Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostate-specific antigen

Gene

KLK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

Catalytic activityi

Preferential cleavage: -Tyr-|-Xaa-.

Enzyme regulationi

Inhibited by SERPINA5. Activity is strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei65Charge relay system1 Publication1
Active sitei120Charge relay system1 Publication1
Active sitei213Charge relay system1 Publication1

GO - Molecular functioni

  • endopeptidase activity Source: UniProtKB
  • hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Source: UniProtKB
  • serine-type endopeptidase activity Source: UniProtKB
  • serine-type peptidase activity Source: ProtInc

GO - Biological processi

  • antibacterial peptide production Source: UniProtKB
  • cellular protein metabolic process Source: Reactome
  • negative regulation of angiogenesis Source: UniProtKB
  • proteolysis Source: UniProtKB

Keywordsi

Molecular functionHydrolase, Protease, Serine protease

Enzyme and pathway databases

BRENDAi3.4.21.77 2681
ReactomeiR-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-5625886 Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
SIGNORiP07288

Protein family/group databases

MEROPSiS01.162

Names & Taxonomyi

Protein namesi
Recommended name:
Prostate-specific antigen (EC:3.4.21.77)
Short name:
PSA
Alternative name(s):
Gamma-seminoprotein
Short name:
Seminin
Kallikrein-3
P-30 antigen
Semenogelase
Gene namesi
Name:KLK3
Synonyms:APS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000142515.14
HGNCiHGNC:6364 KLK3
MIMi176820 gene
neXtProtiNX_P07288

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi354
OpenTargetsiENSG00000142515
PharmGKBiPA164741810

Protein family/group databases

Allergomei2836 Hom s PSA

Chemistry databases

ChEMBLiCHEMBL2099
GuidetoPHARMACOLOGYi2373

Polymorphism and mutation databases

BioMutaiKLK3
DMDMi130989

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 171 PublicationAdd BLAST17
PropeptideiPRO_000002793118 – 24Activation peptide2 Publications7
ChainiPRO_000002793225 – 261Prostate-specific antigenAdd BLAST237

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi31 ↔ 173PROSITE-ProRule annotation1 Publication
Disulfide bondi50 ↔ 66PROSITE-ProRule annotation1 Publication
Glycosylationi69N-linked (GlcNAc...) asparagine1
Disulfide bondi152 ↔ 219PROSITE-ProRule annotation1 Publication
Disulfide bondi184 ↔ 198PROSITE-ProRule annotation1 Publication
Disulfide bondi209 ↔ 234PROSITE-ProRule annotation1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDbiP07288
PeptideAtlasiP07288
PRIDEiP07288

PTM databases

GlyConnecti790
iPTMnetiP07288
PhosphoSitePlusiP07288
UniCarbKBiP07288

Miscellaneous databases

PMAP-CutDBiP07288

Expressioni

Gene expression databases

BgeeiENSG00000142515
CleanExiHS_KLK3
ExpressionAtlasiP07288 baseline and differential
GenevisibleiP07288 HS

Organism-specific databases

HPAiCAB000070
HPA000764

Interactioni

Subunit structurei

Forms a heterodimer with SERPINA5.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ARP102753EBI-1220791,EBI-608057

Protein-protein interaction databases

BioGridi106850, 9 interactors
CORUMiP07288
IntActiP07288, 6 interactors
STRINGi9606.ENSP00000314151

Chemistry databases

BindingDBiP07288

Structurei

Secondary structure

1261
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi39 – 56Combined sources18
Beta strandi59 – 62Combined sources4
Helixi64 – 66Combined sources3
Beta strandi72 – 76Combined sources5
Beta strandi78 – 82Combined sources5
Beta strandi88 – 97Combined sources10
Helixi103 – 106Combined sources4
Beta strandi107 – 110Combined sources4
Beta strandi122 – 128Combined sources7
Beta strandi134 – 136Combined sources3
Beta strandi151 – 157Combined sources7
Beta strandi160 – 164Combined sources5
Beta strandi172 – 179Combined sources8
Helixi181 – 187Combined sources7
Beta strandi189 – 191Combined sources3
Beta strandi196 – 200Combined sources5
Beta strandi216 – 229Combined sources14
Beta strandi232 – 235Combined sources4
Beta strandi241 – 245Combined sources5
Helixi246 – 249Combined sources4
Helixi250 – 258Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PFAmodel-A10-261[»]
2PSAmodel-A25-261[»]
2ZCHX-ray2.83P25-261[»]
2ZCKX-ray3.10P25-261[»]
2ZCLX-ray3.25P25-261[»]
3QUMX-ray3.20P/Q25-261[»]
ProteinModelPortaliP07288
SMRiP07288
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP07288

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 258Peptidase S1PROSITE-ProRule annotationAdd BLAST234

Sequence similaritiesi

Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00910000144067
HOGENOMiHOG000251820
HOVERGENiHBG013304
InParanoidiP07288
KOiK01351
PhylomeDBiP07288
TreeFamiTF331065

