Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin alpha-V

Gene

ITGAV

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. ITGAV:ITGB3 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed:23125415). ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed:20682778). ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling (PubMed:18441324). ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling (PubMed:28302677). ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed:19578119). ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling (PubMed:28873464). ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling (PubMed:29030430). ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:18635536, PubMed:25398877). ITGAV:ITGB3 and ITGAV:ITGB6 act as a receptor for fibrillin-1 (FBN1) and mediate R-G-D-dependent cell adhesion to FBN1 (PubMed:12807887, PubMed:17158881).11 Publications
(Microbial infection) Integrin ITGAV:ITGB5 acts as a receptor for Adenovirus type C.1 Publication
(Microbial infection) Integrin ITGAV:ITGB5 and ITGAV:ITGB3 act as receptors for Coxsackievirus A9 and B1.3 Publications
(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Herpes virus 8/HHV-8.1 Publication
(Microbial infection) Integrin ITGAV:ITGB6 acts as a receptor for herpes simplex 1/HHV-1.1 Publication
(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Human parechovirus 1.1 Publication
(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for West nile virus.1 Publication
(Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi260 – 268Sequence analysis9
Calcium bindingi314 – 322Sequence analysis9
Calcium bindingi379 – 387Sequence analysis9
Calcium bindingi443 – 451Sequence analysis9

GO - Molecular functioni

  • coreceptor activity Source: UniProtKB
  • extracellular matrix binding Source: UniProtKB
  • extracellular matrix protein binding Source: UniProtKB
  • fibronectin binding Source: UniProtKB
  • integrin binding Source: BHF-UCL
  • metal ion binding Source: UniProtKB-KW
  • opsonin binding Source: Ensembl
  • peptide binding Source: Ensembl
  • protease binding Source: UniProtKB
  • protein kinase C binding Source: Ensembl
  • transforming growth factor beta binding Source: BHF-UCL
  • virus receptor activity Source: UniProtKB-KW
  • voltage-gated calcium channel activity Source: UniProtKB

GO - Biological processi

  • angiogenesis Source: UniProtKB
  • antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent Source: Reactome
  • apolipoprotein A-I-mediated signaling pathway Source: UniProtKB
  • apoptotic cell clearance Source: BHF-UCL
  • calcium ion transmembrane transport Source: UniProtKB
  • cell adhesion Source: BHF-UCL
  • cell adhesion mediated by integrin Source: UniProtKB
  • cell-matrix adhesion Source: UniProtKB
  • cell-substrate adhesion Source: UniProtKB
  • endodermal cell differentiation Source: UniProtKB
  • entry of symbiont into host cell by promotion of host phagocytosis Source: BHF-UCL
  • ERK1 and ERK2 cascade Source: BHF-UCL
  • extracellular matrix organization Source: Reactome
  • extrinsic apoptotic signaling pathway in absence of ligand Source: BHF-UCL
  • heterotypic cell-cell adhesion Source: UniProtKB
  • integrin-mediated signaling pathway Source: UniProtKB
  • leukocyte migration Source: Reactome
  • negative chemotaxis Source: UniProtKB
  • negative regulation of entry of bacterium into host cell Source: BHF-UCL
  • negative regulation of extrinsic apoptotic signaling pathway Source: BHF-UCL
  • negative regulation of lipid storage Source: BHF-UCL
  • negative regulation of lipid transport Source: BHF-UCL
  • negative regulation of lipoprotein metabolic process Source: BHF-UCL
  • negative regulation of low-density lipoprotein particle receptor biosynthetic process Source: BHF-UCL
  • negative regulation of macrophage derived foam cell differentiation Source: BHF-UCL
  • neutrophil degranulation Source: Reactome
  • positive regulation of cell adhesion Source: BHF-UCL
  • positive regulation of cell migration Source: Ensembl
  • positive regulation of cell proliferation Source: BHF-UCL
  • positive regulation of cytosolic calcium ion concentration Source: Ensembl
  • positive regulation of MAPK cascade Source: Ensembl
  • positive regulation of osteoblast proliferation Source: Ensembl
  • regulation of phagocytosis Source: BHF-UCL
  • substrate adhesion-dependent cell spreading Source: UniProtKB
  • transforming growth factor-beta secretion Source: Ensembl
  • vascular endothelial growth factor receptor signaling pathway Source: Reactome
  • vasculogenesis Source: Ensembl
  • viral entry into host cell Source: UniProtKB

