P06748 (NPM_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 168.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nucleophosmin Short name=NPM Alternative name(s): Nucleolar phosphoprotein B23 Nucleolar protein NO38 Numatrin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 294 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribosome nuclear export. Associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. Acts as a chaperonin for the core histones H3, H2B and H4. Stimulates APEX1 endonuclease activity on apurinic/apyrimidinic (AP) double-stranded DNA but inhibits APEX1 endonuclease activity on AP single-stranded RNA. May exert a control of APEX1 endonuclease activity within nucleoli devoted to repair AP on rDNA and the removal of oxidized rRNA molecules. In concert with BRCA2, regulates centrosome duplication. Regulates centriole duplication: phosphorylation by PLK2 is able to trigger centriole replication. Ref.33 Ref.37 Ref.45 Ref.48 Ref.53 Ref.57 Ref.58 |
| Subunit structure | Decamer formed by two pentameric rings associated in a head-to-head fashion. Disulfide-linked dimers under certain conditions. The SWAP complex consists of NPM1, NCL, PARP1 and SWAP70 By similarity. Interacts with NSUN2 and SENP3. Interacts with hepatitis delta virus S-HDAg. Interacts with HTLV1 Rex protein (via N-terminal nuclear localization signal). Interacts with the methylated form of RPS10. Interacts (via N-terminal domain) with APEX1; the interaction is RNA-dependent and decreases in hydrogen peroxide-damaged cells. Interacts with isoform 1 of NEK2. Interacts with ROCK2 and BRCA2. Interacts with RPGR. Interacts with CENPW. Ref.20 Ref.26 Ref.30 Ref.32 Ref.37 Ref.39 Ref.40 Ref.41 Ref.48 Ref.52 Ref.57 Ref.58 |
| Subcellular location | Nucleus › nucleolus. Nucleus › nucleoplasm. Cytoplasm › cytoskeleton › centrosome. Note: Generally nucleolar, but is translocated to the nucleoplasm in case of serum starvation or treatment with anticancer drugs. Has been found in the cytoplasm in patients with primary acute myelogenous leukemia (AML), but not with secondary AML. Can shuttle between cytoplasm and nucleus. Co-localizes with the methylated form of RPS10 in the granular component (GC) region of the nucleolus. Colocalized with nucleolin and APEX1 in nucleoli. Isoform 1 of NEK2 is required for its localization to the centrosome during mitosis. Ref.6 Ref.28 Ref.30 Ref.41 Ref.48 Ref.52 Ref.58 |
| Post-translational modification | Acetylated at C-terminal lysine residues, thereby increasing affinity to histones. ADP-ribosylated. Phosphorylated at Ser-4 by PLK1 and PLK2. Phosphorylation at Ser-4 by PLK2 in S phase is required for centriole duplication and is sufficient to trigger centriole replication. Phosphorylation at Ser-4 by PLK1 takes place during mitosis. Phosphorylated by CDK2 at Ser-125 and Thr-199. Phosphorylation at Thr-199 may trigger initiation of centrosome duplication. Phosphorylated by CDK1 at Thr-199, Thr-219, Thr-234 and Thr-237 during cell mitosis. When these four sites are phosphorated, RNA-binding activity seem to be abolished. May be phosphorylated at Ser-70 by NEK2. The Thr-199 phosphorylated form has higher affinity for ROCK2. CDK6 triggers Thr-199 phosphorylation when complexed to Kaposi's sarcoma herpesvirus (KSHV) V-cyclin, leading to viral reactivation by reducing viral LANA levels. Ref.17 Ref.25 Ref.30 Ref.31 Ref.53 Ref.54 Sumoylated by ARF. Ref.34 |
| Involvement in disease | A chromosomal aberration involving NPM1 is found in a form of non-Hodgkin lymphoma. Translocation t(2;5)(p23;q35) with ALK. The resulting chimeric NPM1-ALK protein homodimerize and the kinase becomes constitutively activated. A chromosomal aberration involving NPM1 is found in a form of acute promyelocytic leukemia. Translocation t(5;17)(q32;q11) with RARA. A chromosomal aberration involving NPM1 is a cause of myelodysplastic syndrome (MDS). Translocation t(3;5)(q25.1;q34) with MLF1. Defects in NPM1 are associated with acute myelogenous leukemia (AML). Mutations in exon 12 affecting the C-terminus of the protein are associated with an aberrant cytoplasmic location. |
| Sequence similarities | Belongs to the nucleoplasmin family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Q98147 | 2 | EBI-78579,EBI-626601 | From a different organism. | |
| MDM2 | Q00987 | 3 | EBI-78579,EBI-389668 | |
| TP53 | P04637 | 3 | EBI-354150,EBI-366083 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P06748-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P06748-2) The sequence of this isoform differs from the canonical sequence as follows: 195-223: Missing. | ||||||
| Isoform 3 (identifier: P06748-3) The sequence of this isoform differs from the canonical sequence as follows: 258-294: GGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL → AH | ||||||
| Note: Contains a N6-acetyllysine at position 257. Contains a phosphoserine at position 254. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 294 | 294 | Nucleophosmin | PRO_0000219481 | |||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||
| Region | 1 – 186 | 186 | Required for interaction with SENP3 | ||||||||||||||||||||||||||||
| Region | 1 – 117 | 117 | Necessary for interaction with APEX1 | ||||||||||||||||||||||||||||
| Region | 243 – 294 | 52 | Required for nucleolar localization | ||||||||||||||||||||||||||||
| Motif | 152 – 157 | 6 | Nuclear localization signal Potential | ||||||||||||||||||||||||||||
| Motif | 191 – 197 | 7 | Nuclear localization signal Potential | ||||||||||||||||||||||||||||
| Compositional bias | 1 – 9 | 9 | Met-rich | ||||||||||||||||||||||||||||
| Compositional bias | 120 – 132 | 13 | Asp/Glu-rich (acidic) | ||||||||||||||||||||||||||||
| Compositional bias | 161 – 188 | 28 | Asp/Glu-rich (highly acidic) | ||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||
| Site | 55 | 1 | Interaction between pentamers By similarity | ||||||||||||||||||||||||||||
| Site | 80 | 1 | Interaction between pentamers By similarity | ||||||||||||||||||||||||||||
| Site | 175 – 176 | 2 | Breakpoint for translocation to form NPM1-MLF1 | ||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.17 Ref.55 Ref.59 | ||||||||||||||||||||||||||||
| Modified residue | 4 | 1 | Phosphoserine; by PLK1 and PLK2 Ref.31 Ref.53 Ref.55 Ref.59 | ||||||||||||||||||||||||||||
| Modified residue | 10 | 1 | Phosphoserine Ref.55 | ||||||||||||||||||||||||||||
| Modified residue | 32 | 1 | N6-acetyllysine Ref.51 | ||||||||||||||||||||||||||||
| Modified residue | 70 | 1 | Phosphoserine Ref.35 Ref.38 Ref.43 Ref.44 Ref.46 Ref.50 Ref.55 Ref.59 | ||||||||||||||||||||||||||||
| Modified residue | 75 | 1 | Phosphothreonine Ref.46 | ||||||||||||||||||||||||||||
| Modified residue | 95 | 1 | Phosphothreonine Ref.35 Ref.46 Ref.55 | ||||||||||||||||||||||||||||
| Modified residue | 106 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||
| Modified residue | 125 | 1 | Phosphoserine; by CDK2 Ref.17 Ref.43 Ref.44 Ref.46 Ref.47 Ref.49 Ref.50 Ref.55 Ref.59 | ||||||||||||||||||||||||||||
| Modified residue | 137 | 1 | Phosphoserine Ref.55 | ||||||||||||||||||||||||||||
| Modified residue | 139 | 1 | Phosphoserine Ref.46 Ref.55 | ||||||||||||||||||||||||||||
| Modified residue | 150 | 1 | N6-acetyllysine Ref.36 Ref.51 | ||||||||||||||||||||||||||||
| Modified residue | 154 | 1 | N6-acetyllysine Ref.36 | ||||||||||||||||||||||||||||
| Modified residue | 199 | 1 | Phosphothreonine; by CDK1, CDK2 and CDK6 Ref.38 Ref.54 Ref.55 | ||||||||||||||||||||||||||||
| Modified residue | 212 | 1 | N6-acetyllysine Ref.33 Ref.36 | ||||||||||||||||||||||||||||
| Modified residue | 219 | 1 | Phosphothreonine; by CDK1 | ||||||||||||||||||||||||||||
| Modified residue | 227 | 1 | Phosphoserine Ref.59 | ||||||||||||||||||||||||||||
| Modified residue | 229 | 1 | N6-acetyllysine Ref.33 | ||||||||||||||||||||||||||||
| Modified residue | 230 | 1 | N6-acetyllysine; alternate Ref.33 | ||||||||||||||||||||||||||||
| Modified residue | 234 | 1 | Phosphothreonine; by CDK1 Ref.46 | ||||||||||||||||||||||||||||
| Modified residue | 237 | 1 | Phosphothreonine; by CDK1 Ref.46 | ||||||||||||||||||||||||||||
| Modified residue | 242 | 1 | Phosphoserine Ref.55 | ||||||||||||||||||||||||||||
| Modified residue | 243 | 1 | Phosphoserine Ref.46 Ref.55 Ref.59 | ||||||||||||||||||||||||||||
| Modified residue | 250 | 1 | N6-acetyllysine Ref.33 | ||||||||||||||||||||||||||||
| Modified residue | 254 | 1 | Phosphoserine Ref.38 Ref.55 Ref.59 | ||||||||||||||||||||||||||||
| Modified residue | 257 | 1 | N6-acetyllysine Ref.33 Ref.51 | ||||||||||||||||||||||||||||
| Modified residue | 260 | 1 | Phosphoserine Ref.55 | ||||||||||||||||||||||||||||
| Modified residue | 267 | 1 | N6-acetyllysine Ref.51 | ||||||||||||||||||||||||||||
| Modified residue | 273 | 1 | N6-acetyllysine Ref.51 | ||||||||||||||||||||||||||||
| Modified residue | 279 | 1 | Phosphothreonine Ref.43 Ref.55 | ||||||||||||||||||||||||||||
| Modified residue | 292 | 1 | N6-acetyllysine Ref.33 | ||||||||||||||||||||||||||||
| Cross-link | 230 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate Ref.34 | |||||||||||||||||||||||||||||
| Cross-link | 263 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.34 | |||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||
| Alternative sequence | 195 – 223 | 29 | Missing in isoform 2. | VSP_003616 | |||||||||||||||||||||||||||
| Alternative sequence | 258 – 294 | 37 | GGSLP…WRKSL → AH in isoform 3. | VSP_043599 | |||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||
| Mutagenesis | 4 | 1 | S → A: Abolishes phosphorylation by PLK2 and impairs centriole duplication. Ref.53 | ||||||||||||||||||||||||||||
| Mutagenesis | 4 | 1 | S → D or E: Mimicks phosphorylation state, inducing accumulation of centrioles. Ref.53 | ||||||||||||||||||||||||||||
| Mutagenesis | 95 | 1 | T → A: Does not affect phosphorylation by PLK2. Ref.53 | ||||||||||||||||||||||||||||
| Mutagenesis | 125 | 1 | S → A: Does not affect phosphorylation by PLK2. Ref.53 | ||||||||||||||||||||||||||||
| Mutagenesis | 199 | 1 | T → A: Partial loss of phosphorylation. Does not affect phosphorylation by PLK2. Ref.27 Ref.53 | ||||||||||||||||||||||||||||
| Mutagenesis | 219 | 1 | T → A: Partial loss of phosphorylation. Ref.27 | ||||||||||||||||||||||||||||
| Mutagenesis | 234 | 1 | T → A: Partial loss of phosphorylation; when associated with A-237. Ref.27 | ||||||||||||||||||||||||||||
| Mutagenesis | 237 | 1 | T → A: Partial loss of phosphorylation. Ref.27 | ||||||||||||||||||||||||||||
| Mutagenesis | 248 | 1 | K → A: Partial destabilization of the structure. Ref.61 | ||||||||||||||||||||||||||||
| Mutagenesis | 250 | 1 | K → A: Increase in the stabilization of the structure. Ref.61 | ||||||||||||||||||||||||||||
| Mutagenesis | 263 | 1 | K → A: Increase in the stabilization of the structure and partial delocalization to the nucleoplasm. Complete delocalization to the nucleoplasm; when associated with A-267. Ref.40 | ||||||||||||||||||||||||||||
| Mutagenesis | 263 | 1 | K → R: No change in the sumoylation level. Ref.40 | ||||||||||||||||||||||||||||
| Mutagenesis | 267 | 1 | K → A: Increase in the stabilization of the structure and complete delocalization to the nucleoplasm. Complete delocalization to the nucleoplasm; when associated with A-263. | ||||||||||||||||||||||||||||
| Mutagenesis | 268 | 1 | F → A: Complete destabilization of the structure and loss of nucleolus localization; when associated with A-276. Ref.61 | ||||||||||||||||||||||||||||
| Mutagenesis | 276 | 1 | F → A: Complete destabilization of the structure and loss of nucleolus localization; when associated with A-268. Ref.61 | ||||||||||||||||||||||||||||
| Mutagenesis | 288 | 1 | W → A: Complete destabilization of the structure; when associated with A-290. Ref.61 | ||||||||||||||||||||||||||||
| Mutagenesis | 290 | 1 | W → A: Partial destabilization of the structure. Complete destabilization of the structure; when associated with A-288. Ref.61 | ||||||||||||||||||||||||||||
| Sequence conflict | 80 | 1 | K → E in AAH21983. Ref.13 | ||||||||||||||||||||||||||||
| Sequence conflict | 129 | 1 | E → D AA sequence Ref.21 | ||||||||||||||||||||||||||||
| Sequence conflict | 168 | 1 | Missing in AAW67758. Ref.6 | ||||||||||||||||||||||||||||
| Sequence conflict | 178 | 1 | D → G in AAH16768. Ref.13 | ||||||||||||||||||||||||||||
| Sequence conflict | 183 | 1 | D → N in BAG70175. Ref.11 | ||||||||||||||||||||||||||||
| Sequence conflict | 183 | 1 | D → N in BAG70050. Ref.11 | ||||||||||||||||||||||||||||
| Sequence conflict | 213 | 1 | D → P in AAA36473. Ref.22 | ||||||||||||||||||||||||||||
| Sequence conflict | 213 | 1 | D → P in AAA36474. Ref.22 | ||||||||||||||||||||||||||||
| Sequence conflict | 216 | 1 | P → S in AAA36473. Ref.22 | ||||||||||||||||||||||||||||
| Sequence conflict | 219 – 221 | 3 | TPR → SSS in AAA36473. Ref.22 | ||||||||||||||||||||||||||||
