Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P05976

- MYL1_HUMAN

UniProt

P05976 - MYL1_HUMAN

Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

MYL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 135 (01 Oct 2014)
      Sequence version 3 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regulatory light chain of myosin. Does not bind calcium.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. structural constituent of muscle Source: BHF-UCL

    GO - Biological processi

    1. cardiac muscle contraction Source: Ensembl
    2. muscle contraction Source: BHF-UCL
    3. muscle filament sliding Source: BHF-UCL

    Keywords - Molecular functioni

    Motor protein, Muscle protein, Myosin

    Enzyme and pathway databases

    ReactomeiREACT_16969. Striated Muscle Contraction.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Myosin light chain 1/3, skeletal muscle isoform
    Short name:
    MLC1/MLC3
    Short name:
    MLC1F/MLC3F
    Alternative name(s):
    Myosin light chain alkali 1/2
    Short name:
    Myosin light chain A1/A2
    Gene namesi
    Name:MYL1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:7582. MYL1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. muscle myosin complex Source: BHF-UCL
    3. myofibril Source: BHF-UCL
    4. sarcomere Source: BHF-UCL

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31379.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 194193Myosin light chain 1/3, skeletal muscle isoformPRO_0000198681Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N,N,N-trimethylalanineBy similarity

    Post-translational modificationi

    Isoform MLC3 is acetylated at position 2.By similarity

    Keywords - PTMi

    Acetylation, Methylation

    Proteomic databases

    MaxQBiP05976.
    PaxDbiP05976.
    PRIDEiP05976.

    2D gel databases

    SWISS-2DPAGEP05976.

    PTM databases

    PhosphoSiteiP05976.

    Expressioni

    Gene expression databases

    ArrayExpressiP05976.
    BgeeiP05976.
    CleanExiHS_MYL1.
    GenevestigatoriP05976.

    Interactioni

    Subunit structurei

    Myosin is a hexamer of 2 heavy chains and 4 light chains.

    Protein-protein interaction databases

    BioGridi110716. 7 interactions.
    IntActiP05976. 2 interactions.
    STRINGi9606.ENSP00000307280.

    Structurei

    3D structure databases

    ProteinModelPortaliP05976.
    SMRiP05976. Positions 50-194.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini50 – 8536EF-hand 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini127 – 16236EF-hand 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini162 – 19433EF-hand 3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 3 EF-hand domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiCOG5126.
    HOGENOMiHOG000233018.
    HOVERGENiHBG012180.
    InParanoidiP05976.
    KOiK05738.
    OMAiDRTGDAK.
    OrthoDBiEOG7HQN9N.
    PhylomeDBiP05976.
    TreeFamiTF351553.

    Family and domain databases

    Gene3Di1.10.238.10. 2 hits.
    InterProiIPR011992. EF-hand-dom_pair.
    IPR002048. EF_hand_dom.
    [Graphical view]
    PfamiPF13405. EF-hand_6. 1 hit.
    [Graphical view]
    SMARTiSM00054. EFh. 2 hits.
    [Graphical view]
    PROSITEiPS50222. EF_HAND_2. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform MLC1 (identifier: P05976-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPKKDVKKP VAAAAAAPAP APAPAPAPAP AKPKEEKIDL SAIKIEFSKE    50
    QQDEFKEAFL LFDRTGDSKI TLSQVGDVLR ALGTNPTNAE VRKVLGNPSN 100
    EELNAKKIEF EQFLPMMQAI SNNKDQATYE DFVEGLRVFD KEGNGTVMGA 150
    ELRHVLATLG EKMKEEEVEA LMAGQEDSNG CINYEAFVKH IMSI 194
    Length:194
    Mass (Da):21,145
    Last modified:January 23, 2007 - v3
    Checksum:iDA1F5C5E4C8A2124
    GO
    Isoform MLC3 (identifier: P05976-2) [UniParc] [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2-53: APKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA

    Note: Initiator Met-1 is removed. Contains a N-acetylalanine at position 2 (By similarity).By similarity

    Show »
    Length:151
    Mass (Da):16,815
    Checksum:i94F2613A9887E25F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti45 – 451I → M in CAB42646. (PubMed:3601661)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 5352APKKD…KEQQD → MSFSADQIA in isoform MLC3. 4 PublicationsVSP_038686Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X05450 mRNA. Translation: CAB42646.1.
    X05451 mRNA. Translation: CAA29020.1.
    M20642 mRNA. Translation: AAA59854.1.
    M20643 mRNA. Translation: AAA59855.1.
    CR456869 mRNA. Translation: CAG33150.1.
    AK311942 mRNA. Translation: BAG34883.1.
    AK311892 mRNA. Translation: BAG34833.1.
    CH471063 Genomic DNA. Translation: EAW70483.1.
    CH471063 Genomic DNA. Translation: EAW70484.1.
    BC005318 mRNA. Translation: AAH05318.1.
    J05026 Genomic DNA. Translation: AAA66960.1.
    CCDSiCCDS2390.1. [P05976-1]
    PIRiJS0431. MOHUA1.
    S07939. MOHUA2.
    RefSeqiNP_524144.1. NM_079420.2. [P05976-1]
    NP_524146.1. NM_079422.2.
    UniGeneiHs.187338.

