Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glucose-6-phosphate isomerase

Gene

GPI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons.2 Publications

Catalytic activityi

D-glucose 6-phosphate = D-fructose 6-phosphate.

Pathwayi: glycolysis

This protein is involved in step 2 of the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose.
Proteins known to be involved in the 4 steps of the subpathway in this organism are:
  1. no protein annotated in this organism
  2. Glucose-6-phosphate isomerase, Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase (GPI), Glucose-6-phosphate isomerase, Glucose-6-phosphate isomerase (GPI)
  3. ATP-dependent 6-phosphofructokinase (PFKM), ATP-dependent 6-phosphofructokinase, liver type (PFKL), ATP-dependent 6-phosphofructokinase, platelet type (PFKP), ATP-dependent 6-phosphofructokinase, muscle type (PFKM)
  4. Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOB), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase C (ALDOC), Fructose-bisphosphate aldolase (HEL-S-87p), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase (ALDOC), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOB), Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase (ALDOA), Fructose-bisphosphate aldolase B (ALDOB), Fructose-bisphosphate aldolase A (ALDOA), Fructose-bisphosphate aldolase, Fructose-bisphosphate aldolase (ALDOC)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei358Proton donor1
Active sitei3891
Active sitei5191

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Cytokine, Growth factor, Isomerase

Keywords - Biological processi

Angiogenesis, Gluconeogenesis, Glycolysis

Enzyme and pathway databases

BioCyciMetaCyc:HS02693-MONOMER.
ZFISH:HS02693-MONOMER.
BRENDAi5.3.1.9. 2681.
ReactomeiR-HSA-5628897. TP53 Regulates Metabolic Genes.
R-HSA-6798695. Neutrophil degranulation.
R-HSA-70171. Glycolysis.
R-HSA-70263. Gluconeogenesis.
SABIO-RKP06744.
SIGNORiP06744.
UniPathwayiUPA00109; UER00181.

Names & Taxonomyi

Protein namesi
Recommended name:
Glucose-6-phosphate isomerase (EC:5.3.1.9)
Short name:
GPI
Alternative name(s):
Autocrine motility factor
Short name:
AMF
Neuroleukin
Short name:
NLK
Phosphoglucose isomerase
Short name:
PGI
Phosphohexose isomerase
Short name:
PHI
Sperm antigen 36
Short name:
SA-36
Gene namesi
Name:GPI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:4458. GPI.

Subcellular locationi

GO - Cellular componenti

  • ciliary membrane Source: Ensembl
  • cytoplasm Source: HPA
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • extracellular space Source: UniProtKB-KW
  • membrane Source: UniProtKB
  • myelin sheath Source: Ensembl
  • neuron projection Source: Ensembl
  • nucleoplasm Source: HPA
  • plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Secreted