| Sequence conflict | 231 | 1 | Q → R in AAQ24860. Ref.8 | ||||||||||||||||||||||||||||
| Sequence conflict | 271 | 1 | Y → C in AAH16768. Ref.13 | ||||||||||||||||||||||||||||
| Sequence conflict | 287 | 1 | L → F in AAH12566. Ref.13 | ||||||||||||||||||||||||||||
| Sequence conflict | 288 – 294 | 7 | WQWRKSL → CLAVEEVSLRK in AAW67752. Ref.6 | ||||||||||||||||||||||||||||
| Sequence conflict | 288 – 294 | 7 | WQWRKSL → CLAVEEVSLRK in AAW67755. Ref.6 | ||||||||||||||||||||||||||||
| Sequence conflict | 288 – 294 | 7 | WQWRKSL → CMAVEEVSLRK in AAW67753. Ref.6 | ||||||||||||||||||||||||||||
| Sequence conflict | 288 – 294 | 7 | WQWRKSL → CMAVEEVSLRK in ABC40399. Ref.7 | ||||||||||||||||||||||||||||
| Sequence conflict | 288 – 294 | 7 | WQWRKSL → CVAVEEVSLRK in AAW67754. Ref.6 | ||||||||||||||||||||||||||||
| Sequence conflict | 290 – 294 | 5 | WRKSL → SLAQVSLRK in AAW67756. Ref.6 | ||||||||||||||||||||||||||||
| Sequence conflict | 290 – 294 | 5 | WRKSL → SLEKVSLRK in AAW67757. Ref.6 | ||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||
| Beta strand | 16 – 19 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 29 – 31 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 41 – 49 | 9 | |||||||||||||||||||||||||||||
| Beta strand | 58 – 65 | 8 | |||||||||||||||||||||||||||||
| Beta strand | 69 – 80 | 12 | |||||||||||||||||||||||||||||
| Turn | 81 – 83 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 84 – 94 | 11 | |||||||||||||||||||||||||||||
| Beta strand | 96 – 105 | 10 | |||||||||||||||||||||||||||||
| Beta strand | 109 – 116 | 8 | |||||||||||||||||||||||||||||
| Helix | 244 – 257 | 14 | |||||||||||||||||||||||||||||
| Helix | 265 – 275 | 11 | |||||||||||||||||||||||||||||
| Helix | 281 – 292 | 12 | |||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the cDNA encoding human nucleophosmin and studies of its role in normal and abnormal growth." Chan W.-Y., Liu Q.R., Borjigin J., Busch H., Rennert O.M., Tease L.A., Chan P.-K. Biochemistry 28:1033-1039(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "The nucleotide sequence of a human cDNA encoding the highly conserved nucleolar phosphoprotein B23." Li X., McNeilage L.J., Whittingham S. Biochem. Biophys. Res. Commun. 163:72-78(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: B-cell lymphoma. |
| [3] | "Isolation and characterization of a molecular cDNA clone of a human mRNA from interferon-treated cells encoding nucleolar protein B23, numatrin." Zhang X.T., Thomis D.C., Samuel C.E. Biochem. Biophys. Res. Commun. 164:176-184(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Amnion. |
| [4] | "Isolation and characterization of the human nucleophosmin/B23 (NPM) gene: identification of the YY1 binding site at the 5' enhancer region." Chan P.-K., Chan F.Y., Morris S.W., Xie Z. Nucleic Acids Res. 25:1225-1232(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [5] | "Human homologue of Rat B23.2." Okuwaki M., Nagata K. Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [6] | "Cytoplasmic nucleophosmin in acute myelogenous leukemia with a normal karyotype." Falini B., Mecucci C., Tiacci E., Alcalay M., Rosati R., Pasqualucci L., La Starza R., Diverio D., Colombo E., Santucci A., Bigerna B., Pacini R., Pucciarini A., Liso A., Vignetti M., Fazi P., Meani N., Pettirossi V. Martelli M.F.N. Engl. J. Med. 352:254-266(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, INVOLVEMENT IN ACUTE MYELOGENOUS LEUKEMIA. Tissue: Bone marrow. |
| [7] | "Cytoplasmic nucleophosmin in myeloid sarcoma occurring 20 years after diagnosis of acute myeloid leukaemia." Bolli N., Galimberti S., Martelli M.P., Tabarrini A., Roti G., Mecucci C., Martelli M.F., Petrini M., Falini B. Lancet Oncol. 7:350-352(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [8] | "Cloning of a new transcript of nucleophosmin in testis." Lu L., Huang X.Y., Yin L.L., Xu M., Li J.M., Zhou Z.M., Sha J.H. Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [9] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Embryo. |
| [11] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [12] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [13] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Bone marrow, Brain, Kidney, Lung, Prostate, Testis and Urinary bladder. |
