P06744 (G6PI_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 154.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glucose-6-phosphate isomerase Short name=GPI EC=5.3.1.9 Alternative name(s): Autocrine motility factor Short name=AMF Neuroleukin Short name=NLK Phosphoglucose isomerase Short name=PGI Phosphohexose isomerase Short name=PHI Sperm antigen 36 Short name=SA-36 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 558 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons. Ref.10 Ref.11 Ref.12 |
| Catalytic activity | D-glucose 6-phosphate = D-fructose 6-phosphate. |
| Pathway | |
| Subunit structure | Homodimer in the catalytically active form, monomer in the secreted form. Ref.20 |
| Subcellular location | |
| Post-translational modification | Phosphorylation at Ser-185 by CK2 has been shown to decrease enzymatic activity and may contribute to secretion by a non-classical secretory pathway. ISGylated. Ref.13 |
| Involvement in disease | Hemolytic anemia, non-spherocytic, due to glucose phosphate isomerase deficiency (HA-GPID) [MIM:613470]: A form of anemia in which there is no abnormal hemoglobin or spherocytosis. It is caused by glucose phosphate isomerase deficiency. |
| Sequence similarities | Belongs to the GPI family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P06744-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P06744-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVALCSLQHLGSSDPRALPTLPTATSGQRPAKRRRKSPAM 135-162: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 558 | 557 | Glucose-6-phosphate isomerase | PRO_0000180537 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 358 | 1 | Proton donor Ref.20 Ref.22 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 389 | 1 | Ref.20 Ref.22 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 519 | 1 | Ref.20 Ref.22 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 12 | 1 | N6-acetyllysine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 109 | 1 | Phosphothreonine Ref.15 Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 142 | 1 | N6-acetyllysine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 185 | 1 | Phosphoserine; by CK2 Ref.10 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 454 | 1 | N6-malonyllysine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MVALCSLQHLGSSDPRALPT LPTATSGQRPAKRRRKSPAM in isoform 2. | VSP_043475 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 135 – 162 | 28 | Missing in isoform 2. | VSP_043476 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 5 | 1 | T → I in HA-GPID; GPI Matsumoto. Ref.27 | VAR_002516 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 20 | 1 | H → P in HA-GPID; severe form with neurological deficits; GPI Homburg. Ref.29 | VAR_002517 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 75 | 1 | R → G in HA-GPID; GPI Elyria. Ref.28 | VAR_002518 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 83 | 1 | R → W in HA-GPID. Ref.25 | VAR_002519 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 101 | 1 | V → M in HA-GPID; GPI Sarcina. Ref.26 | VAR_002521 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 159 | 1 | G → S in HA-GPID. Ref.24 | VAR_002520 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 195 | 1 | T → I in HA-GPID; GPI Bari and Mola. Ref.26 | VAR_002522 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 208 | 1 | I → T. Ref.3 Corresponds to variant rs8191371 [ dbSNP | Ensembl ]. | VAR_018816 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 224 | 1 | T → M in HA-GPID; GPI Iwate. Ref.25 Ref.27 | VAR_002523 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 273 | 1 | R → H in HA-GPID. Ref.25 | VAR_002524 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 278 | 1 | S → L in HA-GPID. Ref.25 Corresponds to variant rs34306618 [ dbSNP | Ensembl ]. | VAR_002525 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 300 | 1 | A → P in HA-GPID. Ref.28 | VAR_002526 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 308 | 1 | R → H. Corresponds to variant rs2230294 [ dbSNP | Ensembl ]. | VAR_033943 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 339 | 1 | L → P in HA-GPID; severe form with neurological deficits; GPI Homburg. Ref.29 | VAR_002527 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 343 | 1 | Q → R in HA-GPID; GPI Narita and Morcone. Ref.26 Ref.27 | VAR_002528 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 347 | 1 | R → C in HA-GPID; GPI Mount Scopus. Ref.25 Ref.28 | VAR_002529 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 347 | 1 | R → H in HA-GPID. Ref.24 | VAR_002530 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 375 | 1 | T → R in HA-GPID; GPI Kinki. Ref.27 | VAR_002531 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 389 | 1 | H → R in HA-GPID; severe form; GPI Calden. Ref.29 | VAR_002532 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 472 | 1 | R → H in HA-GPID. Ref.28 | VAR_002533 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 487 | 1 | L → F in HA-GPID. Ref.25 | VAR_002534 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 495 | 1 | E → K in HA-GPID. Ref.25 | VAR_002535 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 517 | 1 | L → V in HA-GPID; severe form; GPI Calden. Ref.29 | VAR_002536 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 525 | 1 | I → T in HA-GPID. Ref.24 Ref.26 | VAR_002537 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 539 | 1 | D → N in HA-GPID; GPI Fukuoka and Kinki. Ref.27 | VAR_002538 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 185 | 1 | S → A: Retained full enzymatic activity. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 185 | 1 | S → E: Decreased enzymatic activity. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 158 | 1 | G → V in AAA36368. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 426 | 1 | L → V in AAF22645. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 436 | 1 | L → V in AAF22645. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 3 – 6 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 8 – 20 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 21 – 23 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 26 – 32 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 36 – 39 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 41 – 45 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 50 – 54 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 57 – 59 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 62 – 74 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 77 – 85 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 92 – 95 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 100 – 103 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 116 – 118 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 137 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 151 – 155 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 160 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 170 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 172 – 174 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 180 – 184 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 189 – 196 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 201 – 203 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 204 – 209 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 211 – 213 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 216 – 233 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 236 – 238 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 239 – 242 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 248 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 256 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 260 – 262 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 263 – 265 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 272 – 274 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 276 – 278 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 279 – 281 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 282 – 288 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 290 – 309 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 312 – 314 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 316 – 329 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 335 – 341 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 343 – 345 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 348 – 360 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 378 – 380 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 386 – 389 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 392 – 397 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 398 – 400 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 404 – 411 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 416 – 419 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 420 – 438 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 442 – 451 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 456 – 462 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 463 – 466 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 474 – 481 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 484 – 505 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 513 – 515 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 516 – 528 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 530 – 532 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 540 – 552 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Gurney M.E. Submitted (MAR-1987) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Cloning of a glucose phosphate isomerase/neuroleukin-like sperm antigen involved in sperm agglutination." Yakirevich E., Naot Y. Biol. Reprod. 62:1016-1023(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [3] | NIEHS SNPs program Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-208. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Amygdala. |
| [5] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| [7] | "Characterization of the 5' end of the gene for human glucose phosphate isomerase (GPI)." Walker J.I.H., Faik P., Morgan M.J. Genomics 7:638-643(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-71. |
