P06730 (IF4E_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 154.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Eukaryotic translation initiation factor 4E Short name=eIF-4E Short name=eIF4E Alternative name(s): eIF-4F 25 kDa subunit mRNA cap-binding protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 217 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Its translation stimulation activity is repressed by binding to the complex CYFIP1-FMR1 By similarity. Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates the binding to the mRNA cap. Ref.25 |
| Subunit structure | eIF4F is a multi-subunit complex, the composition of which varies with external and internal environmental conditions. It is composed of at least EIF4A, EIF4E and EIF4G1/EIF4G3. EIF4E is also known to interact with other partners. The interaction with EIF4ENIF1 mediates the import into the nucleus. Nonphosphorylated EIF4EBP1, EIF4EBP2 and EIF4EBP3 compete with EIF4G1/EIF4G3 to interact with EIF4E; insulin stimulated MAP-kinase (MAPK1 and MAPK3) phosphorylation of EIF4EBP1 causes dissociation of the complex allowing EIF4G1/EIF4G3 to bind and consequent initiation of translation. Rapamycin can attenuate insulin stimulation, mediated by FKBPs. Interacts mutually exclusive with EIF4A1 or EIF4A2. Interacts with NGDN and PIWIL2. Component of the CYFIP1-EIF4E-FMR1 complex composed of CYFIP, EIF4E and FMR1. Interacts directly with CYFIP1 By similarity. Interacts with Lassa virus Z protein. Binds to MKNK2 in nucleus. Interacts with LIMD1, WTIP and AJUBA. Interacts with APOBEC3G in an RNA-dependent manner. Ref.14 Ref.15 Ref.17 Ref.19 Ref.20 Ref.21 Ref.25 |
| Subcellular location | |
| Post-translational modification | Phosphorylation increases the ability of the protein to bind to mRNA caps and to form the eIF4F complex. |
| Sequence similarities | Belongs to the eukaryotic initiation factor 4E family. |
| Caution | Was originally thought to be phosphorylated on Ser-53 (Ref.9); this was later shown to be wrong (Ref.13). |
| Mass spectrometry | Molecular mass is 24964.3 Da from positions 2 - 217. Determined by ESI. Ref.26 Molecular mass is 24960 Da from positions 2 - 217. Determined by ESI. Ref.27 |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EIF4EBP1 | Q13541 | 4 | EBI-73440,EBI-74090 | |
| EIF4EBP3 | O60516 | 2 | EBI-73440,EBI-746950 | |
| EIF4ENIF1 | Q9NRA8 | 5 | EBI-73440,EBI-301024 | |
| EIF4G1 | Q04637 | 2 | EBI-73440,EBI-73711 | |
| EMX2 | Q04743 | 4 | EBI-73440,EBI-399831 | |
| GEMIN5 | Q8TEQ6 | 3 | EBI-73440,EBI-443630 | |
| MKNK1 | Q9BUB5 | 2 | EBI-73440,EBI-73837 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P06730-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P06730-2) The sequence of this isoform differs from the canonical sequence as follows: 133-133: T → TRWDLAMLPRLVSNFWPQVILPLQPPKVLELQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P06730-3) The sequence of this isoform differs from the canonical sequence as follows: 1-6: MATVEP → MLDLTSRGQVGTSRRMAEAACSAHFL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.26 | |||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 217 | 216 | Eukaryotic translation initiation factor 4E | PRO_0000193634 | ||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 37 – 40 | 4 | EIF4EBP1/2/3 binding | |||||||||||||||||||||||||||||||||||||||||||||
| Region | 56 – 57 | 2 | 7-methylguanosine-containing mRNA cap binding | |||||||||||||||||||||||||||||||||||||||||||||
| Region | 73 – 77 | 5 | EIF4EBP1/2/3 binding | |||||||||||||||||||||||||||||||||||||||||||||
| Region | 102 – 103 | 2 | 7-methylguanosine-containing mRNA cap binding | |||||||||||||||||||||||||||||||||||||||||||||
| Region | 132 – 139 | 8 | EIF4EBP1/2/3 binding | |||||||||||||||||||||||||||||||||||||||||||||
| Region | 157 – 162 | 6 | 7-methylguanosine-containing mRNA cap binding | |||||||||||||||||||||||||||||||||||||||||||||