| [14] | "The t(5;17) variant of acute promyelocytic leukemia expresses a nucleophosmin-retinoic acid receptor fusion." Redner R.L., Rush E.A., Faas S., Rudert W.A., Corey S.J. Blood 87:882-886(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-133, CHROMOSOMAL TRANSLOCATION WITH RARA. Tissue: Bone marrow. |
| [15] | "Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma." Morris S.W., Kirstein M.N., Valentine M.B., Dittmer K.G., Shapiro D.N., Saltman D.L., Look A.T. Science 263:1281-1284(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-117, CHROMOSOMAL TRANSLOCATION WITH ALK. Tissue: T-cell lymphoma. |
| [16] | "Characterization of the transforming activity of p80, a hyperphosphorylated protein in a Ki-1 lymphoma cell line with chromosomal translocation t(2;5)." Fujimoto J., Shiota M., Iwahara T., Seki N., Satoh H., Mori S., Yamamoto T. Proc. Natl. Acad. Sci. U.S.A. 93:4181-4186(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-117, CHROMOSOMAL TRANSLOCATION WITH ALK. Tissue: Lymphoma. |
| [17] | Bienvenut W.V., Waridel P., Quadroni M. Submitted (MAR-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 1-24; 33-101; 104-141; 240-248 AND 278-291, ACETYLATION AT MET-1, PHOSPHORYLATION AT SER-125, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Nucleotide sequence of a cDNA clone representing a third allele of human protein B23." Hale T.K., Mansfield B.C. Nucleic Acids Res. 17:10112-10112(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-294 (ISOFORM 1). Tissue: Placenta. |
| [19] | "A two-dimensional gel database of human colon carcinoma proteins." Ji H., Reid G.E., Moritz R.L., Eddes J.S., Burgess A.W., Simpson R.J. Electrophoresis 18:605-613(1997) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 33-54. Tissue: Colon carcinoma. |
| [20] | "Nucleolar targeting signal of Rex protein of human T-cell leukemia virus type I specifically binds to nucleolar shuttle protein B-23." Adachi Y., Copeland T.D., Hatanaka M., Oroszlan S. J. Biol. Chem. 268:13930-13934(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 34-42; 50-67; 137-151; 218-227; 252-266 AND 277-286 (ISOFORM 1), INTERACTION WITH HTLV1 REX PROTEIN. |
| [21] | "Amino acid sequence of protein B23 phosphorylation site." Chan P.-K., Aldrich M.B., Cook R.G., Busch H. J. Biol. Chem. 261:1868-1872(1986) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 115-134. |
| [22] | "Amino acid sequence of a specific antigenic peptide of protein B23." Chan P.-K., Chan W.-Y., Yung B.Y.M., Cook R.G., Aldrich M.B., Ku D., Goldknopf I.L., Busch H. J. Biol. Chem. 261:14335-14341(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 213-294 (ISOFORM 1), PROTEIN SEQUENCE OF 227-294. |
| [23] | "Modification of nucleolar protein B23 after exposure to ionizing radiation." Ramsamooj P., Notario V., Dritschilo A. Radiat. Res. 143:158-164(1995) [PubMed] [Europe PMC] [Abstract] Cited for: ADP-RIBOSYLATION. |
| [24] | "The t(3;5)(q25.1;q34) of myelodysplastic syndrome and acute myeloid leukemia produces a novel fusion gene, NPM-MLF1." Yoneda-Kato N., Look A.T., Kirstein M.N., Valentine M.B., Raimondi S.C., Cohen K.J., Carroll A.J., Morris S.W. Oncogene 12:265-275(1996) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH MLF1. |
| [25] | "Nucleophosmin/B23 is a target of CDK2/cyclin E in centrosome duplication." Okuda M., Horn H.F., Tarapore P., Tokuyama Y., Smulian A.G., Chan P.K., Knudsen E.S., Hofmann I.A., Snyder J.D., Bove K.E., Fukasawa K. Cell 103:127-140(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY CDK2. |
| [26] | "The nucleolar phosphoprotein B23 interacts with hepatitis delta antigens and modulates the hepatitis delta virus RNA replication." Huang W.H., Yung B.Y., Syu W.J., Lee Y.H. J. Biol. Chem. 276:25166-25175(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HEPATITIS DELTA VIRUS S-HDAG. |
| [27] | "The RNA binding activity of a ribosome biogenesis factor, nucleophosmin/B23, is modulated by phosphorylation with a cell cycle-dependent kinase and by association with its subtype." Okuwaki M., Tsujimoto M., Nagata K. Mol. Biol. Cell 13:2016-2030(2002) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF THR-199; THR-219; THR-234 AND THR-237. |
