Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acyl-CoA-binding protein

Gene

DBI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei14Acyl-CoA1
Binding sitei55Acyl-CoA1
Binding sitei74Acyl-CoA1

GO - Molecular functioni

  • benzodiazepine receptor binding Source: ProtInc
  • lipid binding Source: UniProtKB-KW
  • long-chain fatty acyl-CoA binding Source: UniProtKB
  • protein dimerization activity Source: UniProtKB

GO - Biological processi

  • phosphatidylcholine acyl-chain remodeling Source: UniProtKB
  • transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000155368-MONOMER.
ReactomeiR-HSA-75105. Fatty Acyl-CoA Biosynthesis.
SIGNORiP07108.

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-CoA-binding protein
Short name:
ACBP
Alternative name(s):
Diazepam-binding inhibitor
Short name:
DBI
Endozepine
Short name:
EP
Gene namesi
Name:DBI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:2690. DBI.

Subcellular locationi

GO - Cellular componenti

  • endoplasmic reticulum Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
  • Golgi apparatus Source: UniProtKB
  • perinuclear endoplasmic reticulum Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus

Pathology & Biotechi

Organism-specific databases

DisGeNETi1622.
OpenTargetsiENSG00000155368.
PharmGKBiPA27158.

Polymorphism and mutation databases

BioMutaiDBI.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00002140042 – 87Acyl-CoA-binding proteinAdd BLAST86

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1 Publication1
Modified residuei8N6-acetyllysine; alternateCombined sources1
Modified residuei8N6-succinyllysine; alternateBy similarity1
Modified residuei17N6-succinyllysineBy similarity1
Modified residuei19N6-acetyllysineCombined sources1
Modified residuei29PhosphotyrosineCombined sources1
Modified residuei55N6-acetyllysine; alternateCombined sources1
Modified residuei55N6-malonyllysine; alternate1 Publication1
Modified residuei55N6-succinyllysine; alternateBy similarity1
Modified residuei77N6-acetyllysine; alternateCombined sources1
Modified residuei77N6-succinyllysine; alternateBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP07108.
MaxQBiP07108.
PaxDbiP07108.
PeptideAtlasiP07108.
PRIDEiP07108.
TopDownProteomicsiP07108-1. [P07108-1]
P07108-3. [P07108-3]
P07108-4. [P07108-4]
P07108-5. [P07108-5]

PTM databases

iPTMnetiP07108.
PhosphoSitePlusiP07108.
SwissPalmiP07108.

Expressioni

Tissue specificityi

Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.2 Publications

Gene expression databases

BgeeiENSG00000155368.
CleanExiHS_DBI.
ExpressionAtlasiP07108. baseline and differential.
GenevisibleiP07108. HS.

Organism-specific databases

HPAiHPA051428.

Interactioni

Subunit structurei

Monomer.1 Publication

GO - Molecular functioni

  • benzodiazepine receptor binding Source: ProtInc
  • protein dimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi107990. 20 interactors.
IntActiP07108. 14 interactors.
MINTiMINT-1394907.
STRINGi9606.ENSP00000440698.

Structurei

Secondary structure

187
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi3 – 12Combined sources10
Helixi13 – 15Combined sources3
Helixi22 – 36Combined sources15
Helixi50 – 60Combined sources11
Turni61 – 64Combined sources4
Helixi67 – 85Combined sources19

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CB8X-ray1.40A/B2-87[»]
2FJ9X-ray1.60A2-87[»]
ProteinModelPortaliP07108.
SMRiP07108.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP07108.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 87ACBPROSITE-ProRule annotationAdd BLAST86

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni29 – 33Acyl-CoA binding5

Sequence similaritiesi

Belongs to the ACBP family.Curated
Contains 1 ACB (acyl-CoA-binding) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0817. Eukaryota.
COG4281. LUCA.
GeneTreeiENSGT00840000129776.
HOGENOMiHOG000261845.
HOVERGENiHBG000398.
InParanoidiP07108.
KOiK08762.
OrthoDBiEOG091G0NXJ.
PhylomeDBiP07108.
TreeFamiTF335802.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
InterProiIPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view]
PfamiPF00887. ACBP. 1 hit.
[Graphical view]
PRINTSiPR00689. ACOABINDINGP.
SUPFAMiSSF47027. SSF47027. 1 hit.
PROSITEiPS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P07108-1) [UniParc]FASTAAdd to basket
Also known as: ACBP-1a, Short

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF
60 70 80
TGKAKWDAWN ELKGTSKEDA MKAYINKVEE LKKKYGI
Length:87
Mass (Da):10,044
Last modified:January 23, 2007 - v2
Checksum:iB343A309F1B1AE28
GO
Isoform 2 (identifier: P07108-2) [UniParc]FASTAAdd to basket
Also known as: ACBP-1b, Long

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MWGDLWLLPPASANPGTGTE

Show »
Length:104
Mass (Da):11,793
Checksum:i54D0238ABE40BCD2
GO
Isoform 3 (identifier: P07108-3) [UniParc]FASTAAdd to basket
Also known as: ACBP-1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MPAF