Keywordsi

Molecular functionHost cell receptor for virus entry, Integrin, Receptor
Biological processCell adhesion, Host-virus interaction
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-1236973 Cross-presentation of particulate exogenous antigens (phagosomes)
R-HSA-1566948 Elastic fibre formation
R-HSA-210990 PECAM1 interactions
R-HSA-2129379 Molecules associated with elastic fibres
R-HSA-216083 Integrin cell surface interactions
R-HSA-3000157 Laminin interactions
R-HSA-3000170 Syndecan interactions
R-HSA-3000178 ECM proteoglycans
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-445144 Signal transduction by L1
R-HSA-6798695 Neutrophil degranulation
SignaLinkiP06756
SIGNORiP06756

Protein family/group databases

TCDBi8.A.54.1.4 the integrin (integrin) family

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin alpha-V
Alternative name(s):
Vitronectin receptorImported
Vitronectin receptor subunit alpha
CD_antigen: CD51
Cleaved into the following 2 chains:
Gene namesi
Name:ITGAVImported
Synonyms:MSK8Imported, VNRAImported, VTNRImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000138448.11
HGNCiHGNC:6150 ITGAV
MIMi193210 gene
neXtProtiNX_P06756

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini31 – 992ExtracellularSequence analysisAdd BLAST962
Transmembranei993 – 1016HelicalSequence analysisAdd BLAST24
Topological domaini1017 – 1048CytoplasmicSequence analysisAdd BLAST32

Keywords - Cellular componenti

Cell junction, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3685
OpenTargetsiENSG00000138448
PharmGKBiPA37336

Chemistry databases

ChEMBLiCHEMBL3660
DrugBankiDB00098 Anti-thymocyte Globulin (Rabbit)
GuidetoPHARMACOLOGYi2453

Polymorphism and mutation databases

DMDMi143811408

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 301 PublicationAdd BLAST30
ChainiPRO_000001630131 – 1048Integrin alpha-VAdd BLAST1018
ChainiPRO_000001630231 – 889Integrin alpha-V heavy chainAdd BLAST859
ChainiPRO_0000016303891 – 1048Integrin alpha-V light chainAdd BLAST158

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi74N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi89 ↔ 971 Publication
Disulfide bondi138 ↔ 1581 Publication
Disulfide bondi172 ↔ 1851 Publication
Glycosylationi290N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi296N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi488N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi491 ↔ 5021 Publication
Disulfide bondi508 ↔ 5651 Publication
Glycosylationi554N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi615N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi626 ↔ 6321 Publication
Disulfide bondi698 ↔ 7111 Publication
Glycosylationi704N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi835N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi851N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi852 ↔ 914Interchain (between heavy and light chains)1 Publication
Glycosylationi874N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi904 ↔ 9091 Publication
Glycosylationi945N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi973N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi980N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

EPDiP06756
MaxQBiP06756
PaxDbiP06756
PeptideAtlasiP06756
PRIDEiP06756

PTM databases

iPTMnetiP06756
PhosphoSitePlusiP06756

Miscellaneous databases

PMAP-CutDBB0LPF4

Expressioni

Gene expression databases

BgeeiENSG00000138448
CleanExiHS_ITGAV
ExpressionAtlasiP06756 baseline and differential
GenevisibleiP06756 HS

