P07108 (ACBP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 140.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Acyl-CoA-binding protein Short name=ACBP Alternative name(s): Diazepam-binding inhibitor Short name=DBI Endozepine Short name=EP | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 87 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. |
| Subunit structure | Monomer. |
| Subcellular location | Endoplasmic reticulum. Golgi apparatus. Note: Golgi localization is dependent on ligand binding. Ref.4 Ref.14 |
| Tissue specificity | Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart. Ref.3 Ref.4 |
| Sequence similarities | Belongs to the ACBP family. Contains 1 ACB (acyl-CoA-binding) domain. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P07108-1) Also known as: ACBP-1a; Short; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P07108-2) Also known as: ACBP-1b; Long; The sequence of this isoform differs from the canonical sequence as follows: 1-3: MSQ → MWGDLWLLPPASANPGTGTE | ||||||
| Isoform 3 (identifier: P07108-3) Also known as: ACBP-1c; The sequence of this isoform differs from the canonical sequence as follows: 1-3: MSQ → MPAF | ||||||
| Isoform 4 (identifier: P07108-4) Also known as: ACBP-1a1-g; The sequence of this isoform differs from the canonical sequence as follows: 1-3: MSQ → MSQHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGE | ||||||
| Isoform 5 (identifier: P07108-5) Also known as: ACBP-1g; The sequence of this isoform differs from the canonical sequence as follows: 1-3: MSQ → MERWGKGLHGLEERGDSVPIPKHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGE | ||||||
| Isoform 6 (identifier: P07108-6) Also known as: ACBP-1e; The sequence of this isoform differs from the canonical sequence as follows: 43-87: ERPGMLDFTG...VEELKKKYGI → GMQSGGWKGI...YWPSPAATLY | ||||||
| Note: Predominantly expressed in adipose tissue and hippocampus. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.10 Ref.11 | ||||||||||||||||
| Chain | 2 – 87 | 86 | Acyl-CoA-binding protein | PRO_0000214004 | |||||||||||||||
Regions | |||||||||||||||||||
| Domain | 2 – 87 | 86 | ACB | ||||||||||||||||
| Region | 29 – 33 | 5 | Acyl-CoA binding | ||||||||||||||||
Sites | |||||||||||||||||||
| Binding site | 14 | 1 | Acyl-CoA | ||||||||||||||||
| Binding site | 55 | 1 | Acyl-CoA | ||||||||||||||||
| Binding site | 74 | 1 | Acyl-CoA | ||||||||||||||||
Amino acid modifications | |||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylserine Ref.10 Ref.15 | ||||||||||||||||
| Modified residue | 8 | 1 | N6-acetyllysine Ref.15 | ||||||||||||||||
| Modified residue | 19 | 1 | N6-acetyllysine Ref.15 | ||||||||||||||||
| Modified residue | 29 | 1 | Phosphotyrosine Ref.16 | ||||||||||||||||
| Modified residue | 55 | 1 | N6-acetyllysine; alternate Ref.15 | ||||||||||||||||
| Modified residue | 55 | 1 | N6-malonyllysine; alternate Ref.18 | ||||||||||||||||
| Modified residue | 77 | 1 | N6-acetyllysine Ref.15 | ||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 1 – 3 | 3 | MSQ → MWGDLWLLPPASANPGTGTE in isoform 2. | VSP_000068 | |||||||||||||||
| Alternative sequence | 1 – 3 | 3 | MSQ → MPAF in isoform 3. | VSP_038680 | |||||||||||||||
| Alternative sequence | 1 – 3 | 3 | MSQ → MSQHRAGRRGGVGKRGVRGR ELGGQGKYGAGCSECGTRRI AARGE in isoform 4. | VSP_043437 | |||||||||||||||
| Alternative sequence | 1 – 3 | 3 | MSQ → MERWGKGLHGLEERGDSVPI PKHRAGRRGGVGKRGVRGRE LGGQGKYGAGCSECGTRRIA ARGE in isoform 5. | VSP_043438 | |||||||||||||||
| Alternative sequence | 43 – 87 | 45 | ERPGM…KKYGI → GMQSGGWKGICSSKQAQQLR LEVPGNFTLKLPEALLFRWG MVMVPEVEKTMFRILSVSSS NRIQILVLEGLYWPSPAATL Y in isoform 6. | VSP_044114 | |||||||||||||||
| Natural variant | 39 | 1 | D → N. Corresponds to variant rs8192504 [ dbSNP | Ensembl ]. | VAR_048160 | |||||||||||||||
| Natural variant | 71 | 1 | M → V. Corresponds to variant rs8192506 [ dbSNP | Ensembl ]. | VAR_048161 | |||||||||||||||
| Natural variant | 86 | 1 | G → R. Corresponds to variant rs8192507 [ dbSNP | Ensembl ]. | VAR_048162 | |||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Helix | 3 – 12 | 10 | |||||||||||||||||
| Helix | 13 – 15 | 3 | |||||||||||||||||
| Helix | 22 – 36 | 15 | |||||||||||||||||
| Helix | 50 – 60 | 11 | |||||||||||||||||
| Turn | 61 – 64 | 4 | |||||||||||||||||
| Helix | 67 – 85 | 19 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of cDNA for human diazepam binding inhibitor, a natural ligand of an allosteric regulatory site of the gamma-aminobutyric acid type A receptor." Gray P.W., Glaister D., Seeburg P.H., Guidotti A., Costa E. Proc. Natl. Acad. Sci. U.S.A. 83:7547-7551(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Bovine and human cDNA sequences encoding a putative benzodiazepine receptor ligand." Webb N.R., Rose T.M., Malik N., Marquardt H., Shoyab M., Todaro G.J., Lee D.C. DNA 6:71-79(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Identification of new acyl-CoA binding protein transcripts in human and mouse." Nitz I., Doering F., Schrezenmeir J., Burwinkel B. Int. J. Biochem. Cell Biol. 37:2395-2405(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. |
| [4] | "Identification of a novel human Acyl-CoA binding protein isoform with a unique C-terminal domain." Ludewig A.H., Nitz I., Klapper M., Doring F. IUBMB Life 63:547-552(2011) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [5] | "Specific regulation of low-abundance transcript variants encoding human Acyl-CoA binding protein (ACBP) isoforms." Nitz I., Kruse M.L., Klapper M., Doring F. J. Cell. Mol. Med. 15:909-927(2011) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 4 AND 5), ALTERNATIVE SPLICING, ALTERNATIVE PROMOTER USAGE. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [10] | "Complete amino acid sequences of bovine and human endozepines. Homology with rat diazepam binding inhibitor." Marquardt H., Todaro G.J., Shoyab M. J. Biol. Chem. 261:9727-9731(1986) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-87 (ISOFORM 1), ACETYLATION AT SER-2. Tissue: Brain. |
| [11] | "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-14 (ISOFORM 1). Tissue: Platelet. |
| [12] | "Purification and analysis of growth regulating proteins secreted by a human melanoma cell line." Apfel R., Lottspeich F., Hoppe J., Behl C., Duerr G., Bogdahn U. Melanoma Res. 2:327-336(1992) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 26-30 AND 72-87. |
| [13] | "The characterization of two diazepam binding inhibitor (DBI) transcripts in humans." Kolmer M., Rovio A., Alho H. Biochem. J. 306:327-330(1995) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [14] | "Acyl-CoA-binding protein (ACBP) localizes to the endoplasmic reticulum and Golgi in a ligand-dependent manner in mammalian cells." Hansen J.S., Faergeman N.J., Kragelund B.B., Knudsen J. Biochem. J. 410:463-472(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [15] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2; LYS-8; LYS-19; LYS-55 AND LYS-77, MASS SPECTROMETRY. |
| [16] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-29, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [17] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [18] | "The first identification of lysine malonylation substrates and its regulatory enzyme." Peng C., Lu Z., Xie Z., Cheng Z., Chen Y., Tan M., Luo H., Zhang Y., He W., Yang K., Zwaans B.M., Tishkoff D., Ho L., Lombard D., He T.C., Dai J., Verdin E., Ye Y., Zhao Y. Mol. Cell. Proteomics 10:M111.012658.01-M111.012658.12(2011) [PubMed] [Europe PMC] [Abstract] Cited for: MALONYLATION AT LYS-55. |
| [19] | "High resolution crystal structures of unliganded and liganded human liver ACBP reveal a new mode of binding for the acyl-CoA ligand." Taskinen J.P., van Aalten D.M., Knudsen J., Wierenga R.K. Proteins 66:229-238(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.4 ANGSTROMS) IN COMPLEX WITH ACYL-COENZYME A. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M14200 mRNA. Translation: AAA52171.1. M15887 mRNA. Translation: AAA35788.1. FM213123 mRNA. Translation: CAR82405.1. FM213124 mRNA. Translation: CAR82406.1. FM213125 mRNA. Translation: CAR82407.1. FM213126 mRNA. Translation: CAR82408.1. FM213127 mRNA. Translation: CAR82409.1. FM213128 mRNA. Translation: CAR82410.1. FM213131 mRNA. Translation: CAR82414.1. CR456956 mRNA. Translation: CAG33237.1. AC016736 Genomic DNA. Translation: AAY14873.1. CH471103 Genomic DNA. Translation: EAW95214.1. BC006466 mRNA. No translation available. BC062996 mRNA. Translation: AAH62996.1. AM000001 mRNA. Translation: CAJ00736.1. | ||||||||||||||||||
| IPI | IPI00010182. IPI00218836. IPI00921830. IPI00922055. IPI00965476. | ||||||||||||||||||
| PIR | NZHU. B26448. | ||||||||||||||||||
| RefSeq | NP_001073331.1. NM_001079862.1. NP_001073332.1. NM_001079863.1. NP_001171488.1. NM_001178017.1. NP_001171512.1. NM_001178041.1. NP_001171513.1. NM_001178042.1. NP_001171514.1. NM_001178043.1. NP_065438.1. NM_020548.6. | ||||||||||||||||||
| UniGene | Hs.78888. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P07108. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | P07108. 1 interaction. | ||||||||||||||||||
| MINT | MINT-1394907. | ||||||||||||||||||
| STRING | 9606.ENSP00000311117. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P07108. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 118276. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P07108. | ||||||||||||||||||
| PRIDE | P07108. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 1622. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000311521; ENSP00000311117; ENSG00000155368. ENST00000355857; ENSP00000348116; ENSG00000155368. ENST00000393103; ENSP00000376815; ENSG00000155368. ENST00000409094; ENSP00000386486; ENSG00000155368. ENST00000535617; ENSP00000442917; ENSG00000155368. ENST00000535757; ENSP00000439012; ENSG00000155368. ENST00000542275; ENSP00000440698; ENSG00000155368. | ||||||||||||||||||
| GeneID | 1622. | ||||||||||||||||||
| KEGG | hsa:1622. | ||||||||||||||||||
| UCSC | uc002tlv.3. human. uc002tlx.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 1622. | ||||||||||||||||||
| GeneCards | GC02P120124. | ||||||||||||||||||
| HGNC | HGNC:2690. DBI. | ||||||||||||||||||
| HPA | CAB008595. | ||||||||||||||||||
| MIM | 125950. gene. | ||||||||||||||||||
| neXtProt | NX_P07108. | ||||||||||||||||||
| PharmGKB | PA27158. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG4281. | ||||||||||||||||||
| HOVERGEN | HBG000398. | ||||||||||||||||||
| KO | K08762. | ||||||||||||||||||
| OMA | GDNTTDK. | ||||||||||||||||||
| OrthoDB | EOG4GF3GS. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P07108. | ||||||||||||||||||
| Bgee | P07108. | ||||||||||||||||||
| CleanEx | HS_DBI. | ||||||||||||||||||
| Genevestigator | P07108. | ||||||||||||||||||
| GermOnline | ENSG00000155368. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.20.80.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR022408. Acyl-CoA-binding_prot_CS. IPR000582. Acyl-CoA-binding_protein. IPR014352. FERM/acyl-CoA-bd_prot_3-hlx. [Graphical view] | ||||||||||||||||||
| Pfam | PF00887. ACBP. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00689. ACOABINDINGP. | ||||||||||||||||||
| SUPFAM | SSF47027. ACBP. 1 hit. | ||||||||||||||||||
| PROSITE | PS00880. ACB_1. 1 hit. PS51228. ACB_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | DBI. human. | ||||||||||||||||||
| EvolutionaryTrace | P07108. | ||||||||||||||||||
| GenomeRNAi | 1622. | ||||||||||||||||||
| NextBio | 6658. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | ACBP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P07108 Secondary accession number(s): B8ZWD2 Q9UCI8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
