Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

MYL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. structural constituent of muscle Source: BHF-UCL

GO - Biological processi

  1. cardiac muscle contraction Source: Ensembl
  2. muscle contraction Source: BHF-UCL
  3. muscle filament sliding Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Enzyme and pathway databases

ReactomeiREACT_16969. Striated Muscle Contraction.

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:MYL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:7582. MYL1.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. muscle myosin complex Source: BHF-UCL
  3. myofibril Source: BHF-UCL
  4. sarcomere Source: BHF-UCL
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31379.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 194193Myosin light chain 1/3, skeletal muscle isoformPRO_0000198681Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N,N,N-trimethylalanineBy similarity

Post-translational modificationi

Isoform MLC3 is acetylated at position 2.By similarity

Keywords - PTMi

Acetylation, Methylation

Proteomic databases

MaxQBiP05976.
PaxDbiP05976.
PRIDEiP05976.

2D gel databases

SWISS-2DPAGEP05976.

PTM databases

PhosphoSiteiP05976.

Expressioni

Gene expression databases

BgeeiP05976.
CleanExiHS_MYL1.
ExpressionAtlasiP05976. baseline and differential.
GenevestigatoriP05976.

Organism-specific databases

HPAiHPA046859.

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridi110716. 8 interactions.
IntActiP05976. 2 interactions.
STRINGi9606.ENSP00000307280.

Structurei

3D structure databases

SMRiP05976. Positions 50-194.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini50 – 8536EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini127 – 16236EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini162 – 19433EF-hand 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5126.
GeneTreeiENSGT00590000082921.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP05976.
KOiK05738.
OMAiTNAEINK.
OrthoDBiEOG7HQN9N.
PhylomeDBiP05976.
TreeFamiTF351553.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MLC1 (identifier: P05976-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKKDVKKP VAAAAAAPAP APAPAPAPAP AKPKEEKIDL SAIKIEFSKE
60 70 80 90 100
QQDEFKEAFL LFDRTGDSKI TLSQVGDVLR ALGTNPTNAE VRKVLGNPSN
110 120 130 140 150
EELNAKKIEF EQFLPMMQAI SNNKDQATYE DFVEGLRVFD KEGNGTVMGA
160 170 180 190
ELRHVLATLG EKMKEEEVEA LMAGQEDSNG CINYEAFVKH IMSI
Length:194
Mass (Da):21,145
Last modified:January 23, 2007 - v3
Checksum:iDA1F5C5E4C8A2124
GO
Isoform MLC3 (identifier: P05976-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA

Note: Initiator Met-1 is removed. Contains a N-acetylalanine at position 2 (By similarity).By similarity

Show »
Length:150
Mass (Da):16,684
Checksum:i39D6FC3AD153483A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti45 – 451I → M in CAB42646 (PubMed:3601661).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5353MAPKK…KEQQD → MSFSADQIA in isoform MLC3. 4 PublicationsVSP_038686Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X05450 mRNA. Translation: CAB42646.1.
X05451 mRNA. Translation: CAA29020.1.
M20642 mRNA. Translation: AAA59854.1.
M20643 mRNA. Translation: AAA59855.1.
CR456869 mRNA. Translation: CAG33150.1.
AK311942 mRNA. Translation: BAG34883.1.
AK311892 mRNA. Translation: BAG34833.1.
CH471063 Genomic DNA. Translation: EAW70483.1.
CH471063 Genomic DNA. Translation: EAW70484.1.
BC005318 mRNA. Translation: AAH05318.1.
J05026 Genomic DNA. Translation: AAA66960.1.
CCDSiCCDS2390.1. [P05976-1]
CCDS2391.1. [P05976-2]
PIRiJS0431. MOHUA1.
S07939. MOHUA2.
RefSeqiNP_524144.1. NM_079420.2. [P05976-1]
NP_524146.1. NM_079422.2. [P05976-2]
UniGeneiHs.187338.

