBLi CHEMBL2099.

Protein family/group databases

Allergomei 2836. Hom s PSA.
MEROPSi S01.162.

PTM databases

PhosphoSitei P07288.

Polymorphism databases

DMDMi 130989.

Proteomic databases

MaxQBi P07288.
PaxDbi P07288.
PRIDEi P07288.

Protocols and materials databases

DNASUi 354.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000326003 ; ENSP00000314151 ; ENSG00000142515 . [P07288-1 ]
ENST00000360617 ; ENSP00000353829 ; ENSG00000142515 . [P07288-2 ]
ENST00000593997 ; ENSP00000472907 ; ENSG00000142515 . [P07288-5 ]
ENST00000595952 ; ENSP00000471155 ; ENSG00000142515 . [P07288-3 ]
GeneIDi 354.
KEGGi hsa:354.
UCSCi uc002ptr.1. human.
uc002pts.1. human.
uc010eof.2. human. [P07288-1 ]

Organism-specific databases

CTDi 354.
GeneCardsi GC19P051358.
HGNCi HGNC:6364. KLK3.
HPAi CAB000070.
HPA000764.
MIMi 176820. gene.
neXtProti NX_P07288.
PharmGKBi PA164741810.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5640.
GeneTreei ENSGT00760000118862.
HOGENOMi HOG000251820.
HOVERGENi HBG013304.
InParanoidi P07288.
KOi K01351.
OMAi LEIFICC.
PhylomeDBi P07288.
TreeFami TF331065.

Enzyme and pathway databases

BRENDAi 3.4.21.77. 2681.
Reactomei REACT_15428. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

Miscellaneous databases

ChiTaRSi KLK3. human.
EvolutionaryTracei P07288.
GeneWikii Prostate-specific_antigen.
GenomeRNAii 354.
NextBioi 1459.
PMAP-CutDB P07288.
PROi P07288.
SOURCEi Search...

Gene expression databases

Bgeei P07288.
CleanExi HS_KLK3.
ExpressionAtlasi P07288. baseline and differential.
Genevestigatori P07288.

Family and domain databases

InterProi IPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view ]
Pfami PF00089. Trypsin. 1 hit.
[Graphical view ]
PRINTSi PR00722. CHYMOTRYPSIN.
SMARTi SM00020. Tryp_SPc. 1 hit.
[Graphical view ]
SUPFAMi SSF50494. SSF50494. 1 hit.
PROSITEi PS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of human prostate specific antigen cDNA."
    Lundwall A., Lilja H.
    FEBS Lett. 214:317-322(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 4-238 (ISOFORM 2), ALTERNATIVE SPLICING.
    Tissue: Prostate.
  2. "Human prostate specific antigen (PSA) gene: structure and linkage to the kallikrein-like gene, hGK-1."
    Digby M.R., Zhang X.Y., Richard R.I.
    Nucleic Acids Res. 17:2137-2137(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Tissue: Prostate.
  3. "Genomic sequence of human prostate specific antigen (PSA)."
    Klobeck H.-G., Combriato G., Schulz P., Arbusow V., Fittler F.
    Nucleic Acids Res. 17:3981-3981(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "Characterization of the gene for prostate-specific antigen, a human glandular kallikrein."
    Lundwall A.
    Biochem. Biophys. Res. Commun. 161:1151-1159(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Tissue: Leukocyte.
  5. "cDNA coding for the entire human prostate specific antigen shows high homologies to the human tissue kallikrein genes."
    Henttu P., Vihko P.
    Biochem. Biophys. Res. Commun. 160:903-910(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Prostate.
  6. "Characterization of the prostate-specific antigen gene: a novel human kallikrein-like gene."
    Riegman P.H.J., Vlietstra R.J., van der Korput J.A.G.M., Romijn J.C., Trapman J.
    Biochem. Biophys. Res. Commun. 159:95-102(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Tissue: Prostate.
  7. "A comparative analysis of prostate-specific antigen gene sequence in benign and malignant prostate tissue."
    Baffa R., Moreno J.G., Monne M., Veronese M.L., Gomella L.G.
    Urology 47:795-800(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Prostate.
  8. "Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region."
    Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.
    Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  9. "Complex alternative splicing of the hKLK3 gene coding for the tumour marker PSA (prostate-specific-antigen)."
    Heuze-Vourc'h N., Courty Y.
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING.
    Tissue: Prostate.
  10. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  11. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  13. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
    Tissue: PNS, Prostate and Sciatic nerve.
  14. "Molecular characterization of prostate-specific antigen messenger RNA expressed in breast tumors."
    Monne M., Croce C.M., Yu H., Diamandis E.P.
    Cancer Res. 54:6344-6347(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-176 (ISOFORM 1).
  15. "Sequence of a cDNA clone encompassing the complete mature human prostate specific antigen (PSA) and an unspliced leader sequence."
    Schulz P., Stucka R., Feldmann H., Combriato G., Klobeck H.-G., Fittler F.
    Nucleic Acids Res. 16:6226-6226(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-261 (ISOFORM 1).
  16. "Human prostate-specific antigen: structural and functional similarity with serine proteases."
    Watt K.W.K., Lee P.J., M'Timkulu T., Chan W.P., Loor R.
    Proc. Natl. Acad. Sci. U.S.A. 83:3166-3170(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 25-261.
  17. "Isolation, characterization and amino-acid sequence of gamma-seminoprotein, a glycoprotein from human seminal plasma."
    Schaller J., Akiyama K., Tsuda R., Hara M., Marti T., Rickli E.E.
    Eur. J. Biochem. 170:111-120(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 25-261.
  18. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 18-32.
  19. "Identification of a novel proteoform of prostate specific antigen (SNP-L132I) in clinical samples by multiple reaction monitoring."
    Vegvari A., Sjodin K., Rezeli M., Malm J., Lilja H., Laurell T., Marko-Varga G.
    Mol. Cell. Proteomics 12:2761-2773(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 126-138, VARIANT ILE-132.
  20. "Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen."
    Espana F., Gilabert J., Estelles A., Romeu A., Aznar J., Cabo A.
    Thromb. Res. 64:309-320(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: ENZYME REGULATION, HETERODIMER WITH SERPINA5.
  21. "A structural model for the prostate disease marker, human prostate-specific antigen."
    Villoutreix B.O., Getzoff E.D., Griffin J.H.
    Protein Sci. 3:2033-2044(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: 3D-STRUCTURE MODELING.
  22. Cited for: 3D-STRUCTURE MODELING.
  23. "Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody."
    Menez R., Michel S., Muller B.H., Bossus M., Ducancel F., Jolivet-Reynaud C., Stura E.A.
    J. Mol. Biol. 376:1021-1033(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.83 ANGSTROMS) OF 25-261 IN COMPLEX WITH SUBSTRATE AND ACTIVATING ANTIBODY, ENZYME REGULATION, ACTIVE SITE, DISULFIDE BONDS.

Entry informationi

Entry nameiKLK3_HUMAN
AccessioniPrimary (citable) accession number: P07288
Secondary accession number(s): C9JXH3
, G3V0H4, G3XAE3, Q15096, Q16272, Q86TG8, Q8IXI4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1988
Last sequence update: July 1, 1989
Last modified: November 26, 2014
This is version 174 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3