| Region | 205 – 207 | 3 | 7-methylguanosine-containing mRNA cap binding | |||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 209 | 1 | Phosphoserine; by PKC and MKNK2 Ref.12 Ref.13 Ref.18 | |||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 6 | 6 | MATVEP → MLDLTSRGQVGTSRRMAEAA CSAHFL in isoform 3. | VSP_043591 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 133 | 1 | T → TRWDLAMLPRLVSNFWPQVI LPLQPPKVLELQ in isoform 2. | VSP_042014 | ||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 53 | 1 | S → A or D: No effect on phosphorylation level nor incorporation into eIF4F complex. Ref.10 Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 102 | 1 | W → L: Decrease in mRNA cap binding; when associated with A-105. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 103 | 1 | E → A: No effect. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 104 | 1 | D → A: No effect. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 105 | 1 | E → A: Decrease in mRNA cap binding; when associated with L-102. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 119 | 1 | K → A: Higher affinity for EIF4G1. Ref.26 | |||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 127 | 1 | D → N in AAH12611. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 31 – 33 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 38 – 48 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 52 – 54 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 57 – 59 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 68 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 78 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 82 – 84 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 95 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 100 – 103 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 105 – 109 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 111 – 116 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 121 – 124 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 126 – 138 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 139 – 142 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 143 – 148 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 149 – 155 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 162 – 168 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 173 – 187 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 188 – 192 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 196 – 199 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 202 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 206 – 208 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 216 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Amino acid sequence of the mRNA cap-binding protein from human tissues." Rychlik W., Domier L.L., Gardner P.R., Hellmann G.M., Rhoads R.E. Proc. Natl. Acad. Sci. U.S.A. 84:945-949(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | Erratum Rychlik W., Domier L.L., Gardner P.R., Hellmann G.M., Rhoads R.E. Proc. Natl. Acad. Sci. U.S.A. 89:1148-1148(1992) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION TO 108 AND 189. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Small intestine. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Testis. |
| [6] | "Transcriptome analysis of human gastric cancer." Oh J.H., Yang J.O., Hahn Y., Kim M.R., Byun S.S., Jeon Y.J., Kim J.M., Song K.S., Noh S.M., Kim S., Yoo H.S., Kim Y.S., Kim N.S. Mamm. Genome 16:942-954(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-214 (ISOFORM 2). Tissue: Myeloma. |
| [7] | "Phosphorylation of the proto-oncogene product eukaryotic initiation factor 4E is a common cellular response to tumor necrosis factor." Marino M.W., Feld L.J., Jaffe E.A., Pfeffer L.M., Han Y.-M., Donner D.B. J. Biol. Chem. 266:2685-2688(1991) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| [8] | "Combination of Trp and Glu residues for recognition of mRNA cap structure. Analysis of m7G base recognition site of human cap binding protein (IF-4E) by site-directed mutagenesis." Ueda H., Iyo H., Doi M., Inoue M., Ishida T., Morioka H., Tanaka T., Nishikawa S., Uesugi S. FEBS Lett. 280:207-210(1991) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF TRP-102; GLU-103; ASP-104 AND GLU-105. |
| [9] | "Phosphorylation site of eukaryotic initiation factor 4E." Rychlik W., Russ M.A., Rhoads R.E. J. Biol. Chem. 262:10434-10437(1987) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION. |
| [10] | "Characterization of wild-type and Ser53 mutant eukaryotic initiation factor 4E overexpression in mammalian cells." Kaufman R.J., Murtha-Riel P., Pittman D.D., Davies M.V. J. Biol. Chem. 268:11902-11909(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, MUTAGENESIS OF SER-53. |
| [11] | "Role of Ser-53 phosphorylation in the activity of human translation initiation factor eIF-4E in mammalian and yeast cells." Zhang Y., Klein H.L., Schneider R.J. Gene 163:283-288(1995) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, MUTAGENESIS OF SER-53. |
