Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prolactin receptor

Gene

Prlr

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is a receptor for the anterior pituitary hormone prolactin.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi206ZincBy similarity1
Metal bindingi207ZincBy similarity1

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • prolactin receptor activity Source: RGD
  • protein kinase binding Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-RNO-1170546. Prolactin receptor signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Prolactin receptor
Short name:
PRL-R
Alternative name(s):
Lactogen receptor
Gene namesi
Name:Prlr
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3407. Prlr.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 229ExtracellularBy similarityAdd BLAST210
Transmembranei230 – 253HelicalBy similarityAdd BLAST24
Topological domaini254 – 610CytoplasmicBy similarityAdd BLAST357

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000001098120 – 610Prolactin receptorAdd BLAST591

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi31 ↔ 411 Publication
Glycosylationi54N-linked (GlcNAc...)1
Disulfide bondi70 ↔ 811 Publication
Glycosylationi99N-linked (GlcNAc...)1
Glycosylationi127N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP05710.
PRIDEiP05710.

PTM databases

iPTMnetiP05710.
PhosphoSitePlusiP05710.

Interactioni

Subunit structurei

Interacts with SMARCA1. Interacts with NEK3 and VAV2 and this interaction is prolactin-dependent.By similarity

GO - Molecular functioni

  • protein kinase binding Source: RGD

Protein-protein interaction databases

MINTiMINT-143766.
STRINGi10116.ENSRNOP00000056718.

Structurei

Secondary structure

1610
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi27 – 37Combined sources11
Beta strandi39 – 44Combined sources6
Beta strandi54 – 61Combined sources8
Beta strandi64 – 69Combined sources6
Beta strandi80 – 83Combined sources4
Turni85 – 87Combined sources3
Beta strandi93 – 102Combined sources10
Beta strandi105 – 108Combined sources4
Beta strandi112 – 115Combined sources4
Helixi116 – 118Combined sources3
Beta strandi126 – 132Combined sources7
Beta strandi142 – 147Combined sources6
Beta strandi150 – 152Combined sources3
Turni154 – 157Combined sources4
Beta strandi161 – 171Combined sources11
Beta strandi176 – 181Combined sources6
Beta strandi184 – 188Combined sources5
Beta strandi196 – 208Combined sources13
Beta strandi217 – 220Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F6FX-ray2.30B/C20-229[»]
3EW3X-ray3.80B/C20-229[»]
3NPZX-ray3.35B/C20-229[»]
ProteinModelPortaliP05710.
SMRiP05710.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP05710.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 122Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST101
Domaini124 – 224Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST101

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi210 – 214WSXWS motif5
Motifi262 – 270Box 1 motif9

Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

Sequence similaritiesi

Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IUSW. Eukaryota.
ENOG410XRJS. LUCA.
HOVERGENiHBG007314.
InParanoidiP05710.
KOiK05081.
PhylomeDBiP05710.

Family and domain databases

CDDicd00063. FN3. 1 hit.
Gene3Di2.60.40.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR015152. Growth/epo_recpt_lig-bind.
IPR013783. Ig-like_fold.
IPR003528. Long_hematopoietin_rcpt_CS.
IPR033230. PRLR.
[Graphical view]
PANTHERiPTHR23036:SF86. PTHR23036:SF86. 1 hit.
PfamiPF09067. EpoR_lig-bind. 1 hit.
PF00041. fn3. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 2 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 2 hits.
PS01352. HEMATOPO_REC_L_F1. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P05710-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSALAFVLL VLNISLLKGQ SPPGKPEIHK CRSPDKETFT CWWNPGTDGG
60 70 80 90 100
LPTNYSLTYS KEGEKTTYEC PDYKTSGPNS CFFSKQYTSI WKIYIITVNA
110 120 130 140 150
TNQMGSSSSD PLYVDVTYIV EPEPPRNLTL EVKQLKDKKT YLWVKWSPPT
160 170 180 190 200
ITDVKTGWFT MEYEIRLKPE EAEEWEIHFT GHQTQFKVFD LYPGQKYLVQ
210 220 230 240 250
TRCKPDHGYW SRWSQESSVE MPNDFTLKDT TVWIIVAILS AVICLIMVWA
260 270 280 290 300
VALKGYSMMT CIFPPVPGPK IKGFDTHLLE KGKSEELLSA LGCQDFPPTS
310 320 330 340 350
DCEDLLVEFL EVDDNEDERL MPSHSKEYPG QGVKPTHLDP DSDSGHGSYD
360 370 380 390 400
SHSLLSEKCE EPQAYPPTLH IPEITEKPEN PEANIPPTVD PQSTNPNFHV
410 420 430 440 450
DAPKSSTWPL LPGQHMPRSP YHSVADVCKL AGSPVNTLDS FLDKAEENVL
460 470 480 490 500
KLSKALETGE EEVAEQKGAK SFPSDKQNTP WPLLQEKSPT VYVKPPDYVE
510 520 530 540 550
IHKVNKDGVL SLFPKQRENN QTEKPGVPET SKEYAKVSGI TDNNILVLVP
560 570 580 590 600
DSRAQNTALL EESAKKAPPS FEADQSEKDL ASFTATSSNR RLQLGRLDYL
610
DPTCFMHSFH
Length:610
Mass (Da):68,599
Last modified:November 1, 1997 - v2
Checksum:i83D04D832861295D
GO
Isoform 2 (identifier: P05710-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     131-150: EVKQLKDKKTYLWVKWSPPT → DYRWEVSCHQEALPKSAKLN
     151-610: Missing.