| [8] | Bienvenut W.V. Submitted (OCT-2004) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-12; 58-73; 97-104; 181-226; 424-438 AND 455-461, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: B-cell lymphoma. |
| [9] | "Mouse glucose-6-phosphate isomerase and neuroleukin have identical 3' sequences." Faik P., Walker J.I.H., Redmill A.A.M., Morgan M.J. Nature 332:455-456(1988) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTITY OF NEUROLEUKIN AS PGI. |
| [10] | "Phosphohexose isomerase/autocrine motility factor/neuroleukin/maturation factor is a multifunctional phosphoprotein." Haga A., Niinaka Y., Raz A. Biochim. Biophys. Acta 1480:235-244(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT SER-185. |
| [11] | "Tumor autocrine motility factor is an angiogenic factor that stimulates endothelial cell motility." Funasaka T., Haga A., Raz A., Nagase H. Biochem. Biophys. Res. Commun. 285:118-128(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, CYTOKINE AND ANGIOGENIC FUNCTIONS. |
| [12] | "Species specificity of the cytokine function of phosphoglucose isomerase." Amraei M., Nabi I.R. FEBS Lett. 525:151-155(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SPECIES SPECIFICITY OF THE CYTOKINE FUNCTION. |
| [13] | "Proteomic identification of proteins conjugated to ISG15 in mouse and human cells." Giannakopoulos N.V., Luo J.K., Papov V., Zou W., Lenschow D.J., Jacobs B.S., Borden E.C., Li J., Virgin H.W., Zhang D.E. Biochem. Biophys. Res. Commun. 336:496-506(2005) [PubMed] [Europe PMC] [Abstract] Cited for: ISGYLATION. |
| [14] | "Differential regulation of phosphoglucose isomerase/autocrine motility factor activities by protein kinase CK2 phosphorylation." Yanagawa T., Funasaka T., Tsutsumi S., Raz T., Tanaka N., Raz A. J. Biol. Chem. 280:10419-10426(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-185, MUTAGENESIS OF SER-185. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-109, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-109, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [17] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-12 AND LYS-142, MASS SPECTROMETRY. |
| [18] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [19] | "The first identification of lysine malonylation substrates and its regulatory enzyme." Peng C., Lu Z., Xie Z., Cheng Z., Chen Y., Tan M., Luo H., Zhang Y., He W., Yang K., Zwaans B.M., Tishkoff D., Ho L., Lombard D., He T.C., Dai J., Verdin E., Ye Y., Zhao Y. Mol. Cell. Proteomics 10:M111.012658.01-M111.012658.12(2011) [PubMed] [Europe PMC] [Abstract] Cited for: MALONYLATION AT LYS-454. |
| [20] | "The crystal structure of human phosphoglucose isomerase at 1.6 A resolution: implications for catalytic mechanism, cytokine activity and haemolytic anaemia." Read J., Pearce J., Li X., Muirhead H., Chirgwin J., Davies C. J. Mol. Biol. 309:447-463(2001) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.62 ANGSTROMS), SUBUNIT, ACTIVE SITE. |
| [21] | "Inhibition mechanism of cytokine activity of human autocrine motility factor examined by crystal structure analyses and site-directed mutagenesis studies." Tanaka N., Haga A., Uemura H., Akiyama H., Funasaka T., Nagase H., Raz A., Nakamura K.T. J. Mol. Biol. 318:985-997(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) ALONE AND IN COMPLEX WITH INHIBITOR. |
| [22] | "The structure of human phosphoglucose isomerase complexed with a transition-state analogue." Davies C., Muirhead H., Chirgwin J. Acta Crystallogr. D 59:1111-1113(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.51 ANGSTROMS) IN COMPLEX WITH INHIBITOR, ACTIVE SITE. |
| [23] | "Crystal structure of human phosphoglucose isomerase and analysis of the initial catalytic steps." Cordeiro A.T., Godoi P.H., Silva C.H., Garratt R.C., Oliva G., Thiemann O.H. Biochim. Biophys. Acta 1645:117-122(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS), ACTIVE SITE. |
| [24] | "DNA sequence abnormalities in human glucose 6-phosphate isomerase deficiency." Walker J.I.H., Layton D.M., Bellingham A.J., Morgan M.J., Faik P. Hum. Mol. Genet. 2:327-329(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HA-GPID SER-159; HIS-347 AND THR-525. |
| [25] | "The characterization of gene mutations for human glucose phosphate isomerase deficiency associated with chronic hemolytic anemia." Xu W., Beutler E. J. Clin. Invest. 94:2326-2329(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HA-GPID TRP-83; MET-224; HIS-273; LEU-278; CYS-347; PHE-487 AND LYS-495. |
| [26] | "Study of the molecular defects in glucose phosphate isomerase-deficient patients affected by chronic hemolytic anemia." Baronciani L., Zanella A., Bianchi P., Zappa M., Alfinito F., Iolascon A., Tannoia N., Beutler E., Sirchia G. Blood 88:2306-2310(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HA-GPID MET-101; ILE-195; ARG-343 AND THR-525. |
| [27] | "Molecular analysis of glucose phosphate isomerase deficiency associated with hereditary hemolytic anemia." Kanno H., Fujii H., Hirono A., Ishida Y., Ohga S., Fukumoto Y., Matsuzawa K., Ogawa S., Miwa S. Blood 88:2321-2325(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HA-GPID ILE-5; MET-224; ARG-343; ARG-375 AND ASN-539. |
