P05976 (MYL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Myosin light chain 1/3, skeletal muscle isoform Short name=MLC1/MLC3 Short name=MLC1F/MLC3F Alternative name(s): Myosin light chain alkali 1/2 Short name=Myosin light chain A1/A2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 194 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulatory light chain of myosin. Does not bind calcium. |
| Subunit structure | Myosin is a hexamer of 2 heavy chains and 4 light chains. |
| Post-translational modification | Isoform MLC3 is acetylated at position 2 By similarity. |
| Sequence similarities | Contains 3 EF-hand domains. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Molecular function | Motor protein Muscle protein Myosin |
| PTM | Acetylation Methylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cardiac muscle contraction Inferred from electronic annotation. Source: Compara muscle filament slidingNon-traceable author statement PubMed 3904738. Source: BHF-UCL muscle organ developmentNon-traceable author statement. Source: UniProtKB |
| Cellular_component | cytosol Traceable author statement. Source: Reactome muscle myosin complexNon-traceable author statement PubMed 3904738. Source: BHF-UCL sarcomereNon-traceable author statement PubMed 3904738. Source: BHF-UCL |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro structural constituent of muscleNon-traceable author statement PubMed 3904738. Source: BHF-UCL |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform MLC1 (identifier: P05976-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform MLC3 (identifier: P05976-2) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA | ||||||
| Note: Initiator Met-1 is removed. Contains a N-acetylalanine at position 2 (By similarity). |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 194 | 193 | Myosin light chain 1/3, skeletal muscle isoform | PRO_0000198681 | |||||
Regions | |||||||||
| Domain | 50 – 85 | 36 | EF-hand 1 | ||||||
| Domain | 127 – 162 | 36 | EF-hand 2 | ||||||
| Domain | 162 – 194 | 33 | EF-hand 3 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N,N,N-trimethylalanine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 53 | 53 | MAPKK…KEQQD → MSFSADQIA in isoform MLC3. | VSP_038686 | |||||
Experimental info | |||||||||
| Sequence conflict | 45 | 1 | I → M in CAB42646. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3." Seidel U., Bober E., Winter B., Lenz S., Lohse P., Arnold H.H. Nucleic Acids Res. 15:4989-4989(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3). Tissue: Fetal muscle. |
| [2] | "Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms." Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H. Gene 66:135-146(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3). |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS MLC1 AND MLC3). Tissue: Skeletal muscle. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC3). Tissue: Liver. |
| [7] | "Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle." Seidel U., Arnold H.H. J. Biol. Chem. 264:16109-16117(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-44. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X05450 mRNA. Translation: CAB42646.1. X05451 mRNA. Translation: CAA29020.1. M20642 mRNA. Translation: AAA59854.1. M20643 mRNA. Translation: AAA59855.1. CR456869 mRNA. Translation: CAG33150.1. AK311942 mRNA. Translation: BAG34883.1. AK311892 mRNA. Translation: BAG34833.1. CH471063 Genomic DNA. Translation: EAW70483.1. CH471063 Genomic DNA. Translation: EAW70484.1. BC005318 mRNA. Translation: AAH05318.1. J05026 Genomic DNA. Translation: AAA66960.1. |
| IPI | IPI00216070. IPI00220332. |
| PIR | MOHUA1. JS0431. MOHUA2. S07939. |
| RefSeq | NP_524144.1. NM_079420.2. NP_524146.1. NM_079422.2. |
| UniGene | Hs.187338. |
3D structure databases | |
| ProteinModelPortal | P05976. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P05976. 1 interaction. |
| STRING | 9606.ENSP00000307280. |
PTM databases | |
| PhosphoSite | P05976. |
Polymorphism databases | |
| DMDM | 127128. |
2D gel databases | |
| SWISS-2DPAGE | P05976. |
Proteomic databases | |
| PaxDb | P05976. |
| PRIDE | P05976. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000341685; ENSP00000343321; ENSG00000168530. ENST00000352451; ENSP00000307280; ENSG00000168530. |
| GeneID | 4632. |
| KEGG | hsa:4632. |
| UCSC | uc002veb.3. human. uc002vec.3. human. |
Organism-specific databases | |
| CTD | 4632. |
| GeneCards | GC02M211118. |
| HGNC | HGNC:7582. MYL1. |
| MIM | 160780. gene. |
| neXtProt | NX_P05976. |
| PharmGKB | PA31379. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5126. |
| HOGENOM | HOG000233018. |
| HOVERGEN | HBG012180. |
| InParanoid | P05976. |
| KO | K05738. |
| OMA | SKEQQDD. |
Enzyme and pathway databases | |
| Reactome | REACT_17044. Muscle contraction. |
Gene expression databases | |
| ArrayExpress | P05976. |
| Bgee | P05976. |
| CleanEx | HS_MYL1. |
| Genevestigator | P05976. |
| GermOnline | ENSG00000168530. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 2 hits. |
| InterPro | IPR011992. EF-hand-like_dom. IPR002048. EF_hand_dom. [Graphical view] |
| Pfam | PF13405. EF_hand_4. 1 hit. [Graphical view] |
| SMART | SM00054. EFh. 2 hits. [Graphical view] |
| PROSITE | PS50222. EF_HAND_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 4632. |
| NextBio | 17830. |
| SOURCE | Search... |
Entry information
| Entry name | MYL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P05976 Secondary accession number(s): B2R4N6 Q6IBD5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