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P07288-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWVPVVFLTL SVTWIGAAPL ILSRIVGGWE CEKHSQPWQV LVASRGRAVC
60 70 80 90 100
GGVLVHPQWV LTAAHCIRNK SVILLGRHSL FHPEDTGQVF QVSHSFPHPL
110 120 130 140 150
YDMSLLKNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT
160 170 180 190 200
TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHPQ KVTKFMLCAG
210 220 230 240 250
RWTGGKSTCS GDSGGPLVCN GVLQGITSWG SEPCALPERP SLYTKVVHYR
260
KWIKDTIVAN P
Length:261
Mass (Da):28,741
Last modified:July 1, 1989 - v2
Checksum:iAE9E732AF872141A
GO
Isoform 2 (identifier: P07288-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCN...WIKDTIVANP → WVILITELTMPALPMVLHGSLVPWRGGV

Note: No experimental confirmation available.
Show »
Length:238
Mass (Da):26,317
Checksum:iD46C6C2B210F70A4
GO
Isoform 3 (identifier: P07288-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-112: Missing.

Note: No experimental confirmation available.
Show »
Length:218
Mass (Da):23,725
Checksum:iB62C82BD085CC492
GO
Isoform 4 (identifier: P07288-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-261: Missing.

Note: No experimental confirmation available.
Show »
Length:69
Mass (Da):7,616
Checksum:i6781B491913E35B2
GO
Isoform 5 (identifier: P07288-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-260: GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVAN → VSHPYSQDLEGKGEWG

Show »
Length:227
Mass (Da):25,116
Checksum:i2E9B482F3CC3BA12
GO

Sequence cautioni

The sequence AAD14185 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAA32124 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64A → T (PubMed:2456523).Curated1
Sequence conflicti69N → KC in AAA60193 (PubMed:2466464).Curated1
Sequence conflicti94H → T AA sequence (PubMed:2422647).Curated1
Sequence conflicti136V → M (PubMed:2456523).Curated1
Sequence conflicti165 – 168FLTP → HLLYDQM AA sequence (PubMed:2422647).Curated4
Sequence conflicti175D → Q AA sequence (PubMed:2422647).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02194132E → K. Corresponds to variant dbSNP:rs2271092Ensembl.1
Natural variantiVAR_021942132L → I1 PublicationCorresponds to variant dbSNP:rs2003783Ensembl.1
Natural variantiVAR_051852179I → T. Corresponds to variant dbSNP:rs17632542Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04616969N → K in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_04617070 – 261Missing in isoform 4. 1 PublicationAdd BLAST192
Alternative sequenceiVSP_04617170 – 112Missing in isoform 3. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_045786211 – 261GDSGG…IVANP → WVILITELTMPALPMVLHGS LVPWRGGV in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_047643211 – 260GDSGG…TIVAN → VSHPYSQDLEGKGEWG in isoform 5. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M21896 mRNA Translation: AAA59996.1
X05332 mRNA Translation: CAA28947.1
X13940 Genomic DNA Translation: CAA32123.1
X13941 Genomic DNA Translation: CAA32124.1 Sequence problems.
X13942 Genomic DNA Translation: CAB46487.1
X13943 Genomic DNA Translation: CAA32126.1
X13944 Genomic DNA Translation: CAA32127.1
X14810 Genomic DNA Translation: CAA32915.1
M27274 Genomic DNA Translation: AAA60192.1
M26663 mRNA Translation: AAA58802.1
M24543 Genomic DNA Translation: AAA60193.1
U17040 mRNA Translation: AAA56764.1
AF243527 Genomic DNA Translation: AAG33355.1
AJ512346 mRNA Translation: CAD54617.1
BT019862 mRNA Translation: AAV38665.1
AC011523 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW71929.1
CH471135 Genomic DNA Translation: EAW71930.1
CH471135 Genomic DNA Translation: EAW71936.1
BC005307 mRNA Translation: AAH05307.1
BC050595 mRNA Translation: AAH50595.2
BC056665 mRNA Translation: AAH56665.1
BF679511 mRNA No translation available.
BQ932072 mRNA No translation available.
S75755 mRNA Translation: AAD14185.1 Different initiation.
X07730 mRNA No translation available.
CCDSiCCDS12807.1 [P07288-1]
CCDS33083.1 [P07288-2]
CCDS46155.1 [P07288-3]
PIRiA32297
RefSeqiNP_001025218.1, NM_001030047.1 [P07288-2]
NP_001025219.1, NM_001030048.1 [P07288-3]
NP_001639.1, NM_001648.2 [P07288-1]
UniGeneiHs.171995

Genome annotation databases

EnsembliENST00000326003; ENSP00000314151; ENSG00000142515 [P07288-1]
ENST00000360617; ENSP00000353829; ENSG00000142515 [P07288-2]
ENST00000593997; ENSP00000472907; ENSG00000142515 [P07288-5]
ENST00000595952; ENSP00000471155; ENSG00000142515 [P07288-3]
GeneIDi354
KEGGihsa:354
UCSCiuc002ptr.2 human [P07288-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiKLK3_HUMAN
AccessioniPrimary (citable) accession number: P07288
Secondary accession number(s): C9JXH3
, G3V0H4, G3XAE3, Q15096, Q16272, Q86TG8, Q8IXI4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1988
Last sequence update: July 1, 1989
Last modified: April 25, 2018
This is version 197 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health