Show »
Length:88
Mass (Da):10,145
Checksum:iF4FFCEBA6D9D4330
GO
Isoform 4 (identifier: P07108-4) [UniParc]FASTAAdd to basket
Also known as: ACBP-1a1-g

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MSQHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGE

Show »
Length:129
Mass (Da):14,367
Checksum:iA3985333C4BE1F8F
GO
Isoform 5 (identifier: P07108-5) [UniParc]FASTAAdd to basket
Also known as: ACBP-1g

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSQ → MERWGKGLHGLEERGDSVPIPKHRAGRRGGVGKRGVRGRELGGQGKYGAGCSECGTRRIAARGE

Show »
Length:148
Mass (Da):16,495
Checksum:i29F51D3DA08F300B
GO
Isoform 6 (identifier: P07108-6) [UniParc]FASTAAdd to basket
Also known as: ACBP-1e

The sequence of this isoform differs from the canonical sequence as follows:
     43-87: ERPGMLDFTG...VEELKKKYGI → GMQSGGWKGI...YWPSPAATLY

Note: Predominantly expressed in adipose tissue and hippocampus.
Show »
Length:123
Mass (Da):13,911
Checksum:i61407128B4E7B1DD
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04816039D → N.Corresponds to variant rs8192504dbSNPEnsembl.1
Natural variantiVAR_04816171M → V.Corresponds to variant rs8192506dbSNPEnsembl.1
Natural variantiVAR_04816286G → R.Corresponds to variant rs8192507dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0000681 – 3MSQ → MWGDLWLLPPASANPGTGTE in isoform 2. 3 Publications3
Alternative sequenceiVSP_0386801 – 3MSQ → MPAF in isoform 3. 1 Publication3
Alternative sequenceiVSP_0434371 – 3MSQ → MSQHRAGRRGGVGKRGVRGR ELGGQGKYGAGCSECGTRRI AARGE in isoform 4. 1 Publication3
Alternative sequenceiVSP_0434381 – 3MSQ → MERWGKGLHGLEERGDSVPI PKHRAGRRGGVGKRGVRGRE LGGQGKYGAGCSECGTRRIA ARGE in isoform 5. 1 Publication3
Alternative sequenceiVSP_04411443 – 87ERPGM…KKYGI → GMQSGGWKGICSSKQAQQLR LEVPGNFTLKLPEALLFRWG MVMVPEVEKTMFRILSVSSS NRIQILVLEGLYWPSPAATL Y in isoform 6. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14200 mRNA. Translation: AAA52171.1.
M15887 mRNA. Translation: AAA35788.1.
FM213123 mRNA. Translation: CAR82405.1.
FM213124 mRNA. Translation: CAR82406.1.
FM213125 mRNA. Translation: CAR82407.1.
FM213126 mRNA. Translation: CAR82408.1.
FM213127 mRNA. Translation: CAR82409.1.
FM213128 mRNA. Translation: CAR82410.1.
FM213131 mRNA. Translation: CAR82414.1.
CR456956 mRNA. Translation: CAG33237.1.
AC016736 Genomic DNA. Translation: AAY14873.1.
CH471103 Genomic DNA. Translation: EAW95214.1.
BC006466 mRNA. No translation available.
BC062996 mRNA. Translation: AAH62996.1.
AM000001 mRNA. Translation: CAJ00736.1.
CCDSiCCDS2126.1. [P07108-2]
CCDS42740.1. [P07108-1]
CCDS42741.1. [P07108-3]
CCDS54390.1. [P07108-4]
CCDS54391.1. [P07108-5]
PIRiB26448. NZHU.
RefSeqiNP_001073331.1. NM_001079862.2. [P07108-1]
NP_001073332.1. NM_001079863.1. [P07108-3]
NP_001171488.1. NM_001178017.1. [P07108-5]
NP_001171512.1. NM_001178041.2. [P07108-4]
NP_001171513.1. NM_001178042.2. [P07108-2]
NP_001269562.1. NM_001282633.1. [P07108-2]
NP_001269563.1. NM_001282634.1. [P07108-2]
NP_001269564.1. NM_001282635.1. [P07108-2]
NP_065438.1. NM_020548.7. [P07108-2]
UniGeneiHs.78888.