Organism-specific databases

HPAiCAB002499
HPA004856

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-V (ITGAV) associates with either beta-1 (ITGB1), beta-3 (ITGB3), beta-5 (ITGB5), beta-6 (ITGB6) or beta-8 (ITGB8). Interacts with CIB1 (PubMed:24011356). Interacts with RAB25 (PubMed:17925226). Integrins ITGAV:ITGB3 and ITGAV:ITGB5 interact with FBLN5 (via N-terminus) (By similarity). ITGAV:ITGB3 and ITGAV:ITGB5 interact with NOV (PubMed:12695522). ITGAV:ITGB3 interacts with ADGRA2 (PubMed:16982628). ITGAV:ITGB3 interacts with FGF2; it is likely that FGF2 can simultaneously bind ITGAV:ITGB3 and FGF receptors (PubMed:28302677). ITGAV:ITGB3 interacts with IL1B (PubMed:29030430). ITGAV:ITGB3 is found in a ternary complex with CX3CR1 and CX3CL1 (PubMed:23125415). ITGAV:ITGB3 is found in a ternary complex with NRG1 and ERBB3 (PubMed:20682778). ITGAV:ITGB3 is found in a ternary complex with FGF1 and FGFR1 (PubMed:18441324). ITGAV:ITGB3 is found in a ternary complex with IGF1 and IGF1R (PubMed:19578119). ITGAV:ITGB3 interacts with IGF2 (PubMed:28873464). ITGAV:ITGB3 and ITGAV:ITGB6 interact with FBN1 (PubMed:12807887, PubMed:17158881). ITGAV:ITGB3 interacts with CD9, CD81 and CD151 (via second extracellular domain) (PubMed:27993971).By similarity16 Publications
(Microbial infection) Integrin ITGAV:ITGB3 interacts with herpes virus 8/HHV-8 envelope glycoprotein B.1 Publication
(Microbial infection) Integrin ITGAV:ITGB3 and ITGAV:ITGB6 bind to coxsackievirus A9 and coxsackievirus B1 capsid proteins (PubMed:9426447, PubMed:15194773, PubMed:7519807).3 Publications
(Microbial infection) Integrin ITGAV:ITGB6 interacts with herpes simplex 1/HHV-1 envelope glycoprotein H.1 Publication
(Microbial infection) Integrin ITGAV:ITGB5 interacts with adenovirus type C penton protein.1 Publication
(Microbial infection) Integrin ITGAV:ITGB3 interacts with Human parechovirus 1 capsid proteins.1 Publication
(Microbial infection) Integrin ITGAV:ITGB3 interacts with West nile virus envelope protein E.1 Publication
(Microbial infection) Interacts with HIV-1 Tat.1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • extracellular matrix protein binding Source: UniProtKB
  • fibronectin binding Source: UniProtKB
  • integrin binding Source: BHF-UCL
  • opsonin binding Source: Ensembl
  • protease binding Source: UniProtKB
  • protein kinase C binding Source: Ensembl
  • transforming growth factor beta binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi109891, 71 interactors
CORUMiP06756
DIPiDIP-31785N
ELMiP06756
IntActiP06756, 20 interactors
MINTiP06756
STRINGi9606.ENSP00000261023