Pathology & Biotechi

Involvement in diseasei

Hemolytic anemia, non-spherocytic, due to glucose phosphate isomerase deficiency (HA-GPID)
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of anemia in which there is no abnormal hemoglobin or spherocytosis. It is caused by glucose phosphate isomerase deficiency.
See also OMIM:613470
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0025165T → I in HA-GPID; GPI Matsumoto. 1 PublicationCorresponds to variant rs267606852dbSNPEnsembl.1
Natural variantiVAR_00251720H → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant rs137853586dbSNPEnsembl.1
Natural variantiVAR_00251875R → G in HA-GPID; GPI Elyria. 1 Publication1
Natural variantiVAR_00251983R → W in HA-GPID. 1 Publication1
Natural variantiVAR_002521101V → M in HA-GPID; GPI Sarcina. 1 PublicationCorresponds to variant rs757341382dbSNPEnsembl.1
Natural variantiVAR_002520159G → S in HA-GPID. 1 PublicationCorresponds to variant rs137853582dbSNPEnsembl.1
Natural variantiVAR_002522195T → I in HA-GPID; GPI Bari and Mola. 1 Publication1
Natural variantiVAR_002523224T → M in HA-GPID; GPI Iwate. 2 PublicationsCorresponds to variant rs61754634dbSNPEnsembl.1
Natural variantiVAR_002524273R → H in HA-GPID. 1 Publication1
Natural variantiVAR_002525278S → L in HA-GPID. 1 PublicationCorresponds to variant rs34306618dbSNPEnsembl.1
Natural variantiVAR_002526300A → P in HA-GPID. 1 Publication1
Natural variantiVAR_002527339L → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant rs137853587dbSNPEnsembl.1
Natural variantiVAR_002528343Q → R in HA-GPID; GPI Narita and Morcone. 2 PublicationsCorresponds to variant rs267606851dbSNPEnsembl.1
Natural variantiVAR_002529347R → C in HA-GPID; GPI Mount Scopus. 2 PublicationsCorresponds to variant rs758132799dbSNPEnsembl.1
Natural variantiVAR_002530347R → H in HA-GPID. 1 PublicationCorresponds to variant rs137853583dbSNPEnsembl.1
Natural variantiVAR_002531375T → R in HA-GPID; GPI Kinki. 1 PublicationCorresponds to variant rs267606853dbSNPEnsembl.1
Natural variantiVAR_002532389H → R in HA-GPID; severe form; GPI Calden. 1 PublicationCorresponds to variant rs139382538dbSNPEnsembl.1
Natural variantiVAR_002533472R → H in HA-GPID. 1 PublicationCorresponds to variant rs148811525dbSNPEnsembl.1
Natural variantiVAR_002534487L → F in HA-GPID. 1 PublicationCorresponds to variant rs374583873dbSNPEnsembl.1
Natural variantiVAR_002535495E → K in HA-GPID. 1 Publication1
Natural variantiVAR_002536517L → V in HA-GPID; severe form; GPI Calden. 1 Publication1
Natural variantiVAR_002537525I → T in HA-GPID. 2 PublicationsCorresponds to variant rs137853584dbSNPEnsembl.1
Natural variantiVAR_002538539D → N in HA-GPID; GPI Fukuoka and Kinki. 1 PublicationCorresponds to variant rs137853585dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi185S → A: Retained full enzymatic activity. 1 Publication1
Mutagenesisi185S → E: Decreased enzymatic activity. 1 Publication1

Keywords - Diseasei

Disease mutation, Hereditary hemolytic anemia

Organism-specific databases

DisGeNETi2821.
MalaCardsiGPI.
MIMi613470. phenotype.
OpenTargetsiENSG00000105220.
Orphaneti712. Hemolytic anemia due to glucophosphate isomerase deficiency.
PharmGKBiPA28841.

Polymorphism and mutation databases

BioMutaiGPI.
DMDMi17380385.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00001805372 – 558Glucose-6-phosphate isomeraseAdd BLAST557

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei12N6-acetyllysineCombined sources1
Modified residuei107PhosphoserineCombined sources1
Modified residuei109PhosphothreonineCombined sources1
Modified residuei142N6-acetyllysineCombined sources1
Modified residuei185Phosphoserine; by CK22 Publications1
Modified residuei250PhosphothreonineBy similarity1
Modified residuei454N6-acetyllysine; alternateBy similarity1
Modified residuei454N6-malonyllysine; alternate1 Publication1
Modified residuei454N6-succinyllysine; alternateBy similarity1
Modified residuei455PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylation at Ser-185 by CK2 has been shown to decrease enzymatic activity and may contribute to secretion by a non-classical secretory pathway.2 Publications
ISGylated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP06744.
MaxQBiP06744.
PeptideAtlasiP06744.
PRIDEiP06744.
TopDownProteomicsiP06744-1. [P06744-1]
P06744-2. [P06744-2]

PTM databases

iPTMnetiP06744.
PhosphoSitePlusiP06744.
SwissPalmiP06744.

Expressioni

Gene expression databases

BgeeiENSG00000105220.
CleanExiHS_GPI.
ExpressionAtlasiP06744. baseline and differential.
GenevisibleiP06744. HS.

