Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

Myl1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Enzyme and pathway databases

ReactomeiR-MMU-390522. Striated Muscle Contraction.

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:Myl1
Synonyms:Mylf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:97269. Myl1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 188187Myosin light chain 1/3, skeletal muscle isoformPRO_0000198682Add
BLAST
Isoform MLC3 (identifier: P05977-2)
Initiator methionineiRemovedBy similarity

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N,N,N-trimethylalanineBy similarity
Modified residuei65 – 651PhosphothreonineBy similarity
Modified residuei67 – 671PhosphoserineBy similarity
Modified residuei81 – 811PhosphothreonineBy similarity
Modified residuei93 – 931PhosphoserineBy similarity
Isoform MLC3 (identifier: P05977-2)
Modified residuei2 – 21N-acetylalanine By similarityBy similarity

Post-translational modificationi

Isoform MLC3 is acetylated at position 2.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiP05977.
PaxDbiP05977.
PeptideAtlasiP05977.
PRIDEiP05977.

2D gel databases

SWISS-2DPAGEP05977.
UCD-2DPAGEP05977.

PTM databases

iPTMnetiP05977.
PhosphoSiteiP05977.

Expressioni

Gene expression databases

BgeeiP05977.
CleanExiMM_MYL1.
ExpressionAtlasiP05977. baseline and differential.
GenevisibleiP05977. MM.

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridi201656. 2 interactions.
IntActiP05977. 1 interaction.
MINTiMINT-149848.
STRINGi10090.ENSMUSP00000027151.

Structurei

3D structure databases

ProteinModelPortaliP05977.
SMRiP05977. Positions 44-188.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini44 – 7936EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini121 – 15636EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini156 – 18833EF-hand 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0030. Eukaryota.
COG5126. LUCA.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP05977.
KOiK05738.
OMAiTNAEINK.
OrthoDBiEOG7HQN9N.
PhylomeDBiP05977.
TreeFamiTF351553.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MLC1 (identifier: P05977-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKKDVKKP AAAPAPAPAP APAPAKPKEE KIDLSAIKIE FSKEQQEDFK
60 70 80 90 100
EAFLLFDRTG ECKITLSQVG DVLRALGTNP TNAEVKKVLG NPSNEEMNAK
110 120 130 140 150
KIEFEQFLPM MQAISNNKDQ GGYEDFVEGL RVFDKEGNGT VMGAELRHVL
160 170 180
ATLGEKMKEE EVEALLAGQE DSNGCINYEA FVKHIMSV
Length:188
Mass (Da):20,595
Last modified:January 23, 2007 - v2
Checksum:i84C580DA22E25217
GO
Isoform MLC3 (identifier: P05977-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MAPKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQE → MSFSADQIA

Show »
Length:150
Mass (Da):16,600
Checksum:i5822D8DF0F994994
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4747MAPKK…KEQQE → MSFSADQIA in isoform MLC3. CuratedVSP_038687Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K02241
, K02237, K02238, K02239, K02240 Genomic DNA. Translation: AAA39718.1.
K02241
, K02238, K02239, K02240 Genomic DNA. Translation: AAA39719.1.
X12973 Genomic DNA. Translation: CAA31416.1.
CCDSiCCDS15024.1. [P05977-1]
CCDS48284.1. [P05977-2]
PIRiA23253.
B23253.
RefSeqiNP_001106858.1. NM_001113387.1. [P05977-2]
NP_067260.1. NM_021285.3. [P05977-1]
XP_006495826.1. XM_006495763.1. [P05977-1]
XP_006536976.1. XM_006536913.2. [P05977-1]
UniGeneiMm.1000.

Genome annotation databases

EnsembliENSMUST00000027151; ENSMUSP00000027151; ENSMUSG00000061816. [P05977-1]
ENSMUST00000119429; ENSMUSP00000112861; ENSMUSG00000061816. [P05977-2]
GeneIDi17901.
KEGGimmu:17901.
UCSCiuc007bit.2. mouse. [P05977-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
K02241
, K02237, K02238, K02239, K02240 Genomic DNA. Translation: AAA39718.1.
K02241
, K02238, K02239, K02240 Genomic DNA. Translation: AAA39719.1.
X12973 Genomic DNA. Translation: CAA31416.1.
CCDSiCCDS15024.1. [P05977-1]
CCDS48284.1. [P05977-2]
PIRiA23253.
B23253.
RefSeqiNP_001106858.1. NM_001113387.1. [P05977-2]
NP_067260.1. NM_021285.3. [P05977-1]
XP_006495826.1. XM_006495763.1. [P05977-1]
XP_006536976.1. XM_006536913.2. [P05977-1]
UniGeneiMm.1000.

3D structure databases

ProteinModelPortaliP05977.
SMRiP05977. Positions 44-188.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201656. 2 interactions.
IntActiP05977. 1 interaction.
MINTiMINT-149848.
STRINGi10090.ENSMUSP00000027151.

PTM databases

iPTMnetiP05977.
PhosphoSiteiP05977.

2D gel databases

SWISS-2DPAGEP05977.
UCD-2DPAGEP05977.

Proteomic databases

EPDiP05977.
PaxDbiP05977.
PeptideAtlasiP05977.
PRIDEiP05977.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027151; ENSMUSP00000027151; ENSMUSG00000061816. [P05977-1]
ENSMUST00000119429; ENSMUSP00000112861; ENSMUSG00000061816. [P05977-2]
GeneIDi17901.
KEGGimmu:17901.
UCSCiuc007bit.2. mouse. [P05977-1]

Organism-specific databases

CTDi4632.
MGIiMGI:97269. Myl1.

Phylogenomic databases

eggNOGiKOG0030. Eukaryota.
COG5126. LUCA.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP05977.
KOiK05738.
OMAiTNAEINK.
OrthoDBiEOG7HQN9N.
PhylomeDBiP05977.
TreeFamiTF351553.

Enzyme and pathway databases

ReactomeiR-MMU-390522. Striated Muscle Contraction.

Miscellaneous databases

ChiTaRSiMyl1. mouse.
PROiP05977.
SOURCEiSearch...

Gene expression databases

BgeeiP05977.
CleanExiMM_MYL1.
ExpressionAtlasiP05977. baseline and differential.
GenevisibleiP05977. MM.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A single locus in the mouse encodes both myosin light chains 1 and 3, a second locus corresponds to a related pseudogene."
    Robert B., Daubas P., Akimenko M.-A., Cohen A., Garner I., Guenet J.-L., Buckingham M.E.
    Cell 39:129-140(1984) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
  2. "Promoter analysis of myosin alkali light chain genes expressed in mouse striated muscle."
    Cohen A., Barton P.J.R., Robert B., Garner I., Alonso S., Buckingham M.E.
    Nucleic Acids Res. 16:10037-10052(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-38.
  3. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brown adipose tissue.

Entry informationi

Entry nameiMYL1_MOUSE
AccessioniPrimary (citable) accession number: P05977
Secondary accession number(s): P05978
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: January 23, 2007
Last modified: July 6, 2016
This is version 142 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.