Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostate-specific antigen

Gene

KLK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

Catalytic activityi

Preferential cleavage: -Tyr-|-Xaa-.

Enzyme regulationi

Inhibited by SERPINA5. Activity is strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei65Charge relay system1 Publication1
Active sitei120Charge relay system1 Publication1
Active sitei213Charge relay system1 Publication1

GO - Molecular functioni

  • endopeptidase activity Source: UniProtKB
  • hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Source: UniProtKB
  • serine-type endopeptidase activity Source: UniProtKB
  • serine-type peptidase activity Source: ProtInc

GO - Biological processi

  • antibacterial peptide production Source: UniProtKB
  • cellular protein metabolic process Source: Reactome
  • negative regulation of angiogenesis Source: UniProtKB
  • proteolysis Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Enzyme and pathway databases

BioCyciZFISH:HS06931-MONOMER.
BRENDAi3.4.21.77. 2681.
ReactomeiR-HSA-381426. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).
R-HSA-5625886. Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3.

Protein family/group databases

MEROPSiS01.162.

Names & Taxonomyi

Protein namesi
Recommended name:
Prostate-specific antigen (EC:3.4.21.77)
Short name:
PSA
Alternative name(s):
Gamma-seminoprotein
Short name:
Seminin
Kallikrein-3
P-30 antigen
Semenogelase
Gene namesi
Name:KLK3
Synonyms:APS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:6364. KLK3.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • extracellular region Source: UniProtKB
  • extracellular space Source: UniProtKB
  • nucleus Source: UniProtKB
  • protein complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi354.
MalaCardsiKLK3.
OpenTargetsiENSG00000142515.
PharmGKBiPA164741810.

Protein family/group databases

Allergomei2836. Hom s PSA.

Chemistry databases

ChEMBLiCHEMBL2099.
GuidetoPHARMACOLOGYi2373.

Polymorphism and mutation databases

BioMutaiKLK3.
DMDMi130989.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 171 PublicationAdd BLAST17
PropeptideiPRO_000002793118 – 24Activation peptide2 Publications7
ChainiPRO_000002793225 – 261Prostate-specific antigenAdd BLAST237

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi31 ↔ 173PROSITE-ProRule annotation1 Publication
Disulfide bondi50 ↔ 66PROSITE-ProRule annotation1 Publication
Glycosylationi69N-linked (GlcNAc...)1
Disulfide bondi152 ↔ 219PROSITE-ProRule annotation1 Publication
Disulfide bondi184 ↔ 198PROSITE-ProRule annotation1 Publication
Disulfide bondi209 ↔ 234PROSITE-ProRule annotation1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDbiP07288.
PeptideAtlasiP07288.
PRIDEiP07288.

PTM databases

iPTMnetiP07288.
PhosphoSitePlusiP07288.
UniCarbKBiP07288.

Miscellaneous databases

PMAP-CutDBP07288.

Expressioni

Gene expression databases

BgeeiENSG00000142515.
CleanExiHS_KLK3.
ExpressionAtlasiP07288. baseline and differential.
GenevisibleiP07288. HS.

Organism-specific databases

HPAiCAB000070.
HPA000764.

Interactioni

Subunit structurei

Forms a heterodimer with SERPINA5.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ARP102753EBI-1220791,EBI-608057

Protein-protein interaction databases

BioGridi106850. 9 interactors.
IntActiP07288. 6 interactors.
STRINGi9606.ENSP00000314151.

Chemistry databases

BindingDBiP07288.

