SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P05976

- MYL1_HUMAN

UniProt

P05976 - MYL1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Myosin light chain 1/3, skeletal muscle isoform
Gene
MYL1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. structural constituent of muscle Source: BHF-UCL

GO - Biological processi

  1. cardiac muscle contraction Source: Ensembl
  2. muscle contraction Source: BHF-UCL
  3. muscle filament sliding Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Enzyme and pathway databases

ReactomeiREACT_16969. Striated Muscle Contraction.

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:MYL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:7582. MYL1.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. muscle myosin complex Source: BHF-UCL
  3. myofibril Source: BHF-UCL
  4. sarcomere Source: BHF-UCL
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31379.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed By similarity
Chaini2 – 194193Myosin light chain 1/3, skeletal muscle isoform
PRO_0000198681Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N,N,N-trimethylalanine By similarity

Post-translational modificationi

Isoform MLC3 is acetylated at position 2 By similarity.

Keywords - PTMi

Acetylation, Methylation

Proteomic databases

MaxQBiP05976.
PaxDbiP05976.
PRIDEiP05976.

2D gel databases

SWISS-2DPAGEP05976.

PTM databases

PhosphoSiteiP05976.

Expressioni

Gene expression databases

ArrayExpressiP05976.
BgeeiP05976.
CleanExiHS_MYL1.
GenevestigatoriP05976.

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridi110716. 7 interactions.
IntActiP05976. 2 interactions.
STRINGi9606.ENSP00000307280.

Structurei

3D structure databases

ProteinModelPortaliP05976.
SMRiP05976. Positions 50-194.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini50 – 8536EF-hand 1
Add
BLAST
Domaini127 – 16236EF-hand 2
Add
BLAST
Domaini162 – 19433EF-hand 3
Add
BLAST

Sequence similaritiesi

Contains 3 EF-hand domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5126.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP05976.
KOiK05738.
OMAiDRTGDAK.
OrthoDBiEOG7HQN9N.
PhylomeDBiP05976.
TreeFamiTF351553.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform MLC1 (identifier: P05976-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAPKKDVKKP VAAAAAAPAP APAPAPAPAP AKPKEEKIDL SAIKIEFSKE    50
QQDEFKEAFL LFDRTGDSKI TLSQVGDVLR ALGTNPTNAE VRKVLGNPSN 100
EELNAKKIEF EQFLPMMQAI SNNKDQATYE DFVEGLRVFD KEGNGTVMGA 150
ELRHVLATLG EKMKEEEVEA LMAGQEDSNG CINYEAFVKH IMSI 194
Length:194
Mass (Da):21,145
Last modified:January 23, 2007 - v3
Checksum:iDA1F5C5E4C8A2124
GO
Isoform MLC3 (identifier: P05976-2) [UniParc] [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-53: APKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA

Note: Initiator Met-1 is removed. Contains a N-acetylalanine at position 2 (By similarity).

Show »
Length:151
Mass (Da):16,815
Checksum:i94F2613A9887E25F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 5352APKKD…KEQQD → MSFSADQIA in isoform MLC3.
VSP_038686Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti45 – 451I → M in CAB42646. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X05450 mRNA. Translation: CAB42646.1.
X05451 mRNA. Translation: CAA29020.1.
M20642 mRNA. Translation: AAA59854.1.
M20643 mRNA. Translation: AAA59855.1.
CR456869 mRNA. Translation: CAG33150.1.
AK311942 mRNA. Translation: BAG34883.1.
AK311892 mRNA. Translation: BAG34833.1.
CH471063 Genomic DNA. Translation: EAW70483.1.
CH471063 Genomic DNA. Translation: EAW70484.1.
BC005318 mRNA. Translation: AAH05318.1.
J05026 Genomic DNA. Translation: AAA66960.1.
CCDSiCCDS2390.1. [P05976-1]
PIRiJS0431. MOHUA1.
S07939. MOHUA2.
RefSeqiNP_524144.1. NM_079420.2. [P05976-1]
NP_524146.1. NM_079422.2.
UniGeneiHs.187338.