Genome annotation databases

EnsembliENST00000341685; ENSP00000343321; ENSG00000168530. [P05976-2]
ENST00000352451; ENSP00000307280; ENSG00000168530. [P05976-1]
GeneIDi4632.
KEGGihsa:4632.
UCSCiuc002veb.3. human. [P05976-2]
uc002vec.3. human. [P05976-1]

Polymorphism databases

DMDMi127128.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X05450 mRNA. Translation: CAB42646.1.
X05451 mRNA. Translation: CAA29020.1.
M20642 mRNA. Translation: AAA59854.1.
M20643 mRNA. Translation: AAA59855.1.
CR456869 mRNA. Translation: CAG33150.1.
AK311942 mRNA. Translation: BAG34883.1.
AK311892 mRNA. Translation: BAG34833.1.
CH471063 Genomic DNA. Translation: EAW70483.1.
CH471063 Genomic DNA. Translation: EAW70484.1.
BC005318 mRNA. Translation: AAH05318.1.
J05026 Genomic DNA. Translation: AAA66960.1.
CCDSiCCDS2390.1. [P05976-1]
CCDS2391.1. [P05976-2]
PIRiJS0431. MOHUA1.
S07939. MOHUA2.
RefSeqiNP_524144.1. NM_079420.2. [P05976-1]
NP_524146.1. NM_079422.2. [P05976-2]
UniGeneiHs.187338.

3D structure databases

SMRiP05976. Positions 50-194.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110716. 8 interactions.
IntActiP05976. 2 interactions.
STRINGi9606.ENSP00000307280.

PTM databases

PhosphoSiteiP05976.

Polymorphism databases

DMDMi127128.

2D gel databases

SWISS-2DPAGEP05976.

Proteomic databases

MaxQBiP05976.
PaxDbiP05976.
PRIDEiP05976.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341685; ENSP00000343321; ENSG00000168530. [P05976-2]
ENST00000352451; ENSP00000307280; ENSG00000168530. [P05976-1]
GeneIDi4632.
KEGGihsa:4632.
UCSCiuc002veb.3. human. [P05976-2]
uc002vec.3. human. [P05976-1]

Organism-specific databases

CTDi4632.
GeneCardsiGC02M211118.
HGNCiHGNC:7582. MYL1.
HPAiHPA046859.
MIMi160780. gene.
neXtProtiNX_P05976.
PharmGKBiPA31379.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5126.
GeneTreeiENSGT00590000082921.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP05976.
KOiK05738.
OMAiTNAEINK.
OrthoDBiEOG7HQN9N.
PhylomeDBiP05976.
TreeFamiTF351553.

Enzyme and pathway databases

ReactomeiREACT_16969. Striated Muscle Contraction.

Miscellaneous databases

ChiTaRSiMYL1. human.
GeneWikiiMYL1.
GenomeRNAii4632.
NextBioi17830.
PROiP05976.
SOURCEiSearch...

Gene expression databases

BgeeiP05976.
CleanExiHS_MYL1.
ExpressionAtlasiP05976. baseline and differential.
GenevestigatoriP05976.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3."
    Seidel U., Bober E., Winter B., Lenz S., Lohse P., Arnold H.H.
    Nucleic Acids Res. 15:4989-4989(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3).
    Tissue: Fetal muscle.
  2. "Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms."
    Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H.
    Gene 66:135-146(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MLC1 AND MLC3).
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS MLC1 AND MLC3).
    Tissue: Skeletal muscle.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MLC3).
    Tissue: Liver.
  7. "Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle."
    Seidel U., Arnold H.H.
    J. Biol. Chem. 264:16109-16117(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-44.

Entry informationi

Entry nameiMYL1_HUMAN
AccessioniPrimary (citable) accession number: P05976
Secondary accession number(s): B2R4N6
, B2R4T6, P06741, Q6IBD5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: January 23, 2007
Last modified: April 1, 2015
This is version 141 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.