Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prolactin receptor

Gene

Prlr

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is a receptor for the anterior pituitary hormone prolactin.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi206 – 2061ZincBy similarity
Metal bindingi207 – 2071ZincBy similarity

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • prolactin receptor activity Source: RGD
  • protein kinase binding Source: RGD

GO - Biological processi

  • prolactin signaling pathway Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Prolactin receptor
Short name:
PRL-R
Alternative name(s):
Lactogen receptor
Gene namesi
Name:Prlr
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3407. Prlr.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 229210ExtracellularBy similarityAdd
BLAST
Transmembranei230 – 25324HelicalBy similarityAdd
BLAST
Topological domaini254 – 610357CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence analysisAdd
BLAST
Chaini20 – 610591Prolactin receptorPRO_0000010981Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi31 ↔ 411 Publication
Glycosylationi54 – 541N-linked (GlcNAc...)
Disulfide bondi70 ↔ 811 Publication
Glycosylationi99 – 991N-linked (GlcNAc...)
Glycosylationi127 – 1271N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP05710.
PRIDEiP05710.

PTM databases

PhosphoSiteiP05710.

Interactioni

Subunit structurei

Interacts with SMARCA1. Interacts with NEK3 and VAV2 and this interaction is prolactin-dependent.By similarity

GO - Molecular functioni

  • protein kinase binding Source: RGD

Protein-protein interaction databases

MINTiMINT-143766.
STRINGi10116.ENSRNOP00000056718.

Structurei

Secondary structure

1
610
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi27 – 3711Combined sources
Beta strandi39 – 446Combined sources
Beta strandi54 – 618Combined sources
Beta strandi64 – 696Combined sources
Beta strandi80 – 834Combined sources
Turni85 – 873Combined sources
Beta strandi93 – 10210Combined sources
Beta strandi105 – 1084Combined sources
Beta strandi112 – 1154Combined sources
Helixi116 – 1183Combined sources
Beta strandi126 – 1327Combined sources
Beta strandi142 – 1476Combined sources
Beta strandi150 – 1523Combined sources
Turni154 – 1574Combined sources
Beta strandi161 – 17111Combined sources
Beta strandi176 – 1816Combined sources
Beta strandi184 – 1885Combined sources
Beta strandi196 – 20813Combined sources
Beta strandi217 – 2204Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1F6FX-ray2.30B/C20-229[»]
3EW3X-ray3.80B/C20-229[»]
3NPZX-ray3.35B/C20-229[»]
ProteinModelPortaliP05710.
SMRiP05710. Positions 24-222.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP05710.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 122101Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini124 – 224101Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi210 – 2145WSXWS motif
Motifi262 – 2709Box 1 motif

Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

Sequence similaritiesi

Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IUSW. Eukaryota.
ENOG410XRJS. LUCA.
HOVERGENiHBG007314.
InParanoidiP05710.
KOiK05081.
PhylomeDBiP05710.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR015152. Growth/epo_recpt_lig-bind.
IPR013783. Ig-like_fold.
IPR003528. Long_hematopoietin_rcpt_CS.
IPR033230. PRLR.
[Graphical view]
PANTHERiPTHR23036:SF86. PTHR23036:SF86. 1 hit.
PfamiPF09067. EpoR_lig-bind. 1 hit.
PF00041. fn3. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 2 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 2 hits.
PS01352. HEMATOPO_REC_L_F1. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P05710-1) [UniParc]FASTAAdd to basket

Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSALAFVLL VLNISLLKGQ SPPGKPEIHK CRSPDKETFT CWWNPGTDGG
60 70 80 90 100
LPTNYSLTYS KEGEKTTYEC PDYKTSGPNS CFFSKQYTSI WKIYIITVNA
110 120 130 140 150
TNQMGSSSSD PLYVDVTYIV EPEPPRNLTL EVKQLKDKKT YLWVKWSPPT
160 170 180 190 200
ITDVKTGWFT MEYEIRLKPE EAEEWEIHFT GHQTQFKVFD LYPGQKYLVQ
210 220 230 240 250
TRCKPDHGYW SRWSQESSVE MPNDFTLKDT TVWIIVAILS AVICLIMVWA
260 270 280 290 300
VALKGYSMMT CIFPPVPGPK IKGFDTHLLE KGKSEELLSA LGCQDFPPTS
310 320 330 340 350
DCEDLLVEFL EVDDNEDERL MPSHSKEYPG QGVKPTHLDP DSDSGHGSYD
360 370 380 390 400
SHSLLSEKCE EPQAYPPTLH IPEITEKPEN PEANIPPTVD PQSTNPNFHV
410 420 430 440 450
DAPKSSTWPL LPGQHMPRSP YHSVADVCKL AGSPVNTLDS FLDKAEENVL
460 470 480 490 500
KLSKALETGE EEVAEQKGAK SFPSDKQNTP WPLLQEKSPT VYVKPPDYVE
510 520 530 540 550
IHKVNKDGVL SLFPKQRENN QTEKPGVPET SKEYAKVSGI TDNNILVLVP
560 570 580 590 600
DSRAQNTALL EESAKKAPPS FEADQSEKDL ASFTATSSNR RLQLGRLDYL
610
DPTCFMHSFH
Length:610
Mass (Da):68,599
Last modified:November 1, 1997 - v2
Checksum:i83D04D832861295D
GO
Isoform 2 (identifier: P05710-2) [UniParc]FASTAAdd to basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     131-150: EVKQLKDKKTYLWVKWSPPT → DYRWEVSCHQEALPKSAKLN
     151-610: Missing.

Show »
Length:150
Mass (Da):16,865
Checksum:i157312651786F4B9
GO
Isoform 3 (identifier: P05710-3) [UniParc]FASTAAdd to basket

Also known as: Medium

The sequence of this isoform differs from the canonical sequence as follows:
     281-310: KGKSEELLSALGCQDFPPTSDCEDLLVEFL → TGSPSKYKVDLYLALPGGFQKLDNAGELDY
     311-610: Missing.

Show »
Length:310
Mass (Da):35,352
Checksum:i2636CBF8589A7966
GO
Isoform 4 (identifier: P05710-4) [UniParc]FASTAAdd to basket

Also known as: NB2

The sequence of this isoform differs from the canonical sequence as follows:
     342-539: Missing.

Show »
Length:412
Mass (Da):46,799
Checksum:i349D05B173D10D0C
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti236 – 2361V → A in AAA79273 (PubMed:2159291).Curated
Sequence conflicti345 – 3451G → V in AAA79273 (PubMed:2159291).Curated
Sequence conflicti465 – 4651E → K in AAA41938 (PubMed:2293022).Curated
Sequence conflicti466 – 4661Q → E in AAA79273 (PubMed:2159291).Curated
Sequence conflicti469 – 4691A → G in AAA79273 (PubMed:2159291).Curated
Sequence conflicti541 – 5411T → M in AAA41938 (PubMed:2293022).Curated
Sequence conflicti555 – 5551Q → K in AAA79273 (PubMed:2159291).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei131 – 15020EVKQL…WSPPT → DYRWEVSCHQEALPKSAKLN in isoform 2. 1 PublicationVSP_001725Add
BLAST
Alternative sequencei151 – 610460Missing in isoform 2. 1 PublicationVSP_001726Add
BLAST
Alternative sequencei281 – 31030KGKSE…LVEFL → TGSPSKYKVDLYLALPGGFQ KLDNAGELDY in isoform 3. 1 PublicationVSP_001727Add
BLAST
Alternative sequencei311 – 610300Missing in isoform 3. 1 PublicationVSP_001728Add
BLAST
Alternative sequencei342 – 539198Missing in isoform 4. 2 PublicationsVSP_001729Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M57668 mRNA. Translation: AAA41938.1.
M34083 mRNA. Translation: AAA79273.1.
L48060 mRNA. Translation: AAA79274.1.
U34730 Genomic DNA. Translation: AAA92053.1.
M19304 mRNA. Translation: AAA41937.1.
M74152 mRNA. Translation: AAA41946.1.
U07567 mRNA. Translation: AAA61784.1.
PIRiA29884.
A34631.
A36116.
A41070.
B34631.
RefSeqiNP_001029283.1. NM_001034111.1.
NP_036762.1. NM_012630.2. [P05710-3]
UniGeneiRn.9757.