Show »
Length:150
Mass (Da):16,865
Checksum:i157312651786F4B9
GO
Isoform 3 (identifier: P05710-3) [UniParc]FASTAAdd to basket
Also known as: Medium

The sequence of this isoform differs from the canonical sequence as follows:
     281-310: KGKSEELLSALGCQDFPPTSDCEDLLVEFL → TGSPSKYKVDLYLALPGGFQKLDNAGELDY
     311-610: Missing.

Show »
Length:310
Mass (Da):35,352
Checksum:i2636CBF8589A7966
GO
Isoform 4 (identifier: P05710-4) [UniParc]FASTAAdd to basket
Also known as: NB2

The sequence of this isoform differs from the canonical sequence as follows:
     342-539: Missing.

Show »
Length:412
Mass (Da):46,799
Checksum:i349D05B173D10D0C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti236V → A in AAA79273 (PubMed:2159291).Curated1
Sequence conflicti345G → V in AAA79273 (PubMed:2159291).Curated1
Sequence conflicti465E → K in AAA41938 (PubMed:2293022).Curated1
Sequence conflicti466Q → E in AAA79273 (PubMed:2159291).Curated1
Sequence conflicti469A → G in AAA79273 (PubMed:2159291).Curated1
Sequence conflicti541T → M in AAA41938 (PubMed:2293022).Curated1
Sequence conflicti555Q → K in AAA79273 (PubMed:2159291).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001725131 – 150EVKQL…WSPPT → DYRWEVSCHQEALPKSAKLN in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_001726151 – 610Missing in isoform 2. 1 PublicationAdd BLAST460
Alternative sequenceiVSP_001727281 – 310KGKSE…LVEFL → TGSPSKYKVDLYLALPGGFQ KLDNAGELDY in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_001728311 – 610Missing in isoform 3. 1 PublicationAdd BLAST300
Alternative sequenceiVSP_001729342 – 539Missing in isoform 4. 2 PublicationsAdd BLAST198

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M57668 mRNA. Translation: AAA41938.1.
M34083 mRNA. Translation: AAA79273.1.
L48060 mRNA. Translation: AAA79274.1.
U34730 Genomic DNA. Translation: AAA92053.1.
M19304 mRNA. Translation: AAA41937.1.
M74152 mRNA. Translation: AAA41946.1.
U07567 mRNA. Translation: AAA61784.1.
PIRiA29884.
A34631.
A36116.
A41070.
B34631.
RefSeqiNP_001029283.1. NM_001034111.1.
NP_036762.1. NM_012630.2. [P05710-3]
UniGeneiRn.9757.

Genome annotation databases

GeneIDi24684.
KEGGirno:24684.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M57668 mRNA. Translation: AAA41938.1.
M34083 mRNA. Translation: AAA79273.1.
L48060 mRNA. Translation: AAA79274.1.
U34730 Genomic DNA. Translation: AAA92053.1.
M19304 mRNA. Translation: AAA41937.1.
M74152 mRNA. Translation: AAA41946.1.
U07567 mRNA. Translation: AAA61784.1.
PIRiA29884.
A34631.
A36116.
A41070.
B34631.
RefSeqiNP_001029283.1. NM_001034111.1.
NP_036762.1. NM_012630.2. [P05710-3]
UniGeneiRn.9757.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F6FX-ray2.30B/C20-229[»]
3EW3X-ray3.80B/C20-229[»]
3NPZX-ray3.35B/C20-229[»]
ProteinModelPortaliP05710.
SMRiP05710.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-143766.
STRINGi10116.ENSRNOP00000056718.

PTM databases

iPTMnetiP05710.
PhosphoSitePlusiP05710.

Proteomic databases

PaxDbiP05710.
PRIDEiP05710.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi24684.
KEGGirno:24684.

Organism-specific databases

CTDi5618.
RGDi3407. Prlr.

Phylogenomic databases

eggNOGiENOG410IUSW. Eukaryota.
ENOG410XRJS. LUCA.
HOVERGENiHBG007314.
InParanoidiP05710.
KOiK05081.
PhylomeDBiP05710.

Enzyme and pathway databases

ReactomeiR-RNO-1170546. Prolactin receptor signaling.

Miscellaneous databases

EvolutionaryTraceiP05710.
PROiP05710.

Family and domain databases

CDDicd00063. FN3. 1 hit.
Gene3Di2.60.40.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR015152. Growth/epo_recpt_lig-bind.
IPR013783. Ig-like_fold.
IPR003528. Long_hematopoietin_rcpt_CS.
IPR033230. PRLR.
[Graphical view]
PANTHERiPTHR23036:SF86. PTHR23036:SF86. 1 hit.
PfamiPF09067. EpoR_lig-bind. 1 hit.
PF00041. fn3. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 2 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 2 hits.
PS01352. HEMATOPO_REC_L_F1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPRLR_RAT
AccessioniPrimary (citable) accession number: P05710
Secondary accession number(s): Q62832
, Q63451, Q63479, Q63723, Q64274
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: November 1, 1997
Last modified: November 30, 2016
This is version 153 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.