    Genome annotation databases

    EnsembliENST00000341685; ENSP00000343321; ENSG00000168530. [P05976-2]
    ENST00000352451; ENSP00000307280; ENSG00000168530. [P05976-1]
    GeneIDi4632.
    KEGGihsa:4632.
    UCSCiuc002veb.3. human. [P05976-2]
    uc002vec.3. human. [P05976-1]

    Polymorphism databases

    DMDMi127128.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X05450 mRNA. Translation: CAB42646.1 .
    X05451 mRNA. Translation: CAA29020.1 .
    M20642 mRNA. Translation: AAA59854.1 .
    M20643 mRNA. Translation: AAA59855.1 .
    CR456869 mRNA. Translation: CAG33150.1 .
    AK311942 mRNA. Translation: BAG34883.1 .
    AK311892 mRNA. Translation: BAG34833.1 .
    CH471063 Genomic DNA. Translation: EAW70483.1 .
    CH471063 Genomic DNA. Translation: EAW70484.1 .
    BC005318 mRNA. Translation: AAH05318.1 .
    J05026 Genomic DNA. Translation: AAA66960.1 .
    CCDSi CCDS2390.1. [P05976-1 ]
    PIRi JS0431. MOHUA1.
    S07939. MOHUA2.
    RefSeqi NP_524144.1. NM_079420.2. [P05976-1 ]
    NP_524146.1. NM_079422.2.
    UniGenei Hs.187338.

    3D structure databases

    ProteinModelPortali P05976.
    SMRi P05976. Positions 50-194.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110716. 7 interactions.
    IntActi P05976. 2 interactions.
    STRINGi 9606.ENSP00000307280.

    PTM databases

    PhosphoSitei P05976.

    Polymorphism databases

    DMDMi 127128.

    2D gel databases

    SWISS-2DPAGE P05976.

    Proteomic databases

    MaxQBi P05976.
    PaxDbi P05976.
    PRIDEi P05976.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000341685 ; ENSP00000343321 ; ENSG00000168530 . [P05976-2 ]
    ENST00000352451 ; ENSP00000307280 ; ENSG00000168530 . [P05976-1 ]
    GeneIDi 4632.
    KEGGi hsa:4632.
    UCSCi uc002veb.3. human. [P05976-2 ]
    uc002vec.3. human. [P05976-1 ]

    Organism-specific databases

    CTDi 4632.
    GeneCardsi GC02M211118.
    HGNCi HGNC:7582. MYL1.
    MIMi 160780. gene.
    neXtProti NX_P05976.
    PharmGKBi PA31379.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5126.
    HOGENOMi HOG000233018.
    HOVERGENi HBG012180.
    InParanoidi P05976.
    KOi K05738.
    OMAi DRTGDAK.
    OrthoDBi EOG7HQN9N.
    PhylomeDBi P05976.
    TreeFami TF351553.

    Enzyme and pathway databases

    Reactomei REACT_16969. Striated Muscle Contraction.

    Miscellaneous databases

    GeneWikii MYL1.
    GenomeRNAii 4632.
    NextBioi 17830.
    PROi P05976.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P05976.
    Bgeei P05976.
    CleanExi HS_MYL1.
    Genevestigatori P05976.

    Family and domain databases

    Gene3Di 1.10.238.10. 2 hits.
    InterProi IPR011992. EF-hand-dom_pair.
    IPR002048. EF_hand_dom.
    [Graphical view ]
    Pfami PF13405. EF-hand_6. 1 hit.
    [Graphical view ]
    SMARTi SM00054. EFh. 2 hits.
    [Graphical view ]
    PROSITEi PS50222. EF_HAND_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3."
      Seidel U., Bober E., Winter B., Lenz S., Lohse P., Arnold H.H.
      Nucleic Acids Res. 15:4989-4989(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3).
      Tissue: Fetal muscle.
    2. "Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms."
      Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H.
      Gene 66:135-146(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3).
    3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS MLC1 AND MLC3).
      Tissue: Skeletal muscle.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC3).
      Tissue: Liver.
    7. "Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle."
      Seidel U., Arnold H.H.
      J. Biol. Chem. 264:16109-16117(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-44.

    Entry informationi

    Entry nameiMYL1_HUMAN
    AccessioniPrimary (citable) accession number: P05976
    Secondary accession number(s): B2R4N6
    , B2R4T6, P06741, Q6IBD5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1988
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 135 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3