Chemistry databases

BindingDBiP06756

Structurei

Secondary structure

11048
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi39 – 42Combined sources4
Turni45 – 50Combined sources6
Beta strandi51 – 56Combined sources6
Beta strandi60 – 62Combined sources3
Beta strandi65 – 70Combined sources6
Beta strandi85 – 95Combined sources11
Beta strandi97 – 100Combined sources4
Beta strandi109 – 111Combined sources3
Beta strandi114 – 118Combined sources5
Beta strandi126 – 131Combined sources6
Beta strandi134 – 139Combined sources6
Beta strandi147 – 150Combined sources4
Beta strandi157 – 162Combined sources6
Beta strandi165 – 169Combined sources5
Beta strandi174 – 176Combined sources3
Turni178 – 184Combined sources7
Beta strandi189 – 193Combined sources5
Beta strandi197 – 203Combined sources7
Helixi206 – 209Combined sources4
Beta strandi211 – 217Combined sources7
Helixi218 – 223Combined sources6
Beta strandi235 – 239Combined sources5
Helixi245 – 247Combined sources3
Beta strandi254 – 259Combined sources6
Beta strandi261 – 266Combined sources6
Beta strandi268 – 273Combined sources6
Helixi276 – 279Combined sources4
Beta strandi282 – 286Combined sources5
Turni288 – 290Combined sources3
Beta strandi293 – 298Combined sources6
Beta strandi308 – 313Combined sources6
Beta strandi316 – 319Combined sources4
Beta strandi322 – 327Combined sources6
Beta strandi331 – 333Combined sources3
Beta strandi335 – 337Combined sources3
Beta strandi339 – 341Combined sources3
Beta strandi344 – 350Combined sources7
Beta strandi352 – 354Combined sources3
Beta strandi356 – 362Combined sources7
Beta strandi364 – 368Combined sources5
Helixi370 – 372Combined sources3
Beta strandi374 – 378Combined sources5
Beta strandi383 – 385Combined sources3
Beta strandi387 – 392Combined sources6
Helixi397 – 399Combined sources3
Beta strandi402 – 409Combined sources8
Beta strandi410 – 413Combined sources4
Beta strandi418 – 422Combined sources5
Beta strandi428 – 430Combined sources3
Beta strandi436 – 442Combined sources7
Beta strandi447 – 449Combined sources3
Beta strandi451 – 456Combined sources6
Helixi457 – 459Combined sources3
Beta strandi461 – 465Combined sources5
Beta strandi470 – 485Combined sources16
Beta strandi494 – 499Combined sources6
Beta strandi502 – 512Combined sources11
Beta strandi514 – 516Combined sources3
Beta strandi519 – 528Combined sources10
Turni529 – 532Combined sources4
Beta strandi535 – 537Combined sources3
Beta strandi541 – 543Combined sources3
Turni544 – 546Combined sources3
Beta strandi547 – 558Combined sources12
Beta strandi559 – 561Combined sources3
Beta strandi564 – 572Combined sources9
Helixi575 – 577Combined sources3
Beta strandi585 – 593Combined sources9
Turni595 – 597Combined sources3
Beta strandi601 – 603Combined sources3
Beta strandi610 – 612Combined sources3
Beta strandi614 – 623Combined sources10
Turni627 – 630Combined sources4
Beta strandi636 – 641Combined sources6
Beta strandi646 – 648Combined sources3
Beta strandi653 – 663Combined sources11
Beta strandi668 – 670Combined sources3
Beta strandi672 – 676Combined sources5
Beta strandi681 – 686Combined sources6
Beta strandi691 – 693Combined sources3
Beta strandi697 – 701Combined sources5
Beta strandi703 – 705Combined sources3
Beta strandi708 – 712Combined sources5
Beta strandi715 – 717Combined sources3
Beta strandi722 – 731Combined sources10
Beta strandi735 – 737Combined sources3
Beta strandi739 – 748Combined sources10
Beta strandi752 – 754Combined sources3
Beta strandi760 – 767Combined sources8
Beta strandi772 – 786Combined sources15
Turni798 – 802Combined sources5
Beta strandi805 – 814Combined sources10
Beta strandi816 – 818Combined sources3
Beta strandi820 – 833Combined sources14
Beta strandi839 – 856Combined sources18
Beta strandi900 – 902Combined sources3
Turni904 – 906Combined sources3
Beta strandi907 – 916Combined sources10
Beta strandi923 – 933Combined sources11
Helixi935 – 938Combined sources4
Beta strandi941 – 944Combined sources4
Beta strandi948 – 960Combined sources13
Beta strandi964 – 966Combined sources3
Beta strandi971 – 982Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JV2X-ray3.10A31-987[»]
1L5GX-ray3.20A31-987[»]
1M1XX-ray3.30A31-987[»]
1U8CX-ray3.10A31-987[»]
3IJEX-ray2.90A31-997[»]
4G1EX-ray3.00A31-989[»]
4G1MX-ray2.90A31-989[»]
4MMXX-ray3.32A31-989[»]
4MMYX-ray3.18A31-989[»]
4MMZX-ray3.10A31-989[»]
4O02X-ray3.60A31-992[»]
4UM8X-ray2.85A/C31-625[»]
4UM9X-ray2.50A/C31-625[»]
5FFGX-ray2.25A31-625[»]
5FFOX-ray3.49A/E31-625[»]
5NEMelectron microscopy3.10A31-624[»]
5NERelectron microscopy3.10A31-624[»]
5NETelectron microscopy3.10A31-624[»]
5NEUelectron microscopy3.10A31-624[»]
6AVQelectron microscopy35.00A31-987[»]
6AVRelectron microscopy35.00A31-987[»]
6AVUelectron microscopy35.00A31-987[»]
ProteinModelPortaliP06756
SMRiP06756
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP06756