| [28] | "Glucosephosphate isomerase (GPI) deficiency mutations associated with hereditary nonspherocytic hemolytic anemia (HNSHA)." Beutler E., West C., Britton H.A., Harris J., Forman L. Blood Cells Mol. Dis. 23:402-409(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HA-GPID GLY-75; PRO-300; CYS-347 AND HIS-472. |
| [29] | "Molecular basis of neurological dysfunction coupled with haemolytic anaemia in human glucose-6-phosphate isomerase (GPI) deficiency." Kugler W., Breme K., Laspe P., Muirhead H., Davies C., Winkler H., Schroter W., Lakomek M. Hum. Genet. 103:450-454(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HA-GPID PRO-20; PRO-339; ARG-389 AND VAL-517. |
| + | Additional computationally mapped references. |
Web resources
| SHMPD The Singapore human mutation and polymorphism database |
| Wikipedia Phosphoglucose isomerase entry |
| NIEHS-SNPs |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | K03515 mRNA. Translation: AAA36368.1. AF187554 mRNA. Translation: AAF22645.1. AY324386 Genomic DNA. Translation: AAP72966.1. AK294396 mRNA. Translation: BAG57650.1. AC010504 Genomic DNA. No translation available. AC092073 Genomic DNA. No translation available. BC004982 mRNA. Translation: AAH04982.1. AH002710 Genomic DNA. Translation: AAA52593.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00027497. IPI00910781. | ||||||||||||||||||||||||||||||||||||
| PIR | A35333. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000166.2. NM_000175.3. NP_001171651.1. NM_001184722.1. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.466471. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P06744. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| IntAct | P06744. 4 interactions. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000348877. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P06744. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 17380385. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | P06744. | ||||||||||||||||||||||||||||||||||||
| PeptideAtlas | P06744. | ||||||||||||||||||||||||||||||||||||
| PRIDE | P06744. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 2821. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000356487; ENSP00000348877; ENSG00000105220. ENST00000415930; ENSP00000405573; ENSG00000105220. ENST00000588991; ENSP00000465858; ENSG00000105220. | ||||||||||||||||||||||||||||||||||||
| GeneID | 2821. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2821. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc002nvf.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 2821. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC19P034855. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:4458. GPI. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB018655. CAB040563. HPA024305. | ||||||||||||||||||||||||||||||||||||
| MIM | 172400. gene. 613470. phenotype. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P06744. | ||||||||||||||||||||||||||||||||||||
| Orphanet | 712. Hemolytic anemia due to glucophosphate isomerase deficiency. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA28841. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | COG0166. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000261371. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG002877. | ||||||||||||||||||||||||||||||||||||
| InParanoid | P06744. | ||||||||||||||||||||||||||||||||||||
| KO | K01810. | ||||||||||||||||||||||||||||||||||||
| OMA | LKMHFVS. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | P06744. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||||||||||||||||||||
| SABIO-RK | P06744. | ||||||||||||||||||||||||||||||||||||
| UniPathway | UPA00109; UER00181. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P06744. | ||||||||||||||||||||||||||||||||||||
| Bgee | P06744. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_GPI. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P06744. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000105220. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.1390.10. 1 hit. | ||||||||||||||||||||||||||||||||||||
| InterPro | IPR001672. G6P_Isomerase. IPR023096. G6P_Isomerase_C. IPR018189. Phosphoglucose_isomerase_CS. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11469. PTHR11469. 1 hit. | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00342. PGI. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PRINTS | PR00662. G6PISOMERASE. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS00765. P_GLUCOSE_ISOMERASE_1. 1 hit. PS00174. P_GLUCOSE_ISOMERASE_2. 1 hit. PS51463. P_GLUCOSE_ISOMERASE_3. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| ChiTaRS | GPI. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P06744. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 2821. | ||||||||||||||||||||||||||||||||||||
| NextBio | 11117. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | G6PI_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P06744 Secondary accession number(s): B4DG39 Q9UHE6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