Genome annotation databases

GeneIDi24684.
KEGGirno:24684.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M57668 mRNA. Translation: AAA41938.1.
M34083 mRNA. Translation: AAA79273.1.
L48060 mRNA. Translation: AAA79274.1.
U34730 Genomic DNA. Translation: AAA92053.1.
M19304 mRNA. Translation: AAA41937.1.
M74152 mRNA. Translation: AAA41946.1.
U07567 mRNA. Translation: AAA61784.1.
PIRiA29884.
A34631.
A36116.
A41070.
B34631.
RefSeqiNP_001029283.1. NM_001034111.1.
NP_036762.1. NM_012630.2. [P05710-3]
UniGeneiRn.9757.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1F6FX-ray2.30B/C20-229[»]
3EW3X-ray3.80B/C20-229[»]
3NPZX-ray3.35B/C20-229[»]
ProteinModelPortaliP05710.
SMRiP05710. Positions 24-222.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-143766.
STRINGi10116.ENSRNOP00000056718.

PTM databases

PhosphoSiteiP05710.

Proteomic databases

PaxDbiP05710.
PRIDEiP05710.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi24684.
KEGGirno:24684.

Organism-specific databases

CTDi5618.
RGDi3407. Prlr.

Phylogenomic databases

eggNOGiENOG410IUSW. Eukaryota.
ENOG410XRJS. LUCA.
HOVERGENiHBG007314.
InParanoidiP05710.
KOiK05081.
PhylomeDBiP05710.

Miscellaneous databases

EvolutionaryTraceiP05710.
NextBioi604105.
PROiP05710.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR015152. Growth/epo_recpt_lig-bind.
IPR013783. Ig-like_fold.
IPR003528. Long_hematopoietin_rcpt_CS.
IPR033230. PRLR.
[Graphical view]
PANTHERiPTHR23036:SF86. PTHR23036:SF86. 1 hit.
PfamiPF09067. EpoR_lig-bind. 1 hit.
PF00041. fn3. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 2 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 2 hits.
PS01352. HEMATOPO_REC_L_F1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Expression of two forms of prolactin receptor in rat ovary and liver."
    Shirota M., Banville D., Ali S., Jolicoeur C., Boutin J.-M., Edery M., Djiane J., Kelly P.A.
    Mol. Endocrinol. 4:1136-1143(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Isolation and characterization of two novel rat ovarian lactogen receptor cDNA species."
    Zhang R., Buczko E., Tsai-Morris C.-H., Hu Z.Z., Dufau M.L.
    Biochem. Biophys. Res. Commun. 168:415-422(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: Sprague-Dawley.
    Tissue: Ovary.
  3. Banville D., Stocco R., Murthy K.K., Boie Y., Kelly P.A.
    Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE OF 281-610.
  4. "Cloning and expression of the rat prolactin receptor, a member of the growth hormone/prolactin receptor gene family."
    Boutin J.-M., Jolicoeur C., Okamura H., Gagnon J., Edery M., Shirota M., Banville D., Dusanter-Fourt I., Djiane J., Kelly P.A.
    Cell 53:69-77(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), PARTIAL PROTEIN SEQUENCE.
    Tissue: Liver.
  5. "A prolactin-dependent immune cell line (Nb2) expresses a mutant form of prolactin receptor."
    Ali S., Pelligrini I., Kelly P.A.
    J. Biol. Chem. 266:20110-20117(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Lymphoma.
  6. "Differential signal transduction of the short, Nb2, and long prolactin receptors. Activation of interferon regulatory factor-1 and cell proliferation."
    O'Neal K.D., Yu-Lee L.Y.
    J. Biol. Chem. 269:26076-26082(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  7. "Ternary complex between placental lactogen and the extracellular domain of the prolactin receptor."
    Elkins P.A., Christinger H.W., Sandowski Y., Sakal E., Gertler A., de Vos A.M., Kossiakoff A.A.
    Nat. Struct. Biol. 7:808-815(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 20-229 IN COMPLEX WITH PLACENTAL LACTOGEN, DISULFIDE BONDS.

Entry informationi

Entry nameiPRLR_RAT
AccessioniPrimary (citable) accession number: P05710
Secondary accession number(s): Q62832
, Q63451, Q63479, Q63723, Q64274
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: November 1, 1997
Last modified: May 11, 2016
This is version 148 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.