Genome annotation databases

EnsembliENST00000341685; ENSP00000343321; ENSG00000168530. [P05976-2]
ENST00000352451; ENSP00000307280; ENSG00000168530. [P05976-1]
GeneIDi4632.
KEGGihsa:4632.
UCSCiuc002veb.3. human. [P05976-2]
uc002vec.3. human. [P05976-1]

Polymorphism databases

DMDMi127128.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X05450 mRNA. Translation: CAB42646.1 .
X05451 mRNA. Translation: CAA29020.1 .
M20642 mRNA. Translation: AAA59854.1 .
M20643 mRNA. Translation: AAA59855.1 .
CR456869 mRNA. Translation: CAG33150.1 .
AK311942 mRNA. Translation: BAG34883.1 .
AK311892 mRNA. Translation: BAG34833.1 .
CH471063 Genomic DNA. Translation: EAW70483.1 .
CH471063 Genomic DNA. Translation: EAW70484.1 .
BC005318 mRNA. Translation: AAH05318.1 .
J05026 Genomic DNA. Translation: AAA66960.1 .
CCDSi CCDS2390.1. [P05976-1 ]
PIRi JS0431. MOHUA1.
S07939. MOHUA2.
RefSeqi NP_524144.1. NM_079420.2. [P05976-1 ]
NP_524146.1. NM_079422.2.
UniGenei Hs.187338.

3D structure databases

ProteinModelPortali P05976.
SMRi P05976. Positions 50-194.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110716. 7 interactions.
IntActi P05976. 2 interactions.
STRINGi 9606.ENSP00000307280.

PTM databases

PhosphoSitei P05976.

Polymorphism databases

DMDMi 127128.

2D gel databases

SWISS-2DPAGE P05976.

Proteomic databases

MaxQBi P05976.
PaxDbi P05976.
PRIDEi P05976.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000341685 ; ENSP00000343321 ; ENSG00000168530 . [P05976-2 ]
ENST00000352451 ; ENSP00000307280 ; ENSG00000168530 . [P05976-1 ]
GeneIDi 4632.
KEGGi hsa:4632.
UCSCi uc002veb.3. human. [P05976-2 ]
uc002vec.3. human. [P05976-1 ]

Organism-specific databases

CTDi 4632.
GeneCardsi GC02M211118.
HGNCi HGNC:7582. MYL1.
MIMi 160780. gene.
neXtProti NX_P05976.
PharmGKBi PA31379.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5126.
HOGENOMi HOG000233018.
HOVERGENi HBG012180.
InParanoidi P05976.
KOi K05738.
OMAi DRTGDAK.
OrthoDBi EOG7HQN9N.
PhylomeDBi P05976.
TreeFami TF351553.

Enzyme and pathway databases

Reactomei REACT_16969. Striated Muscle Contraction.

Miscellaneous databases

GeneWikii MYL1.
GenomeRNAii 4632.
NextBioi 17830.
PROi P05976.
SOURCEi Search...

Gene expression databases

ArrayExpressi P05976.
Bgeei P05976.
CleanExi HS_MYL1.
Genevestigatori P05976.

Family and domain databases

Gene3Di 1.10.238.10. 2 hits.
InterProi IPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view ]
Pfami PF13405. EF-hand_6. 1 hit.
[Graphical view ]
SMARTi SM00054. EFh. 2 hits.
[Graphical view ]
PROSITEi PS50222. EF_HAND_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3."
    Seidel U., Bober E., Winter B., Lenz S., Lohse P., Arnold H.H.
    Nucleic Acids Res. 15:4989-4989(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3).
    Tissue: Fetal muscle.
  2. "Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms."
    Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H.
    Gene 66:135-146(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3).
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS MLC1 AND MLC3).
    Tissue: Skeletal muscle.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC3).
    Tissue: Liver.
  7. "Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle."
    Seidel U., Arnold H.H.
    J. Biol. Chem. 264:16109-16117(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-44.

Entry informationi

Entry nameiMYL1_HUMAN
AccessioniPrimary (citable) accession number: P05976
Secondary accession number(s): B2R4N6
, B2R4T6, P06741, Q6IBD5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: January 23, 2007
Last modified: September 3, 2014
This is version 134 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi