Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

MYL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • structural constituent of muscle Source: BHF-UCL

GO - Biological processi

  • cardiac muscle contraction Source: Ensembl
  • muscle contraction Source: BHF-UCL
  • muscle filament sliding Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Enzyme and pathway databases

ReactomeiR-HSA-390522. Striated Muscle Contraction.
SIGNORiP05976.

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:MYL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:7582. MYL1.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • muscle myosin complex Source: BHF-UCL
  • myofibril Source: BHF-UCL
  • sarcomere Source: BHF-UCL
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi4632.
OpenTargetsiENSG00000168530.
PharmGKBiPA31379.

Polymorphism and mutation databases

BioMutaiMYL1.
DMDMi127128.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001986812 – 194Myosin light chain 1/3, skeletal muscle isoformAdd BLAST193
Isoform MLC3 (identifier: P05976-2)
Initiator methionineiRemovedBy similarity

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N,N,N-trimethylalanineBy similarity1
Modified residuei71PhosphothreonineBy similarity1
Modified residuei73PhosphoserineBy similarity1
Modified residuei87PhosphothreonineBy similarity1
Modified residuei99PhosphoserineBy similarity1
Isoform MLC3 (identifier: P05976-2)
Modified residuei2N-acetylalanine By similarityBy similarity1

Post-translational modificationi

Isoform MLC3 is acetylated at position 2.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiP05976.
MaxQBiP05976.
PaxDbiP05976.
PeptideAtlasiP05976.
PRIDEiP05976.

2D gel databases

SWISS-2DPAGEP05976.

PTM databases

iPTMnetiP05976.
PhosphoSitePlusiP05976.

Expressioni

Gene expression databases

BgeeiENSG00000168530.
CleanExiHS_MYL1.
GenevisibleiP05976. HS.

Organism-specific databases

HPAiHPA046859.

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridi110716. 10 interactors.
IntActiP05976. 2 interactors.
STRINGi9606.ENSP00000307280.

Structurei

3D structure databases

ProteinModelPortaliP05976.
SMRiP05976.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 85EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini127 – 162EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini162 – 194EF-hand 3PROSITE-ProRule annotationAdd BLAST33

Sequence similaritiesi

Contains 3 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0030. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00590000082921.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP05976.
KOiK05738.
OMAiTNAEINK.
OrthoDBiEOG091G0TQL.
PhylomeDBiP05976.
TreeFamiTF351553.

Family and domain databases

CDDicd00051. EFh. 1 hit.
Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MLC1 (identifier: P05976-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKKDVKKP VAAAAAAPAP APAPAPAPAP AKPKEEKIDL SAIKIEFSKE
60 70 80 90 100
QQDEFKEAFL LFDRTGDSKI TLSQVGDVLR ALGTNPTNAE VRKVLGNPSN
110 120 130 140 150
EELNAKKIEF EQFLPMMQAI SNNKDQATYE DFVEGLRVFD KEGNGTVMGA
160 170 180 190
ELRHVLATLG EKMKEEEVEA LMAGQEDSNG CINYEAFVKH IMSI
Length:194
Mass (Da):21,145
Last modified:January 23, 2007 - v3
Checksum:iDA1F5C5E4C8A2124
GO
Isoform MLC3 (identifier: P05976-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA

Show »
Length:150
Mass (Da):16,684
Checksum:i39D6FC3AD153483A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti45I → M in CAB42646 (PubMed:3601661).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0386861 – 53MAPKK…KEQQD → MSFSADQIA in isoform MLC3. 4 PublicationsAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X05450 mRNA. Translation: CAB42646.1.
X05451 mRNA. Translation: CAA29020.1.
M20642 mRNA. Translation: AAA59854.1.
M20643 mRNA. Translation: AAA59855.1.
CR456869 mRNA. Translation: CAG33150.1.
AK311942 mRNA. Translation: BAG34883.1.
AK311892 mRNA. Translation: BAG34833.1.
CH471063 Genomic DNA. Translation: EAW70483.1.
CH471063 Genomic DNA. Translation: EAW70484.1.
BC005318 mRNA. Translation: AAH05318.1.
J05026 Genomic DNA. Translation: AAA66960.1.
CCDSiCCDS2390.1. [P05976-1]
CCDS2391.1. [P05976-2]
PIRiJS0431. MOHUA1.
S07939. MOHUA2.
RefSeqiNP_524144.1. NM_079420.2. [P05976-1]
NP_524146.1. NM_079422.2. [P05976-2]
UniGeneiHs.187338.

Genome annotation databases

EnsembliENST00000341685; ENSP00000343321; ENSG00000168530. [P05976-2]
ENST00000352451; ENSP00000307280; ENSG00000168530. [P05976-1]
GeneIDi4632.
KEGGihsa:4632.
UCSCiuc002veb.4. human. [P05976-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X05450 mRNA. Translation: CAB42646.1.
X05451 mRNA. Translation: CAA29020.1.
M20642 mRNA. Translation: AAA59854.1.
M20643 mRNA. Translation: AAA59855.1.
CR456869 mRNA. Translation: CAG33150.1.
AK311942 mRNA. Translation: BAG34883.1.
AK311892 mRNA. Translation: BAG34833.1.
CH471063 Genomic DNA. Translation: EAW70483.1.
CH471063 Genomic DNA. Translation: EAW70484.1.
BC005318 mRNA. Translation: AAH05318.1.
J05026 Genomic DNA. Translation: AAA66960.1.
CCDSiCCDS2390.1. [P05976-1]
CCDS2391.1. [P05976-2]
PIRiJS0431. MOHUA1.
S07939. MOHUA2.
RefSeqiNP_524144.1. NM_079420.2. [P05976-1]
NP_524146.1. NM_079422.2. [P05976-2]
UniGeneiHs.187338.

3D structure databases

ProteinModelPortaliP05976.
SMRiP05976.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110716. 10 interactors.
IntActiP05976. 2 interactors.
STRINGi9606.ENSP00000307280.

PTM databases

iPTMnetiP05976.
PhosphoSitePlusiP05976.

Polymorphism and mutation databases

BioMutaiMYL1.
DMDMi127128.

2D gel databases

SWISS-2DPAGEP05976.

Proteomic databases

EPDiP05976.
MaxQBiP05976.
PaxDbiP05976.
PeptideAtlasiP05976.
PRIDEiP05976.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341685; ENSP00000343321; ENSG00000168530. [P05976-2]
ENST00000352451; ENSP00000307280; ENSG00000168530. [P05976-1]
GeneIDi4632.
KEGGihsa:4632.
UCSCiuc002veb.4. human. [P05976-1]

Organism-specific databases

CTDi4632.
DisGeNETi4632.
GeneCardsiMYL1.
HGNCiHGNC:7582. MYL1.
HPAiHPA046859.
MIMi160780. gene.
neXtProtiNX_P05976.
OpenTargetsiENSG00000168530.
PharmGKBiPA31379.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0030. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00590000082921.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP05976.
KOiK05738.
OMAiTNAEINK.
OrthoDBiEOG091G0TQL.
PhylomeDBiP05976.
TreeFamiTF351553.

Enzyme and pathway databases

ReactomeiR-HSA-390522. Striated Muscle Contraction.
SIGNORiP05976.

Miscellaneous databases

ChiTaRSiMYL1. human.
GeneWikiiMYL1.
GenomeRNAii4632.
PROiP05976.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168530.
CleanExiHS_MYL1.
GenevisibleiP05976. HS.

Family and domain databases

CDDicd00051. EFh. 1 hit.
Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMYL1_HUMAN
AccessioniPrimary (citable) accession number: P05976
Secondary accession number(s): B2R4N6
, B2R4T6, P06741, Q6IBD5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 157 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.