| [28] | "Functional proteomic analysis of human nucleolus." Scherl A., Coute Y., Deon C., Calle A., Kindbeiter K., Sanchez J.-C., Greco A., Hochstrasser D.F., Diaz J.-J. Mol. Biol. Cell 13:4100-4109(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [29] | "The role of nucleophosmin in centrosome duplication." Okuda M. Oncogene 21:6170-6174(2002) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [30] | "Nek2A kinase regulates the localization of numatrin to centrosome in mitosis." Yao J., Fu C., Ding X., Guo Z., Zenreski A., Chen Y., Ahmed K., Liao J., Dou Z., Yao X. FEBS Lett. 575:112-118(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION, INTERACTION WITH NEK2. |
| [31] | "B23/nucleophosmin serine 4 phosphorylation mediates mitotic functions of polo-like kinase 1." Zhang H., Shi X., Paddon H., Hampong M., Dai W., Pelech S. J. Biol. Chem. 279:35726-35734(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-4 BY PLK1. |
| [32] | "RPGR ORF15 isoform co-localizes with RPGRIP1 at centrioles and basal bodies and interacts with nucleophosmin." Shu X., Fry A.M., Tulloch B., Manson F.D., Crabb J.W., Khanna H., Faragher A.J., Lennon A., He S., Trojan P., Giessl A., Wolfrum U., Vervoort R., Swaroop A., Wright A.F. Hum. Mol. Genet. 14:1183-1197(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RPGR. |
| [33] | "Human histone chaperone nucleophosmin enhances acetylation-dependent chromatin transcription." Swaminathan V., Kishore A.H., Febitha K.K., Kundu T.K. Mol. Cell. Biol. 25:7534-7545(2005) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION AT LYS-212; LYS-229; LYS-230; LYS-250; LYS-257 AND LYS-292, FUNCTION AS A CHAPERONE. |
| [34] | "Sumoylation induced by the Arf tumor suppressor: a p53-independent function." Tago K., Chiocca S., Sherr C.J. Proc. Natl. Acad. Sci. U.S.A. 102:7689-7694(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-230 AND LYS-263. |
| [35] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70 AND THR-95, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [36] | "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T., Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y. Mol. Cell 23:607-618(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-150; LYS-154 AND LYS-212, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [37] | "Interaction between ROCK II and nucleophosmin/B23 in the regulation of centrosome duplication." Ma Z., Kanai M., Kawamura K., Kaibuchi K., Ye K., Fukasawa K. Mol. Cell. Biol. 26:9016-9034(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ROCK2. |
| [38] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70; THR-199 AND SER-254, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [39] | "Aurora-B regulates RNA methyltransferase NSUN2." Sakita-Suto S., Kanda A., Suzuki F., Sato S., Takata T., Tatsuka M. Mol. Biol. Cell 18:1107-1117(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NSUN2. |
| [40] | "The nucleolar SUMO-specific protease SENP3 reverses SUMO modification of nucleophosmin and is required for rRNA processing." Haindl M., Harasim T., Eick D., Muller S. EMBO Rep. 9:273-279(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SENP3, MUTAGENESIS OF LYS-263. |
| [41] | "Nucleolar protein B23/nucleophosmin regulates the vertebrate SUMO pathway through SENP3 and SENP5 proteases." Yun C., Wang Y., Mukhopadhyay D., Backlund P., Kolli N., Yergey A., Wilkinson K.D., Dasso M. J. Cell Biol. 183:589-595(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SENP3, SUBCELLULAR LOCATION. |
| [42] | "The structure and functions of NPM1/Nucleophosmin/B23, a multifunctional nucleolar acidic protein." Okuwaki M. J. Biochem. 143:441-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [43] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70; SER-125 AND THR-279, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [44] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70 AND SER-125, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [45] | "Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome." Maggi L.B. Jr., Kuchenruether M., Dadey D.Y., Schwope R.M., Grisendi S., Townsend R.R., Pandolfi P.P., Weber J.D. Mol. Cell. Biol. 28:7050-7065(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [46] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70; THR-75; THR-95; SER-125; SER-139; THR-234; THR-237 AND SER-243, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [47] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, MASS SPECTROMETRY. Tissue: Liver. |