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati32 – 98FG-GAP 1PROSITE-ProRule annotationAdd BLAST67
Repeati109 – 170FG-GAP 2PROSITE-ProRule annotationAdd BLAST62
Repeati173 – 225FG-GAP 3PROSITE-ProRule annotationAdd BLAST53
Repeati237 – 291FG-GAP 4PROSITE-ProRule annotationAdd BLAST55
Repeati292 – 357FG-GAP 5PROSITE-ProRule annotationAdd BLAST66
Repeati358 – 415FG-GAP 6PROSITE-ProRule annotationAdd BLAST58
Repeati419 – 482FG-GAP 7PROSITE-ProRule annotationAdd BLAST64

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi1019 – 1023GFFKR motif5

Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IPB5 Eukaryota
ENOG410YR19 LUCA
GeneTreeiENSGT00760000118782
HOGENOMiHOG000231603
HOVERGENiHBG006186
InParanoidiP06756
KOiK06487
OMAiSCFNVRF
OrthoDBiEOG091G05Z4
PhylomeDBiP06756
TreeFamiTF105391

Family and domain databases

Gene3Di2.130.10.130, 1 hit
InterProiView protein in InterPro
IPR013517 FG-GAP
IPR013519 Int_alpha_beta-p
IPR000413 Integrin_alpha
IPR013649 Integrin_alpha-2
IPR018184 Integrin_alpha_C_CS
IPR028994 Integrin_alpha_N
IPR032695 Integrin_dom_sf
PfamiView protein in Pfam
PF01839 FG-GAP, 3 hits
PF00357 Integrin_alpha, 1 hit
PF08441 Integrin_alpha2, 1 hit
PRINTSiPR01185 INTEGRINA
SMARTiView protein in SMART
SM00191 Int_alpha, 5 hits
SUPFAMiSSF69179 SSF69179, 3 hits
PROSITEiView protein in PROSITE
PS51470 FG_GAP, 7 hits
PS00242 INTEGRIN_ALPHA, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P06756-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAFPPRRRLR LGPRGLPLLL SGLLLPLCRA FNLDVDSPAE YSGPEGSYFG
60 70 80 90 100
FAVDFFVPSA SSRMFLLVGA PKANTTQPGI VEGGQVLKCD WSSTRRCQPI
110 120 130 140 150
EFDATGNRDY AKDDPLEFKS HQWFGASVRS KQDKILACAP LYHWRTEMKQ
160 170 180 190 200
EREPVGTCFL QDGTKTVEYA PCRSQDIDAD GQGFCQGGFS IDFTKADRVL
210 220 230 240 250
LGGPGSFYWQ GQLISDQVAE IVSKYDPNVY SIKYNNQLAT RTAQAIFDDS
260 270 280 290 300
YLGYSVAVGD FNGDGIDDFV SGVPRAARTL GMVYIYDGKN MSSLYNFTGE
310 320 330 340 350
QMAAYFGFSV AATDINGDDY ADVFIGAPLF MDRGSDGKLQ EVGQVSVSLQ
360 370 380 390 400
RASGDFQTTK LNGFEVFARF GSAIAPLGDL DQDGFNDIAI AAPYGGEDKK
410 420 430 440 450
GIVYIFNGRS TGLNAVPSQI LEGQWAARSM PPSFGYSMKG ATDIDKNGYP
460 470 480 490 500
DLIVGAFGVD RAILYRARPV ITVNAGLEVY PSILNQDNKT CSLPGTALKV
510 520 530 540 550
SCFNVRFCLK ADGKGVLPRK LNFQVELLLD KLKQKGAIRR ALFLYSRSPS
560 570 580 590 600
HSKNMTISRG GLMQCEELIA YLRDESEFRD KLTPITIFME YRLDYRTAAD
610 620 630 640 650
TTGLQPILNQ FTPANISRQA HILLDCGEDN VCKPKLEVSV DSDQKKIYIG
660 670 680 690 700
DDNPLTLIVK AQNQGEGAYE AELIVSIPLQ ADFIGVVRNN EALARLSCAF
710 720 730 740 750
KTENQTRQVV CDLGNPMKAG TQLLAGLRFS VHQQSEMDTS VKFDLQIQSS
760 770 780 790 800
NLFDKVSPVV SHKVDLAVLA AVEIRGVSSP DHVFLPIPNW EHKENPETEE
810 820 830 840 850
DVGPVVQHIY ELRNNGPSSF SKAMLHLQWP YKYNNNTLLY ILHYDIDGPM
860 870 880 890 900
NCTSDMEINP LRIKISSLQT TEKNDTVAGQ GERDHLITKR DLALSEGDIH
910 920 930 940 950
TLGCGVAQCL KIVCQVGRLD RGKSAILYVK SLLWTETFMN KENQNHSYSL
960 970 980 990 1000
KSSASFNVIE FPYKNLPIED ITNSTLVTTN VTWGIQPAPM PVPVWVIILA
1010 1020 1030 1040
VLAGLLLLAV LVFVMYRMGF FKRVRPPQEE QEREQLQPHE NGEGNSET
Length:1,048
Mass (Da):116,038
Last modified:April 3, 2007 - v2
Checksum:i364EE25C5303A2D7
GO
Isoform 2 (identifier: P06756-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-211: QDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQG → R