| [12] | "Phosphorylation of eukaryotic protein synthesis initiation factor 4E at Ser-209." Joshi B., Cai A.L., Keiper B.D., Minich W.B., Mendez R., Beach C.M., Stepinski J., Stolarski R., Darzynkiewicz E., Rhoads R.E. J. Biol. Chem. 270:14597-14603(1995) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-209. |
| [13] | "Serine 209, not serine 53, is the major site of phosphorylation in initiation factor eIF-4E in serum-treated Chinese hamster ovary cells." Flynn A., Proud C.G. J. Biol. Chem. 270:21684-21688(1995) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-209. |
| [14] | "Repression of cap-dependent translation by 4E-binding protein 1: competition with p220 for binding to eukaryotic initiation factor-4E." Haghighat A., Mader S., Pause A., Sonenberg N. EMBO J. 14:5701-5709(1995) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF4G AND EIF4EBP1. |
| [15] | "A novel shuttling protein, 4E-T, mediates the nuclear import of the mRNA 5' cap-binding protein, eIF4E." Dostie J., Ferraiuolo M., Pause A., Adam S.A., Sonenberg N. EMBO J. 19:3142-3156(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF4ENIF1. Tissue: Fetal brain and Placenta. |
| [16] | "Human eukaryotic translation initiation factor 4G (eIF4G) recruits mnk1 to phosphorylate eIF4E." Pyronnet S., Imataka H., Gingras A.-C., Fukunaga R., Hunter T., Sonenberg N. EMBO J. 18:270-279(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY MKNK1. |
| [17] | "Eukaryotic initiation factors 4A (eIF4A) and 4G (eIF4G) mutually interact in a 1:1 ratio in vivo." Li W., Belsham G.J., Proud C.G. J. Biol. Chem. 276:29111-29115(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF4A1 AND EIF4A2. |
| [18] | "The mitogen-activated protein kinase signal-integrating kinase Mnk2 is a eukaryotic initiation factor 4E kinase with high levels of basal activity in mammalian cells." Scheper G.C., Morrice N.A., Kleijn M., Proud C.G. Mol. Cell. Biol. 21:743-754(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-209 BY MKNK2. |
| [19] | "The N and C termini of the splice variants of the human mitogen-activated protein kinase-interacting kinase Mnk2 determine activity and localization." Scheper G.C., Parra J.L., Wilson M., Van Kollenburg B., Vertegaal A.C.O., Han Z.-G., Proud C.G. Mol. Cell. Biol. 23:5692-5705(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MKNK2. |
| [20] | "Human retroviral host restriction factors APOBEC3G and APOBEC3F localize to mRNA processing bodies." Wichroski M.J., Robb G.B., Rana T.M. PLoS Pathog. 2:E41-E41(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH APOBEC3G. |
| [21] | "LIM-domain proteins, LIMD1, Ajuba, and WTIP are required for microRNA-mediated gene silencing." James V., Zhang Y., Foxler D.E., de Moor C.H., Kong Y.W., Webb T.M., Self T.J., Feng Y., Lagos D., Chu C.Y., Rana T.M., Morley S.J., Longmore G.D., Bushell M., Sharp T.V. Proc. Natl. Acad. Sci. U.S.A. 107:12499-12504(2010) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH LIMD1; WTIP AND AJUBA. |
| [22] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [23] | "Crystal structures of 7-methylguanosine 5'-triphosphate (m(7)GTP)- and P(1)-7-methylguanosine-P(3)-adenosine-5',5'-triphosphate (m(7)GpppA)-bound human full-length eukaryotic initiation factor 4E: biological importance of the C-terminal flexible region." Tomoo K., Shen X., Okabe K., Nozoe Y., Fukuhara S., Morino S., Ishida T., Taniguchi T., Hasegawa H., Terashima A., Sasaki M., Katsuya Y., Kitamura K., Miyoshi H., Ishikawa M., Miura K. Biochem. J. 362:539-544(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) IN COMPLEX WITH MRNA CAP ANALOGS. |
| [24] | "Backbone resonance assignment of human eukaryotic translation initiation factor 4E (eIF4E) in complex with 7-methylguanosine diphosphate (m7GDP) and a 17-amino acid peptide derived from human eIF4GII." Miura T., Shiratori Y., Shimma N. J. Biomol. NMR 27:279-280(2003) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR IN COMPLEX WITH EIF4G3 AND MRNA CAP ANALOGS. |
| [25] | "Structural basis for mRNA cap-binding regulation of eukaryotic initiation factor 4E by 4E-binding protein, studied by spectroscopic, X-ray crystal structural, and molecular dynamics simulation methods." Tomoo K., Matsushita Y., Fujisaki H., Abiko F., Shen X., Taniguchi T., Miyagawa H., Kitamura K., Miura K., Ishida T. Biochim. Biophys. Acta 1753:191-208(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 27-217 IN COMPLEX WITH MRNA CAP ANALOG AND EIF4EBP1, FUNCTION, INTERACTION WITH EIF4EBP1; EIF4EBP2 AND EIF4EBP3. |