Structurei

Secondary structure

1261
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi39 – 56Combined sources18
Beta strandi59 – 62Combined sources4
Helixi64 – 66Combined sources3
Beta strandi72 – 76Combined sources5
Beta strandi78 – 82Combined sources5
Beta strandi88 – 97Combined sources10
Helixi103 – 106Combined sources4
Beta strandi107 – 110Combined sources4
Beta strandi122 – 128Combined sources7
Beta strandi134 – 136Combined sources3
Beta strandi151 – 157Combined sources7
Beta strandi160 – 164Combined sources5
Beta strandi172 – 179Combined sources8
Helixi181 – 187Combined sources7
Beta strandi189 – 191Combined sources3
Beta strandi196 – 200Combined sources5
Beta strandi216 – 229Combined sources14
Beta strandi232 – 235Combined sources4
Beta strandi241 – 245Combined sources5
Helixi246 – 249Combined sources4
Helixi250 – 258Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PFAmodel-A10-261[»]
2PSAmodel-A25-261[»]
2ZCHX-ray2.83P25-261[»]
2ZCKX-ray3.10P25-261[»]
2ZCLX-ray3.25P25-261[»]
3QUMX-ray3.20P/Q25-261[»]
ProteinModelPortaliP07288.
SMRiP07288.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP07288.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 258Peptidase S1PROSITE-ProRule annotationAdd BLAST234

Sequence similaritiesi

Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation
Contains 1 peptidase S1 domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3627. Eukaryota.
COG5640. LUCA.
GeneTreeiENSGT00760000118862.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP07288.
KOiK01351.
PhylomeDBiP07288.
TreeFamiTF331065.

Family and domain databases

CDDicd00190. Tryp_SPc. 1 hit.
InterProiIPR009003. Peptidase_S1_PA.
IPR001314. Peptidase_S1A.
IPR001254. Trypsin_dom.
IPR018114. TRYPSIN_HIS.
IPR033116. TRYPSIN_SER.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P07288-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWVPVVFLTL SVTWIGAAPL ILSRIVGGWE CEKHSQPWQV LVASRGRAVC
60 70 80 90 100
GGVLVHPQWV LTAAHCIRNK SVILLGRHSL FHPEDTGQVF QVSHSFPHPL
110 120 130 140 150
YDMSLLKNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT
160 170 180 190 200
TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHPQ KVTKFMLCAG
210 220 230 240 250
RWTGGKSTCS GDSGGPLVCN GVLQGITSWG SEPCALPERP SLYTKVVHYR
260
KWIKDTIVAN P
Length:261
Mass (Da):28,741
Last modified:July 1, 1989 - v2
Checksum:iAE9E732AF872141A
GO
Isoform 2 (identifier: P07288-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCN...WIKDTIVANP → WVILITELTMPALPMVLHGSLVPWRGGV

Note: No experimental confirmation available.
Show »
Length:238
Mass (Da):26,317
Checksum:iD46C6C2B210F70A4
GO
Isoform 3 (identifier: P07288-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-112: Missing.

Note: No experimental confirmation available.
Show »
Length:218
Mass (Da):23,725
Checksum:iB62C82BD085CC492
GO
Isoform 4 (identifier: P07288-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: N → K
     70-261: Missing.

Note: No experimental confirmation available.
Show »
Length:69
Mass (Da):7,616
Checksum:i6781B491913E35B2
GO
Isoform 5 (identifier: P07288-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-260: GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVAN → VSHPYSQDLEGKGEWG