Note: No experimental confirmation available.
Show »
Length:1,012
Mass (Da):112,258
Checksum:i132A3F554FCDE8B6
GO
Isoform 3 (identifier: P06756-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAFPPRRRLR...VDFFVPSASS → MLLGTLLLILYILMLC

Note: No experimental confirmation available.
Show »
Length:1,002
Mass (Da):111,132
Checksum:iD6178F9822C83829
GO

Sequence cautioni

The sequence BAD93131 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti425W → R in AAG03000 (PubMed:10965141).Curated1
Sequence conflicti700F → L in AAI44101 (PubMed:15489334).Curated1
Sequence conflicti1039H → R in AAG03000 (PubMed:10965141).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024289405I → V. Corresponds to variant dbSNP:rs3738918Ensembl.1
Natural variantiVAR_055970548S → A. Corresponds to variant dbSNP:rs2230615Ensembl.1
Natural variantiVAR_031547783V → I7 PublicationsCorresponds to variant dbSNP:rs2230616Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0449141 – 62MAFPP…PSASS → MLLGTLLLILYILMLC in isoform 3. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_024351175 – 211QDIDA…FYWQG → R in isoform 2. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14648 mRNA Translation: AAA36808.1
AF251841
, AF251818, AF251819, AF251820, AF251821, AF251822, AF251823, AF251824, AF251825, AF251826, AF251827, AF251828, AF251829, AF251830, AF251831, AF251832, AF251833, AF251834, AF251835, AF251836, AF251837, AF251838, AF251839, AF251840 Genomic DNA Translation: AAG03000.1
AK302990 mRNA Translation: BAH13869.1
AB209894 mRNA Translation: BAD93131.1 Different initiation.
AC017101 Genomic DNA Translation: AAY24257.1
EU332844 Genomic DNA Translation: ABY87533.1
CH471058 Genomic DNA Translation: EAX10934.1
BC126231 mRNA Translation: AAI26232.1
BC136442 mRNA Translation: AAI36443.1
BC144100 mRNA Translation: AAI44101.1
U07375 Genomic DNA Translation: AAA61631.1
CCDSiCCDS2292.1 [P06756-1]
CCDS46470.1 [P06756-2]
CCDS46471.1 [P06756-3]
PIRiA27421
RefSeqiNP_001138471.1, NM_001144999.2
NP_001138472.1, NM_001145000.2
NP_002201.1, NM_002210.4
UniGeneiHs.436873

Genome annotation databases

EnsembliENST00000261023; ENSP00000261023; ENSG00000138448 [P06756-1]
ENST00000374907; ENSP00000364042; ENSG00000138448 [P06756-2]
ENST00000433736; ENSP00000404291; ENSG00000138448 [P06756-3]
GeneIDi3685
KEGGihsa:3685
UCSCiuc002upq.5 human [P06756-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiITAV_HUMAN
AccessioniPrimary (citable) accession number: P06756
Secondary accession number(s): A0AV67
, B0LPF4, B7Z883, B7ZLX0, D3DPG8, E7EWZ6, Q53SK4, Q59EB7, Q6LD15
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1988
Last sequence update: April 3, 2007
Last modified: May 23, 2018
This is version 220 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health