| [48] | "APE1/Ref-1 interacts with NPM1 within nucleoli and plays a role in the rRNA quality control process." Vascotto C., Fantini D., Romanello M., Cesaratto L., Deganuto M., Leonardi A., Radicella J.P., Kelley M.R., D'Ambrosio C., Scaloni A., Quadrifoglio F., Tell G. Mol. Cell. Biol. 29:1834-1854(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH APEX1, MASS SPECTROMETRY, SUBCELLULAR LOCATION. |
| [49] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, MASS SPECTROMETRY. |
| [50] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70 AND SER-125, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [51] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-32; LYS-150; LYS-257; LYS-267 AND LYS-273, MASS SPECTROMETRY. |
| [52] | "Methylation of ribosomal protein S10 by protein-arginine methyltransferase 5 regulates ribosome biogenesis." Ren J., Wang Y., Liang Y., Zhang Y., Bao S., Xu Z. J. Biol. Chem. 285:12695-12705(2010) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH RPS10. |
| [53] | "Polo-like kinase 2-dependent phosphorylation of NPM/B23 on serine 4 triggers centriole duplication." Krause A., Hoffmann I. PLoS ONE 5:E9849-E9849(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT SER-4 BY PLK2, MUTAGENESIS OF SER-4; THR-95; SER-125 AND THR-199. |
| [54] | "Nucleophosmin phosphorylation by v-cyclin-CDK6 controls KSHV latency." Sarek G., Jaerviluoma A., Moore H.M., Tojkander S., Vartia S., Biberfeld P., Laiho M., Ojala P.M. PLoS Pathog. 6:E1000818-E1000818(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-199 BY CDK6. |
| [55] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4; SER-10; SER-70; THR-95; SER-125; SER-137; SER-139; THR-199; SER-242; SER-243; SER-254; SER-260 AND THR-279, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [56] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [57] | "BRCA2 and nucleophosmin coregulate centrosome amplification and form a complex with the Rho effector kinase ROCK2." Wang H.F., Takenaka K., Nakanishi A., Miki Y. Cancer Res. 71:68-77(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH BRCA2. |
| [58] | "New centromeric component CENP-W is an RNA-associated nuclear matrix protein that interacts with nucleophosmin/B23 protein." Chun Y., Park B., Koh W., Lee S., Cheon Y., Kim R., Che L., Lee S. J. Biol. Chem. 286:42758-42769(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CENPW. |
| [59] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4; SER-70; SER-125; SER-227; SER-243 AND SER-254, MASS SPECTROMETRY. |
| [60] | "Crystal structure of human nucleophosmin-core reveals plasticity of the pentamer-pentamer interface." Lee H.H., Kim H.S., Kang J.Y., Lee B.I., Ha J.Y., Yoon H.J., Lim S.O., Jung G., Suh S.W. Proteins 69:672-678(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.75 ANGSTROMS) OF 9-124. |
| [61] | "Structural consequences of nucleophosmin mutations in acute myeloid leukemia." Grummitt C.G., Townsley F.M., Johnson C.M., Warren A.J., Bycroft M. J. Biol. Chem. 283:23326-23332(2008) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 243-294, MUTAGENESIS OF LYS-248; LYS-250; PHE-268; PHE-276; TRP-288 AND TRP-290. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M23613 mRNA. Translation: AAA36380.1. M28699 mRNA. Translation: AAA58386.1. M26697 mRNA. Translation: AAA36385.1. U89321 U89319 Genomic DNA. Translation: AAB94739.1.AB042278 mRNA. Translation: BAB40600.1. AY740634 mRNA. Translation: AAW67752.1. AY740635 mRNA. Translation: AAW67753.1. AY740636 mRNA. Translation: AAW67754.1. AY740637 mRNA. Translation: AAW67755.1. AY740638 mRNA. Translation: AAW67756.1. AY740639 mRNA. Translation: AAW67757.1. AY740640 mRNA. Translation: AAW67758.1. DQ303464 mRNA. Translation: ABC40399.1. AY347529 mRNA. Translation: AAQ24860.1. BT007011 mRNA. Translation: AAP35657.1. AK290652 mRNA. Translation: BAF83341.1. AB451236 mRNA. Translation: BAG70050.1. AB451361 mRNA. Translation: BAG70175.1. CH471062 Genomic DNA. Translation: EAW61443.1. CH471062 Genomic DNA. Translation: EAW61446.1. BC002398 mRNA. Translation: AAH02398.1. BC008495 mRNA. Translation: AAH08495.1. BC009623 mRNA. Translation: AAH09623.1. BC012566 mRNA. Translation: AAH12566.1. BC014349 mRNA. Translation: AAH14349.1. BC016716 mRNA. Translation: AAH16716.1. BC016768 mRNA. Translation: AAH16768.1. BC016824 mRNA. Translation: AAH16824.1. BC021668 mRNA. Translation: AAH21668.1. BC021983 mRNA. Translation: AAH21983.1. BC050628 mRNA. Translation: AAH50628.1. BC107754 mRNA. Translation: AAI07755.1. U41742 mRNA. Translation: AAB00112.1. Different termination. U41743 mRNA. Translation: AAB00113.1. Different termination. U04946 mRNA. Translation: AAA58698.1. Different termination. D45915 mRNA. Translation: BAA08343.1. Different termination. X16934 mRNA. Translation: CAA34809.1. J02590 mRNA. Translation: AAA36473.1. M31004 mRNA. Translation: AAA36474.1. | ||||||||||||||||||||||||
| IPI | IPI00220740. IPI00549248. IPI00658013. | ||||||||||||||||||||||||
| PIR | A32915. A33423. I38491. | ||||||||||||||||||||||||
| RefSeq | NP_001032827.1. NM_001037738.2. NP_002511.1. NM_002520.6. NP_954654.1. NM_199185.3. | ||||||||||||||||||||||||
| UniGene | Hs.557550. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P06748. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-30932N. | ||||||||||||||||||||||||
| IntAct | P06748. 53 interactions. | ||||||||||||||||||||||||
| MINT | MINT-4999760. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P06748. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 114762. | ||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||
| DOSAC-COBS-2DPAGE | P06748. | ||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00549248. | ||||||||||||||||||||||||
| SWISS-2DPAGE | P06748. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | P06748. | ||||||||||||||||||||||||
| PRIDE | P06748. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 4869. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000296930; ENSP00000296930; ENSG00000181163. ENST00000351986; ENSP00000341168; ENSG00000181163. ENST00000393820; ENSP00000377408; ENSG00000181163. ENST00000517671; ENSP00000428755; ENSG00000181163. | ||||||||||||||||||||||||
| GeneID | 4869. | ||||||||||||||||||||||||
| KEGG | hsa:4869. | ||||||||||||||||||||||||
| UCSC | uc003mbi.3. human. uc003mbj.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 4869. | ||||||||||||||||||||||||
| GeneCards | GC05P170814. | ||||||||||||||||||||||||
| HGNC | HGNC:7910. NPM1. | ||||||||||||||||||||||||
| HPA | CAB012983. HPA011384. | ||||||||||||||||||||||||
| MIM | 164040. gene. | ||||||||||||||||||||||||
| neXtProt | NX_P06748. | ||||||||||||||||||||||||
| Orphanet | 520. Acute promyelocytic leukemia. | ||||||||||||||||||||||||
| PharmGKB | PA31712. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG79897. | ||||||||||||||||||||||||
| HOGENOM | HOG000013061. | ||||||||||||||||||||||||
| HOVERGEN | HBG001860. | ||||||||||||||||||||||||
| InParanoid | P06748. | ||||||||||||||||||||||||
| KO | K11276. | ||||||||||||||||||||||||
| OMA | NCFRTED. | ||||||||||||||||||||||||
| OrthoDB | EOG4W3SNZ. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | aurora_b_pathway. Aurora B signaling. bard1pathway. BARD1 signaling events. hif1_tfpathway. HIF-1-alpha transcription factor network. | ||||||||||||||||||||||||
| Reactome | REACT_115566. Cell Cycle. REACT_116125. Disease. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P06748. | ||||||||||||||||||||||||
| Bgee | P06748. | ||||||||||||||||||||||||
| Genevestigator | P06748. | ||||||||||||||||||||||||
| GermOnline | ENSG00000181163. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 2.60.120.340. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR004301. Nucleoplasmin. IPR024057. Nucleoplasmin_core_dom. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR22747. PTHR22747. 1 hit. | ||||||||||||||||||||||||
| SUPFAM | SSF69203. Nucleoplasmin. 1 hit. | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | P06748. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL5178. | ||||||||||||||||||||||||
| ChiTaRS | NPM1. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | P06748. | ||||||||||||||||||||||||
| GenomeRNAi | 4869. | ||||||||||||||||||||||||
| NextBio | 18752. | ||||||||||||||||||||||||
| PMAP-CutDB | P06748. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | NPM_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P06748 Secondary accession number(s): A8K3N7 Q9UDJ7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