Organism-specific databases

HPAiCAB018655.
CAB040563.
HPA024305.

Interactioni

Subunit structurei

Homodimer in the catalytically active form, monomer in the secreted form.3 Publications

GO - Molecular functioni

  • ubiquitin protein ligase binding Source: ParkinsonsUK-UCL

Protein-protein interaction databases

BioGridi109082. 45 interactors.
IntActiP06744. 6 interactors.
MINTiMINT-4999095.

Structurei

Secondary structure

1558
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi3 – 6Combined sources4
Helixi8 – 20Combined sources13
Helixi21 – 23Combined sources3
Helixi26 – 32Combined sources7
Helixi36 – 39Combined sources4
Beta strandi41 – 45Combined sources5
Beta strandi50 – 54Combined sources5
Beta strandi57 – 59Combined sources3
Helixi62 – 74Combined sources13
Helixi77 – 85Combined sources9
Turni92 – 95Combined sources4
Helixi100 – 103Combined sources4
Beta strandi116 – 118Combined sources3
Helixi119 – 137Combined sources19
Beta strandi151 – 155Combined sources5
Helixi158 – 160Combined sources3
Helixi162 – 170Combined sources9
Helixi172 – 174Combined sources3
Beta strandi180 – 184Combined sources5
Helixi189 – 196Combined sources8
Helixi201 – 203Combined sources3
Beta strandi204 – 209Combined sources6
Beta strandi211 – 213Combined sources3
Helixi216 – 233Combined sources18
Helixi236 – 238Combined sources3
Helixi239 – 242Combined sources4
Beta strandi243 – 248Combined sources6
Helixi250 – 256Combined sources7
Helixi260 – 262Combined sources3
Beta strandi263 – 265Combined sources3
Helixi272 – 274Combined sources3
Turni276 – 278Combined sources3
Helixi279 – 281Combined sources3
Helixi282 – 288Combined sources7
Helixi290 – 309Combined sources20
Helixi312 – 314Combined sources3
Helixi316 – 329Combined sources14
Beta strandi335 – 341Combined sources7
Helixi343 – 345Combined sources3
Helixi348 – 360Combined sources13
Beta strandi378 – 380Combined sources3
Helixi386 – 389Combined sources4
Helixi392 – 397Combined sources6
Beta strandi398 – 400Combined sources3
Beta strandi404 – 411Combined sources8
Helixi416 – 419Combined sources4
Helixi420 – 438Combined sources19
Helixi442 – 451Combined sources10
Helixi456 – 462Combined sources7
Helixi463 – 466Combined sources4
Beta strandi474 – 481Combined sources8
Helixi484 – 505Combined sources22
Helixi513 – 515Combined sources3
Helixi516 – 528Combined sources13
Beta strandi530 – 532Combined sources3
Helixi540 – 552Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IATX-ray1.62A2-558[»]
1IRIX-ray2.40A/B/C/D1-558[»]
1JIQX-ray1.90A/B/C/D1-558[»]
1JLHX-ray2.10A/B/C/D1-558[»]
1NUHX-ray2.51A1-558[»]
ProteinModelPortaliP06744.
SMRiP06744.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP06744.

Family & Domainsi

Sequence similaritiesi

Belongs to the GPI family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000000707.
HOGENOMiHOG000261370.
HOVERGENiHBG002877.
InParanoidiP06744.
KOiK01810.
PhylomeDBiP06744.
TreeFamiTF300436.

Family and domain databases

Gene3Di1.10.1390.10. 1 hit.
HAMAPiMF_00473. G6P_isomerase. 1 hit.
InterProiIPR001672. G6P_Isomerase.
IPR023096. G6P_Isomerase_C.
IPR018189. Phosphoglucose_isomerase_CS.
[Graphical view]
PANTHERiPTHR11469. PTHR11469. 1 hit.
PfamiPF00342. PGI. 1 hit.
[Graphical view]
PRINTSiPR00662. G6PISOMERASE.
PROSITEiPS00765. P_GLUCOSE_ISOMERASE_1. 1 hit.
PS00174. P_GLUCOSE_ISOMERASE_2. 1 hit.
PS51463. P_GLUCOSE_ISOMERASE_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P06744-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALTRDPQF QKLQQWYREH RSELNLRRLF DANKDRFNHF SLTLNTNHGH
60 70 80 90 100
ILVDYSKNLV TEDVMRMLVD LAKSRGVEAA RERMFNGEKI NYTEGRAVLH
110 120 130 140 150
VALRNRSNTP ILVDGKDVMP EVNKVLDKMK SFCQRVRSGD WKGYTGKTIT
160 170 180 190 200
DVINIGIGGS DLGPLMVTEA LKPYSSGGPR VWYVSNIDGT HIAKTLAQLN
210 220 230 240 250
PESSLFIIAS KTFTTQETIT NAETAKEWFL QAAKDPSAVA KHFVALSTNT
260 270 280 290 300
TKVKEFGIDP QNMFEFWDWV GGRYSLWSAI GLSIALHVGF DNFEQLLSGA
310 320 330 340 350
HWMDQHFRTT PLEKNAPVLL ALLGIWYINC FGCETHAMLP YDQYLHRFAA
360 370 380 390 400
YFQQGDMESN GKYITKSGTR VDHQTGPIVW GEPGTNGQHA FYQLIHQGTK
410 420 430 440 450
MIPCDFLIPV QTQHPIRKGL HHKILLANFL AQTEALMRGK STEEARKELQ
460 470 480 490 500
AAGKSPEDLE RLLPHKVFEG NRPTNSIVFT KLTPFMLGAL VAMYEHKIFV
510 520 530 540 550
QGIIWDINSF DQWGVELGKQ LAKKIEPELD GSAQVTSHDA STNGLINFIK

QQREARVQ
Length:558
Mass (Da):63,147
Last modified:January 23, 2007 - v4
Checksum:i7C8E95277BDC79A6
GO
Isoform 2 (identifier: P06744-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVALCSLQHLGSSDPRALPTLPTATSGQRPAKRRRKSPAM
     135-162: Missing.

Note: No experimental confirmation available.
Show »
Length:569
Mass (Da):64,325
Checksum:i65537AD376C4FDF1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti158G → V in AAA36368 (Ref. 1) Curated1
Sequence conflicti426L → V in AAF22645 (PubMed:10727272).Curated1
Sequence conflicti436L → V in AAF22645 (PubMed:10727272).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0025165T → I in HA-GPID; GPI Matsumoto. 1 PublicationCorresponds to variant rs267606852dbSNPEnsembl.1
Natural variantiVAR_00251720H → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant rs137853586dbSNPEnsembl.1
Natural variantiVAR_00251875R → G in HA-GPID; GPI Elyria. 1 Publication1
Natural variantiVAR_00251983R → W in HA-GPID. 1 Publication1
Natural variantiVAR_002521101V → M in HA-GPID; GPI Sarcina. 1 PublicationCorresponds to variant rs757341382dbSNPEnsembl.1
Natural variantiVAR_002520159G → S in HA-GPID. 1 PublicationCorresponds to variant rs137853582dbSNPEnsembl.1
Natural variantiVAR_002522195T → I in HA-GPID; GPI Bari and Mola. 1 Publication1
Natural variantiVAR_018816208I → T.1 PublicationCorresponds to variant rs8191371dbSNPEnsembl.1
Natural variantiVAR_002523224T → M in HA-GPID; GPI Iwate. 2 PublicationsCorresponds to variant rs61754634dbSNPEnsembl.1
Natural variantiVAR_002524273R → H in HA-GPID. 1 Publication1
Natural variantiVAR_002525278S → L in HA-GPID. 1 PublicationCorresponds to variant rs34306618dbSNPEnsembl.1
Natural variantiVAR_002526300A → P in HA-GPID. 1 Publication1
Natural variantiVAR_033943308R → H.Corresponds to variant rs2230294dbSNPEnsembl.1
Natural variantiVAR_002527339L → P in HA-GPID; severe form with neurological deficits; GPI Homburg. 1 PublicationCorresponds to variant rs137853587dbSNPEnsembl.1
Natural variantiVAR_002528343Q → R in HA-GPID; GPI Narita and Morcone. 2 PublicationsCorresponds to variant rs267606851dbSNPEnsembl.1
Natural variantiVAR_002529347R → C in HA-GPID; GPI Mount Scopus. 2 PublicationsCorresponds to variant rs758132799dbSNPEnsembl.1
Natural variantiVAR_002530347R → H in HA-GPID. 1 PublicationCorresponds to variant rs137853583dbSNPEnsembl.1
Natural variantiVAR_002531375T → R in HA-GPID; GPI Kinki. 1 PublicationCorresponds to variant rs267606853dbSNPEnsembl.1
Natural variantiVAR_002532389H → R in HA-GPID; severe form; GPI Calden. 1 PublicationCorresponds to variant rs139382538dbSNPEnsembl.1
Natural variantiVAR_002533472R → H in HA-GPID. 1 PublicationCorresponds to variant rs148811525dbSNPEnsembl.1
Natural variantiVAR_002534487L → F in HA-GPID. 1 PublicationCorresponds to variant rs374583873dbSNPEnsembl.1
Natural variantiVAR_002535495E → K in HA-GPID. 1 Publication1
Natural variantiVAR_002536517L → V in HA-GPID; severe form; GPI Calden. 1 Publication1
Natural variantiVAR_002537525I → T in HA-GPID. 2 PublicationsCorresponds to variant rs137853584dbSNPEnsembl.1
Natural variantiVAR_002538539D → N in HA-GPID; GPI Fukuoka and Kinki. 1 PublicationCorresponds to variant rs137853585dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0434751M → MVALCSLQHLGSSDPRALPT LPTATSGQRPAKRRRKSPAM in isoform 2. 1 Publication1
Alternative sequenceiVSP_043476135 – 162Missing in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K03515 mRNA. Translation: AAA36368.1.
AF187554 mRNA. Translation: AAF22645.1.
AY324386 Genomic DNA. Translation: AAP72966.1.
AK294396 mRNA. Translation: BAG57650.1.
AC010504 Genomic DNA. No translation available.
AC092073 Genomic DNA. No translation available.
BC004982 mRNA. Translation: AAH04982.1.
AH002710 Genomic DNA. Translation: AAA52593.1.
CCDSiCCDS12437.1. [P06744-1]
CCDS54246.1. [P06744-2]
PIRiA35333.
RefSeqiNP_000166.2. NM_000175.4. [P06744-1]
NP_001171651.1. NM_001184722.1. [P06744-2]
NP_001316838.1. NM_001329909.1. [P06744-1]
NP_001316839.1. NM_001329910.1. [P06744-1]
NP_001316840.1. NM_001329911.1.
UniGeneiHs.466471.
Hs.515344.

Genome annotation databases

EnsembliENST00000356487; ENSP00000348877; ENSG00000105220. [P06744-1]
ENST00000415930; ENSP00000405573; ENSG00000105220. [P06744-2]
GeneIDi2821.
KEGGihsa:2821.
UCSCiuc002nvg.3. human. [P06744-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SHMPD

The Singapore human mutation and polymorphism database

Wikipedia

Phosphoglucose isomerase entry

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K03515 mRNA. Translation: AAA36368.1.
AF187554 mRNA. Translation: AAF22645.1.
AY324386 Genomic DNA. Translation: AAP72966.1.
AK294396 mRNA. Translation: BAG57650.1.
AC010504 Genomic DNA. No translation available.
AC092073 Genomic DNA. No translation available.
BC004982 mRNA. Translation: AAH04982.1.
AH002710 Genomic DNA. Translation: AAA52593.1.
CCDSiCCDS12437.1. [P06744-1]
CCDS54246.1. [P06744-2]
PIRiA35333.
RefSeqiNP_000166.2. NM_000175.4. [P06744-1]
NP_001171651.1. NM_001184722.1. [P06744-2]
NP_001316838.1. NM_001329909.1. [P06744-1]
NP_001316839.1. NM_001329910.1. [P06744-1]
NP_001316840.1. NM_001329911.1.
UniGeneiHs.466471.
Hs.515344.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IATX-ray1.62A2-558[»]
1IRIX-ray2.40A/B/C/D1-558[»]
1JIQX-ray1.90A/B/C/D1-558[»]
1JLHX-ray2.10A/B/C/D1-558[»]
1NUHX-ray2.51A1-558[»]
ProteinModelPortaliP06744.
SMRiP06744.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109082. 45 interactors.
IntActiP06744. 6 interactors.
MINTiMINT-4999095.

PTM databases

iPTMnetiP06744.
PhosphoSitePlusiP06744.
SwissPalmiP06744.

Polymorphism and mutation databases

BioMutaiGPI.
DMDMi17380385.

Proteomic databases

EPDiP06744.
MaxQBiP06744.
PeptideAtlasiP06744.
PRIDEiP06744.
TopDownProteomicsiP06744-1. [P06744-1]
P06744-2. [P06744-2]

Protocols and materials databases

DNASUi2821.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356487; ENSP00000348877; ENSG00000105220. [P06744-1]
ENST00000415930; ENSP00000405573; ENSG00000105220. [P06744-2]
GeneIDi2821.
KEGGihsa:2821.
UCSCiuc002nvg.3. human. [P06744-1]

Organism-specific databases

CTDi2821.
DisGeNETi2821.
GeneCardsiGPI.
HGNCiHGNC:4458. GPI.
HPAiCAB018655.
CAB040563.
HPA024305.
MalaCardsiGPI.
MIMi172400. gene.
613470. phenotype.
neXtProtiNX_P06744.
OpenTargetsiENSG00000105220.
Orphaneti712. Hemolytic anemia due to glucophosphate isomerase deficiency.
PharmGKBiPA28841.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000000707.
HOGENOMiHOG000261370.
HOVERGENiHBG002877.
InParanoidiP06744.
KOiK01810.
PhylomeDBiP06744.
TreeFamiTF300436.

Enzyme and pathway databases

UniPathwayiUPA00109; UER00181.
BioCyciMetaCyc:HS02693-MONOMER.
ZFISH:HS02693-MONOMER.
BRENDAi5.3.1.9. 2681.
ReactomeiR-HSA-5628897. TP53 Regulates Metabolic Genes.
R-HSA-6798695. Neutrophil degranulation.
R-HSA-70171. Glycolysis.
R-HSA-70263. Gluconeogenesis.
SABIO-RKP06744.
SIGNORiP06744.

Miscellaneous databases

ChiTaRSiGPI. human.
EvolutionaryTraceiP06744.
GeneWikiiGlucose-6-phosphate_isomerase.
GenomeRNAii2821.
PROiP06744.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105220.
CleanExiHS_GPI.
ExpressionAtlasiP06744. baseline and differential.
GenevisibleiP06744. HS.

Family and domain databases

Gene3Di1.10.1390.10. 1 hit.
HAMAPiMF_00473. G6P_isomerase. 1 hit.
InterProiIPR001672. G6P_Isomerase.
IPR023096. G6P_Isomerase_C.
IPR018189. Phosphoglucose_isomerase_CS.
[Graphical view]
PANTHERiPTHR11469. PTHR11469. 1 hit.
PfamiPF00342. PGI. 1 hit.
[Graphical view]
PRINTSiPR00662. G6PISOMERASE.
PROSITEiPS00765. P_GLUCOSE_ISOMERASE_1. 1 hit.
PS00174. P_GLUCOSE_ISOMERASE_2. 1 hit.
PS51463. P_GLUCOSE_ISOMERASE_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiG6PI_HUMAN
AccessioniPrimary (citable) accession number: P06744
Secondary accession number(s): B4DG39
, Q9BRD3, Q9BSK5, Q9UHE6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1988
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 193 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.