| [26] | "Cap-free structure of eIF4E suggests a basis for conformational regulation by its ligands." Volpon L., Osborne M.J., Topisirovic I., Siddiqui N., Borden K.L.B. EMBO J. 25:5138-5149(2006) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR, CLEAVAGE OF INITIATOR METHIONINE, MASS SPECTROMETRY, MUTAGENESIS OF LYS-119. |
| [27] | "Crystallographic and mass spectrometric characterisation of eIF4E with N7-alkylated cap derivatives." Brown C.J., McNae I., Fischer P.M., Walkinshaw M.D. J. Mol. Biol. 372:7-15(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) IN COMPLEX WITH MRNA CAP ANALOGS, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M15353 mRNA. Translation: AAC13647.1. AK300982 mRNA. Translation: BAH13387.1. AC019131 Genomic DNA. No translation available. AC093836 Genomic DNA. No translation available. BC012611 mRNA. Translation: AAH12611.1. BC035166 mRNA. Translation: AAH35166.1. BC043226 mRNA. Translation: AAH43226.1. BM849222 mRNA. No translation available. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00027485. IPI00873680. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A26411. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001124150.1. NM_001130678.1. NP_001124151.1. NM_001130679.1. NP_001959.1. NM_001968.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.249718. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-22N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P06730. 20 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-85626. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000280892. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 1352435. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OGP | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00027485. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 1977. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000280892; ENSP00000280892; ENSG00000151247. ENST00000450253; ENSP00000389624; ENSG00000151247. ENST00000505992; ENSP00000425561; ENSG00000151247. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 1977. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:1977. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003hue.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 1977. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC04M099799. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0039231. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:3287. EIF4E. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB004077. CAB016316. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 133440. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 106. Autism. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA27714. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG5053. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000186751. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG006130. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K03259. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | FWLETRW. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG48GW45. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | mtor_4pathway. mTOR signaling pathway. p38alphabetadownstreampathway. Signaling mediated by p38-alpha and p38-beta. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_1675. mRNA Processing. REACT_17015. Metabolism of proteins. REACT_1762. 3' -UTR-mediated translational regulation. REACT_21257. Metabolism of RNA. REACT_6900. Immune System. REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_EIF4E. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000151247. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 3.30.760.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR023398. TIF_eIF4e-like_dom. IPR001040. TIF_eIF_4E. IPR019770. TIF_eIF_4E_CS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11960. PTHR11960. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01652. IF4E. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF55418. TIF_eIF_4E. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00813. IF4E. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4848. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | EIF4E. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P06730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 1977. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 7999. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | IF4E_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P06730 Secondary accession number(s): B7Z6V1, D6RCQ6, Q96E95 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Translation initiation factors List of translation initiation factor entries |
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