Genome annotation databases

EnsembliENST00000311521; ENSP00000311117; ENSG00000155368. [P07108-2]
ENST00000355857; ENSP00000348116; ENSG00000155368. [P07108-1]
ENST00000393103; ENSP00000376815; ENSG00000155368. [P07108-3]
ENST00000409094; ENSP00000386486; ENSG00000155368. [P07108-2]
ENST00000535757; ENSP00000439012; ENSG00000155368. [P07108-2]
ENST00000627093; ENSP00000486281; ENSG00000155368. [P07108-4]
ENST00000627305; ENSP00000486361; ENSG00000155368. [P07108-5]
GeneIDi1622.
KEGGihsa:1622.
UCSCiuc002tlv.5. human. [P07108-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14200 mRNA. Translation: AAA52171.1.
M15887 mRNA. Translation: AAA35788.1.
FM213123 mRNA. Translation: CAR82405.1.
FM213124 mRNA. Translation: CAR82406.1.
FM213125 mRNA. Translation: CAR82407.1.
FM213126 mRNA. Translation: CAR82408.1.
FM213127 mRNA. Translation: CAR82409.1.
FM213128 mRNA. Translation: CAR82410.1.
FM213131 mRNA. Translation: CAR82414.1.
CR456956 mRNA. Translation: CAG33237.1.
AC016736 Genomic DNA. Translation: AAY14873.1.
CH471103 Genomic DNA. Translation: EAW95214.1.
BC006466 mRNA. No translation available.
BC062996 mRNA. Translation: AAH62996.1.
AM000001 mRNA. Translation: CAJ00736.1.
CCDSiCCDS2126.1. [P07108-2]
CCDS42740.1. [P07108-1]
CCDS42741.1. [P07108-3]
CCDS54390.1. [P07108-4]
CCDS54391.1. [P07108-5]
PIRiB26448. NZHU.
RefSeqiNP_001073331.1. NM_001079862.2. [P07108-1]
NP_001073332.1. NM_001079863.1. [P07108-3]
NP_001171488.1. NM_001178017.1. [P07108-5]
NP_001171512.1. NM_001178041.2. [P07108-4]
NP_001171513.1. NM_001178042.2. [P07108-2]
NP_001269562.1. NM_001282633.1. [P07108-2]
NP_001269563.1. NM_001282634.1. [P07108-2]
NP_001269564.1. NM_001282635.1. [P07108-2]
NP_065438.1. NM_020548.7. [P07108-2]
UniGeneiHs.78888.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CB8X-ray1.40A/B2-87[»]
2FJ9X-ray1.60A2-87[»]
ProteinModelPortaliP07108.
SMRiP07108.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107990. 20 interactors.
IntActiP07108. 14 interactors.
MINTiMINT-1394907.
STRINGi9606.ENSP00000440698.

PTM databases

iPTMnetiP07108.
PhosphoSitePlusiP07108.
SwissPalmiP07108.

Polymorphism and mutation databases

BioMutaiDBI.

Proteomic databases

EPDiP07108.
MaxQBiP07108.
PaxDbiP07108.
PeptideAtlasiP07108.
PRIDEiP07108.
TopDownProteomicsiP07108-1. [P07108-1]
P07108-3. [P07108-3]
P07108-4. [P07108-4]
P07108-5. [P07108-5]

Protocols and materials databases

DNASUi1622.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311521; ENSP00000311117; ENSG00000155368. [P07108-2]
ENST00000355857; ENSP00000348116; ENSG00000155368. [P07108-1]
ENST00000393103; ENSP00000376815; ENSG00000155368. [P07108-3]
ENST00000409094; ENSP00000386486; ENSG00000155368. [P07108-2]
ENST00000535757; ENSP00000439012; ENSG00000155368. [P07108-2]
ENST00000627093; ENSP00000486281; ENSG00000155368. [P07108-4]
ENST00000627305; ENSP00000486361; ENSG00000155368. [P07108-5]
GeneIDi1622.
KEGGihsa:1622.
UCSCiuc002tlv.5. human. [P07108-1]

Organism-specific databases

CTDi1622.
DisGeNETi1622.
GeneCardsiDBI.
HGNCiHGNC:2690. DBI.
HPAiHPA051428.
MIMi125950. gene.
neXtProtiNX_P07108.
OpenTargetsiENSG00000155368.
PharmGKBiPA27158.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0817. Eukaryota.
COG4281. LUCA.
GeneTreeiENSGT00840000129776.
HOGENOMiHOG000261845.
HOVERGENiHBG000398.
InParanoidiP07108.
KOiK08762.
OrthoDBiEOG091G0NXJ.
PhylomeDBiP07108.
TreeFamiTF335802.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000155368-MONOMER.
ReactomeiR-HSA-75105. Fatty Acyl-CoA Biosynthesis.
SIGNORiP07108.

Miscellaneous databases

ChiTaRSiDBI. human.
EvolutionaryTraceiP07108.
GeneWikiiDiazepam_binding_inhibitor.
GenomeRNAii1622.
PROiP07108.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000155368.
CleanExiHS_DBI.
ExpressionAtlasiP07108. baseline and differential.
GenevisibleiP07108. HS.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
InterProiIPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view]
PfamiPF00887. ACBP. 1 hit.
[Graphical view]
PRINTSiPR00689. ACOABINDINGP.
SUPFAMiSSF47027. SSF47027. 1 hit.
PROSITEiPS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiACBP_HUMAN
AccessioniPrimary (citable) accession number: P07108
Secondary accession number(s): B8ZWD2
, B8ZWD6, B8ZWD7, P08869, Q4VWZ6, Q53SQ7, Q6IB48, Q9UCI8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1988
Last sequence update: January 23, 2007
Last modified: November 2, 2016
This is version 176 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.