Show »
Length:227
Mass (Da):25,116
Checksum:i2E9B482F3CC3BA12
GO

Sequence cautioni

The sequence AAD14185 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAA32124 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64A → T (PubMed:2456523).Curated1
Sequence conflicti69N → KC in AAA60193 (PubMed:2466464).Curated1
Sequence conflicti94H → T AA sequence (PubMed:2422647).Curated1
Sequence conflicti136V → M (PubMed:2456523).Curated1
Sequence conflicti165 – 168FLTP → HLLYDQM AA sequence (PubMed:2422647).Curated4
Sequence conflicti175D → Q AA sequence (PubMed:2422647).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02194132E → K.Corresponds to variant rs2271092dbSNPEnsembl.1
Natural variantiVAR_021942132L → I.1 PublicationCorresponds to variant rs2003783dbSNPEnsembl.1
Natural variantiVAR_051852179I → T.Corresponds to variant rs17632542dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04616969N → K in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_04617070 – 261Missing in isoform 4. 1 PublicationAdd BLAST192
Alternative sequenceiVSP_04617170 – 112Missing in isoform 3. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_045786211 – 261GDSGG…IVANP → WVILITELTMPALPMVLHGS LVPWRGGV in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_047643211 – 260GDSGG…TIVAN → VSHPYSQDLEGKGEWG in isoform 5. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M21896 mRNA. Translation: AAA59996.1.
X05332 mRNA. Translation: CAA28947.1.
X13940 Genomic DNA. Translation: CAA32123.1.
X13941 Genomic DNA. Translation: CAA32124.1. Sequence problems.
X13942 Genomic DNA. Translation: CAB46487.1.
X13943 Genomic DNA. Translation: CAA32126.1.
X13944 Genomic DNA. Translation: CAA32127.1.
X14810 Genomic DNA. Translation: CAA32915.1.
M27274 Genomic DNA. Translation: AAA60192.1.
M26663 mRNA. Translation: AAA58802.1.
M24543 Genomic DNA. Translation: AAA60193.1.
U17040 mRNA. Translation: AAA56764.1.
AF243527 Genomic DNA. Translation: AAG33355.1.
AJ512346 mRNA. Translation: CAD54617.1.
BT019862 mRNA. Translation: AAV38665.1.
AC011523 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71929.1.
CH471135 Genomic DNA. Translation: EAW71930.1.
CH471135 Genomic DNA. Translation: EAW71936.1.
BC005307 mRNA. Translation: AAH05307.1.
BC050595 mRNA. Translation: AAH50595.2.
BC056665 mRNA. Translation: AAH56665.1.
BF679511 mRNA. No translation available.
BQ932072 mRNA. No translation available.
S75755 mRNA. Translation: AAD14185.1. Different initiation.
X07730 mRNA. No translation available.
CCDSiCCDS12807.1. [P07288-1]
CCDS33083.1. [P07288-2]
CCDS46155.1. [P07288-3]
PIRiA32297.
RefSeqiNP_001025218.1. NM_001030047.1. [P07288-2]
NP_001025219.1. NM_001030048.1. [P07288-3]
NP_001639.1. NM_001648.2. [P07288-1]
UniGeneiHs.171995.

Genome annotation databases

EnsembliENST00000326003; ENSP00000314151; ENSG00000142515. [P07288-1]
ENST00000360617; ENSP00000353829; ENSG00000142515. [P07288-2]
ENST00000593997; ENSP00000472907; ENSG00000142515. [P07288-5]
ENST00000595952; ENSP00000471155; ENSG00000142515. [P07288-3]
GeneIDi354.
KEGGihsa:354.
UCSCiuc002ptr.2. human. [P07288-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Prostate-specific antigen entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M21896 mRNA. Translation: AAA59996.1.
X05332 mRNA. Translation: CAA28947.1.
X13940 Genomic DNA. Translation: CAA32123.1.
X13941 Genomic DNA. Translation: CAA32124.1. Sequence problems.
X13942 Genomic DNA. Translation: CAB46487.1.
X13943 Genomic DNA. Translation: CAA32126.1.
X13944 Genomic DNA. Translation: CAA32127.1.
X14810 Genomic DNA. Translation: CAA32915.1.
M27274 Genomic DNA. Translation: AAA60192.1.
M26663 mRNA. Translation: AAA58802.1.
M24543 Genomic DNA. Translation: AAA60193.1.
U17040 mRNA. Translation: AAA56764.1.
AF243527 Genomic DNA. Translation: AAG33355.1.
AJ512346 mRNA. Translation: CAD54617.1.
BT019862 mRNA. Translation: AAV38665.1.
AC011523 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71929.1.
CH471135 Genomic DNA. Translation: EAW71930.1.
CH471135 Genomic DNA. Translation: EAW71936.1.
BC005307 mRNA. Translation: AAH05307.1.
BC050595 mRNA. Translation: AAH50595.2.
BC056665 mRNA. Translation: AAH56665.1.
BF679511 mRNA. No translation available.
BQ932072 mRNA. No translation available.
S75755 mRNA. Translation: AAD14185.1. Different initiation.
X07730 mRNA. No translation available.
CCDSiCCDS12807.1. [P07288-1]
CCDS33083.1. [P07288-2]
CCDS46155.1. [P07288-3]
PIRiA32297.
RefSeqiNP_001025218.1. NM_001030047.1. [P07288-2]
NP_001025219.1. NM_001030048.1. [P07288-3]
NP_001639.1. NM_001648.2. [P07288-1]
UniGeneiHs.171995.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PFAmodel-A10-261[»]
2PSAmodel-A25-261[»]
2ZCHX-ray2.83P25-261[»]
2ZCKX-ray3.10P25-261[»]
2ZCLX-ray3.25P25-261[»]
3QUMX-ray3.20P/Q25-261[»]
ProteinModelPortaliP07288.
SMRiP07288.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106850. 9 interactors.
IntActiP07288. 6 interactors.
STRINGi9606.ENSP00000314151.

Chemistry databases

BindingDBiP07288.
ChEMBLiCHEMBL2099.
GuidetoPHARMACOLOGYi2373.

Protein family/group databases

Allergomei2836. Hom s PSA.
MEROPSiS01.162.

PTM databases

iPTMnetiP07288.
PhosphoSitePlusiP07288.
UniCarbKBiP07288.

Polymorphism and mutation databases

BioMutaiKLK3.
DMDMi130989.

Proteomic databases

PaxDbiP07288.
PeptideAtlasiP07288.
PRIDEiP07288.

Protocols and materials databases

DNASUi354.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326003; ENSP00000314151; ENSG00000142515. [P07288-1]
ENST00000360617; ENSP00000353829; ENSG00000142515. [P07288-2]
ENST00000593997; ENSP00000472907; ENSG00000142515. [P07288-5]
ENST00000595952; ENSP00000471155; ENSG00000142515. [P07288-3]
GeneIDi354.
KEGGihsa:354.
UCSCiuc002ptr.2. human. [P07288-1]

Organism-specific databases

CTDi354.
DisGeNETi354.
GeneCardsiKLK3.
HGNCiHGNC:6364. KLK3.
HPAiCAB000070.
HPA000764.
MalaCardsiKLK3.
MIMi176820. gene.
neXtProtiNX_P07288.
OpenTargetsiENSG00000142515.
PharmGKBiPA164741810.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3627. Eukaryota.
COG5640. LUCA.
GeneTreeiENSGT00760000118862.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP07288.
KOiK01351.
PhylomeDBiP07288.
TreeFamiTF331065.

Enzyme and pathway databases

BioCyciZFISH:HS06931-MONOMER.
BRENDAi3.4.21.77. 2681.
ReactomeiR-HSA-381426. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).
R-HSA-5625886. Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3.

Miscellaneous databases

ChiTaRSiKLK3. human.
EvolutionaryTraceiP07288.
GeneWikiiProstate-specific_antigen.
GenomeRNAii354.
PMAP-CutDBP07288.
PROiP07288.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000142515.
CleanExiHS_KLK3.
ExpressionAtlasiP07288. baseline and differential.
GenevisibleiP07288. HS.

Family and domain databases

CDDicd00190. Tryp_SPc. 1 hit.
InterProiIPR009003. Peptidase_S1_PA.
IPR001314. Peptidase_S1A.
IPR001254. Trypsin_dom.
IPR018114. TRYPSIN_HIS.
IPR033116. TRYPSIN_SER.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKLK3_HUMAN
AccessioniPrimary (citable) accession number: P07288
Secondary accession number(s): C9JXH3
, G3V0H4, G3XAE3, Q15096, Q16272, Q86TG8, Q8IXI4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1988
Last sequence update: July 1, 1989
Last modified: November 2, 2016
This is version 191 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.