Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P05976 (MYL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 131. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Myosin light chain 1/3, skeletal muscle isoform

Short name=MLC1/MLC3
Short name=MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name=Myosin light chain A1/A2
Gene names
Name:MYL1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length194 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Regulatory light chain of myosin. Does not bind calcium.

Subunit structure

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Post-translational modification

Isoform MLC3 is acetylated at position 2 By similarity.

Sequence similarities

Contains 3 EF-hand domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform MLC1 (identifier: P05976-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform MLC3 (identifier: P05976-2)

The sequence of this isoform differs from the canonical sequence as follows:
     2-53: APKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA
Note: Initiator Met-1 is removed. Contains a N-acetylalanine at position 2 (By similarity).

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 194193Myosin light chain 1/3, skeletal muscle isoform
PRO_0000198681

Regions

Domain50 – 8536EF-hand 1
Domain127 – 16236EF-hand 2
Domain162 – 19433EF-hand 3

Amino acid modifications

Modified residue21N,N,N-trimethylalanine By similarity

Natural variations

Alternative sequence2 – 5352APKKD…KEQQD → MSFSADQIA in isoform MLC3.
VSP_038686

Experimental info

Sequence conflict451I → M in CAB42646. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform MLC1 [UniParc].

Last modified January 23, 2007. Version 3.
Checksum: DA1F5C5E4C8A2124

FASTA19421,145
        10         20         30         40         50         60 
MAPKKDVKKP VAAAAAAPAP APAPAPAPAP AKPKEEKIDL SAIKIEFSKE QQDEFKEAFL 

        70         80         90        100        110        120 
LFDRTGDSKI TLSQVGDVLR ALGTNPTNAE VRKVLGNPSN EELNAKKIEF EQFLPMMQAI 

       130        140        150        160        170        180 
SNNKDQATYE DFVEGLRVFD KEGNGTVMGA ELRHVLATLG EKMKEEEVEA LMAGQEDSNG 

       190 
CINYEAFVKH IMSI 

« Hide

Isoform MLC3 [UniParc] [UniParc].

Checksum: 94F2613A9887E25F
Show »

FASTA15116,815

References

« Hide 'large scale' references
[1]"The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3."
Seidel U., Bober E., Winter B., Lenz S., Lohse P., Arnold H.H.
Nucleic Acids Res. 15:4989-4989(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3).
Tissue: Fetal muscle.
[2]"Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms."
Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H.
Gene 66:135-146(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3).
[3]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC1).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS MLC1 AND MLC3).
Tissue: Skeletal muscle.
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC3).
Tissue: Liver.
[7]"Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle."
Seidel U., Arnold H.H.
J. Biol. Chem. 264:16109-16117(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-44.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X05450 mRNA. Translation: CAB42646.1.
X05451 mRNA. Translation: CAA29020.1.
M20642 mRNA. Translation: AAA59854.1.
M20643 mRNA. Translation: AAA59855.1.
CR456869 mRNA. Translation: CAG33150.1.
AK311942 mRNA. Translation: BAG34883.1.
AK311892 mRNA. Translation: BAG34833.1.
CH471063 Genomic DNA. Translation: EAW70483.1.
CH471063 Genomic DNA. Translation: EAW70484.1.
BC005318 mRNA. Translation: AAH05318.1.
J05026 Genomic DNA. Translation: AAA66960.1.
PIRMOHUA1. JS0431.
MOHUA2. S07939.
RefSeqNP_524144.1. NM_079420.2.
NP_524146.1. NM_079422.2.
UniGeneHs.187338.

3D structure databases

ProteinModelPortalP05976.
SMRP05976. Positions 50-194.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110716. 7 interactions.
IntActP05976. 1 interaction.
STRING9606.ENSP00000307280.

PTM databases

PhosphoSiteP05976.

Polymorphism databases

DMDM127128.

2D gel databases

SWISS-2DPAGEP05976.

Proteomic databases

PaxDbP05976.
PRIDEP05976.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000341685; ENSP00000343321; ENSG00000168530. [P05976-2]
ENST00000352451; ENSP00000307280; ENSG00000168530. [P05976-1]
GeneID4632.
KEGGhsa:4632.
UCSCuc002veb.3. human. [P05976-2]
uc002vec.3. human. [P05976-1]

Organism-specific databases

CTD4632.
GeneCardsGC02M211118.
HGNCHGNC:7582. MYL1.
MIM160780. gene.
neXtProtNX_P05976.
PharmGKBPA31379.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5126.
HOGENOMHOG000233018.
HOVERGENHBG012180.
InParanoidP05976.
KOK05738.
OMASKEQQDD.
OrthoDBEOG7HQN9N.
PhylomeDBP05976.
TreeFamTF351553.

Enzyme and pathway databases

ReactomeREACT_17044. Muscle contraction.

Gene expression databases

ArrayExpressP05976.
BgeeP05976.
CleanExHS_MYL1.
GenevestigatorP05976.

Family and domain databases

Gene3D1.10.238.10. 2 hits.
InterProIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamPF13405. EF-hand_6. 1 hit.
[Graphical view]
SMARTSM00054. EFh. 2 hits.
[Graphical view]
PROSITEPS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiMYL1.
GenomeRNAi4632.
NextBio17830.
PROP05976.
SOURCESearch...

Entry information

Entry nameMYL1_HUMAN
AccessionPrimary (citable) accession number: P05976
Secondary accession number(s): B2R4N6 expand/collapse secondary AC list , B2R4T6, P06741, Q6IBD5
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: January 23, 2007
Last modified: April 16, 2014
This is version 131 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM