Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin heavy chain, muscle

Gene

Mhc

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Muscle contraction.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi179 – 1868ATPBy similarity

GO - Molecular functioni

  • actin-dependent ATPase activity Source: FlyBase
  • ATPase activity, coupled Source: FlyBase
  • ATP binding Source: UniProtKB-KW
  • motor activity Source: InterPro
  • protein homodimerization activity Source: FlyBase
  • structural constituent of muscle Source: FlyBase

GO - Biological processi

  • adult somatic muscle development Source: FlyBase
  • border follicle cell migration Source: FlyBase
  • epithelial cell migration, open tracheal system Source: FlyBase
  • flight Source: FlyBase
  • locomotion Source: FlyBase
  • muscle cell differentiation Source: FlyBase
  • muscle contraction Source: FlyBase
  • muscle organ development Source: FlyBase
  • muscle thin filament assembly Source: FlyBase
  • myofibril assembly Source: FlyBase
  • myosin filament organization Source: FlyBase
  • protein stabilization Source: FlyBase
  • sarcomere organization Source: FlyBase
  • skeletal muscle myosin thick filament assembly Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Keywords - Ligandi

Actin-binding, ATP-binding, Calmodulin-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin heavy chain, muscle
Gene namesi
Name:Mhc
ORF Names:CG17927
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2L

Organism-specific databases

FlyBaseiFBgn0264695. Mhc.

Subcellular locationi

GO - Cellular componenti

  • A band Source: FlyBase
  • myosin complex Source: FlyBase
  • myosin filament Source: UniProtKB-KW
  • polytene chromosome puff Source: FlyBase
  • sarcomere Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Thick filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 19621962Myosin heavy chain, musclePRO_0000123387Add
BLAST

Proteomic databases

PaxDbiP05661.
PeptideAtlasiP05661.
PRIDEiP05661.

Expressioni

Tissue specificityi

Expressed in larval and adult muscles. Isoforms containing exon 9a are expressed in indirect flight muscles, exons 9a and 9b are expressed in jump muscles, exons 9b and 9c are expressed in other larval and adult muscles.1 Publication

Gene expression databases

BgeeiP05661.
ExpressionAtlasiP05661. differential.
GenevisibleiP05661. DM.

Interactioni

Subunit structurei

Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2).

GO - Molecular functioni

  • protein homodimerization activity Source: FlyBase

Protein-protein interaction databases

BioGridi61014. 43 interactions.
IntActiP05661. 8 interactions.
MINTiMINT-2884939.
STRINGi7227.FBpp0080452.

Structurei

Secondary structure

1
1962
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi14 – 163Combined sources
Helixi21 – 288Combined sources
Turni34 – 363Combined sources
Beta strandi37 – 426Combined sources
Turni43 – 453Combined sources
Beta strandi46 – 5611Combined sources
Beta strandi59 – 635Combined sources
Beta strandi65 – 673Combined sources
Beta strandi69 – 735Combined sources
Helixi74 – 763Combined sources
Helixi83 – 853Combined sources
Helixi91 – 933Combined sources
Helixi99 – 11113Combined sources
Beta strandi116 – 1194Combined sources
Beta strandi122 – 1265Combined sources
Helixi137 – 1426Combined sources
Turni143 – 1453Combined sources
Helixi148 – 1503Combined sources
Helixi155 – 16915Combined sources
Beta strandi173 – 1786Combined sources
Helixi185 – 19915Combined sources
Beta strandi202 – 2076Combined sources
Turni210 – 2123Combined sources
Helixi215 – 2206Combined sources
Helixi223 – 2308Combined sources
Beta strandi243 – 2519Combined sources
Beta strandi255 – 26511Combined sources
Helixi269 – 2724Combined sources
Helixi283 – 2897Combined sources
Helixi296 – 3005Combined sources
Helixi306 – 3083Combined sources
Helixi310 – 3123Combined sources
Helixi324 – 33714Combined sources
Helixi342 – 35918Combined sources
Beta strandi373 – 3753Combined sources
Helixi378 – 38710Combined sources
Helixi391 – 3999Combined sources
Beta strandi402 – 4054Combined sources
Beta strandi408 – 4114Combined sources
Helixi415 – 44632Combined sources
Beta strandi454 – 4607Combined sources
Helixi472 – 50332Combined sources
Helixi512 – 5165Combined sources
Helixi517 – 5248Combined sources
Helixi529 – 5368Combined sources
Helixi544 – 55512Combined sources
Turni556 – 5583Combined sources
Beta strandi570 – 5723Combined sources
Beta strandi577 – 5815Combined sources
Beta strandi584 – 5885Combined sources
Helixi593 – 5964Combined sources
Helixi603 – 6097Combined sources
Helixi615 – 6206Combined sources
Turni621 – 6233Combined sources
Helixi648 – 66417Combined sources
Beta strandi666 – 6749Combined sources
Helixi687 – 69610Combined sources
Helixi699 – 7068Combined sources
Beta strandi712 – 7154Combined sources
Helixi716 – 7238Combined sources
Helixi724 – 7263Combined sources
Turni728 – 7336Combined sources
Helixi737 – 74711Combined sources
Helixi752 – 7543Combined sources
Beta strandi755 – 7573Combined sources
Beta strandi759 – 7646Combined sources
Helixi768 – 80336Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4QBDX-ray2.23A/C2-805[»]
ProteinModelPortaliP05661.
SMRiP05661. Positions 5-839.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini86 – 777692Myosin motorAdd
BLAST
Domaini780 – 80930IQPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili802 – 19271126Sequence analysisAdd
BLAST

Domaini

Alternative splicing exons contribute to the specialized contractile activities of different muscle types. Exon 3 encodes the hydrophobic pocket adjacent to the ATP-binding site, exon 9 is adjacent to the actin-binding domain, exon 11 is involved in actin-binding, exon 15 in the S2 hinge and exons 18 and 19 the non-coiled tail region.
Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).Curated

Sequence similaritiesi

Contains 1 IQ domain.PROSITE-ProRule annotation
Contains 1 myosin motor domain.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0161. Eukaryota.
COG5022. LUCA.
InParanoidiP05661.
KOiK17751.
OMAiAGKCLEA.
PhylomeDBiP05661.

Family and domain databases

Gene3Di4.10.270.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR027401. Myosin-like_IQ_dom.
IPR001609. Myosin_head_motor_dom.
IPR004009. Myosin_N.
IPR002928. Myosin_tail.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00063. Myosin_head. 1 hit.
PF02736. Myosin_N. 1 hit.
PF01576. Myosin_tail_1. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00242. MYSc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50096. IQ. 1 hit.
PS51456. MYOSIN_MOTOR. 1 hit.
[Graphical view]

Sequences (26)i

Sequence statusi: Complete.

This entry describes 26 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. Exons 3, 7, 9, 11 and 15 are mutually exclusive splicing exons and exon 18 is included or excluded.

Isoform AAAAA (identifier: P05661-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPKPVANQED EDPTPYLFVS LEQRRIDQSK PYDSKKSCWI PDEKEGYLLG
60 70 80 90 100
EIKATKGDIV SVGLQGGEVR DIKSEKVEKV NPPKFEKIED MADMTVLNTP
110 120 130 140 150
CVLHNLRQRY YAKLIYTYSG LFCVAINPYK RYPVYTNRCA KMYRGKRRNE
160 170 180 190 200
VPPHIFAISD GAYVDMLTNH VNQSMLITGE SGAGKTENTK KVIAYFATVG
210 220 230 240 250
ASKKTDEAAK SKGSLEDQVV QTNPVLEAFG NAKTVRNDNS SRFGKFIRIH
260 270 280 290 300
FGPTGKLAGA DIETYLLEKA RVISQQSLER SYHIFYQIMS GSVPGVKDIC
310 320 330 340 350
LLTDNIYDYH IVSQGKVTVA SIDDAEEFSL TDQAFDILGF TKQEKEDVYR
360 370 380 390 400
ITAAVMHMGG MKFKQRGREE QAEQDGEEEG GRVSKLFGCD TAELYKNLLK
410 420 430 440 450
PRIKVGNEFV TQGRNVQQVT NSIGALCKGV FDRLFKWLVK KCNETLDTQQ
460 470 480 490 500
KRQHFIGVLD IAGFEIFEYN GFEQLCINFT NEKLQQFFNH IMFVMEQEEY
510 520 530 540 550
KKEGINWDFI DFGMDLLACI DLIEKPMGIL SILEEESMFP KATDQTFSEK
560 570 580 590 600
LTNTHLGKSA PFQKPKPPKP GQQAAHFAIA HYAGCVSYNI TGWLEKNKDP
610 620 630 640 650
LNDTVVDQFK KSQNKLLIEI FADHAGQSGG GEQAKGGRGK KGGGFATVSS
660 670 680 690 700
AYKEQLNSLM TTLRSTQPHF VRCIIPNEMK QPGVVDAHLV MHQLTCNGVL
710 720 730 740 750
EGIRICRKGF PNRMMYPDFK MRYQILNPRG IKDLDCPKKA SKVLIESTEL
760 770 780 790 800
NEDLYRLGHT KVFFRAGVLG QMEEFRDERL GKIMSWMQAW ARGYLSRKGF
810 820 830 840 850
KKLQEQRVAL KVVQRNLRKY LQLRTWPWYK LWQKVKPLLN VSRIEDEIAR
860 870 880 890 900
LEEKAKKAEE LHAAEVKVRK ELEALNAKLL AEKTALLDSL SGEKGALQDY
910 920 930 940 950
QERNAKLTAQ KNDLENQLRD IQERLTQEED ARNQLFQQKK KADQEISGLK
960 970 980 990 1000
KDIEDLELNV QKAEQDKATK DHQIRNLNDE IAHQDELINK LNKEKKMQGE
1010 1020 1030 1040 1050
TNQKTGEELQ AAEDKINHLN KVKAKLEQTL DELEDSLERE KKVRGDVEKS
1060 1070 1080 1090 1100
KRKVEGDLKL TQEAVADLER NKKELEQTIQ RKDKELSSIT AKLEDEQVVV
1110 1120 1130 1140 1150
LKHQRQIKEL QARIEELEEE VEAERQARAK AEKQRADLAR ELEELGERLE
1160 1170 1180 1190 1200
EAGGATSAQI ELNKKREAEL SKLRRDLEEA NIQHESTLAN LRKKHNDAVA
1210 1220 1230 1240 1250
EMAEQVDQLN KLKAKAEHDR QTCHNELNQT RTACDQLGRD KAAQEKIAKQ
1260 1270 1280 1290 1300
LQHTLNEVQS KLDETNRTLN DFDASKKKLS IENSDLLRQL EEAESQVSQL
1310 1320 1330 1340 1350
SKIKISLTTQ LEDTKRLADE ESRERATLLG KFRNLEHDLD NLREQVEEEA
1360 1370 1380 1390 1400
EGKADLQRQL SKANAEAQVW RSKYESDGVA RSEELEEAKR KLQARLAEAE
1410 1420 1430 1440 1450
ETIESLNQKC IGLEKTKQRL STEVEDLQLE VDRANAIANA AEKKQKAFDK
1460 1470 1480 1490 1500
IIGEWKLKVD DLAAELDASQ KECRNYSTEL FRLKGAYEEG QEQLEAVRRE
1510 1520 1530 1540 1550
NKNLADEVKD LLDQIGEGGR NIHEIEKARK RLEAEKDELQ AALEEAEAAL
1560 1570 1580 1590 1600
EQEENKVLRA QLELSQVRQE IDRRIQEKEE EFENTRKNHQ RALDSMQASL
1610 1620 1630 1640 1650
EAEAKGKAEA LRMKKKLEAD INELEIALDH ANKANAEAQK NIKRYQQQLK
1660 1670 1680 1690 1700
DIQTALEEEQ RARDDAREQL GISERRANAL QNELEESRTL LEQADRGRRQ
1710 1720 1730 1740 1750
AEQELADAHE QLNEVSAQNA SISAAKRKLE SELQTLHSDL DELLNEAKNS
1760 1770 1780 1790 1800
EEKAKKAMVD AARLADELRA EQDHAQTQEK LRKALEQQIK ELQVRLDEAE
1810 1820 1830 1840 1850
ANALKGGKKA IQKLEQRVRE LENELDGEQR RHADAQKNLR KSERRVKELS
1860 1870 1880 1890 1900
FQSEEDRKNH ERMQDLVDKL QQKIKTYKRQ IEEAEEIAAL NLAKFRKAQQ
1910 1920 1930 1940 1950
ELEEAEERAD LAEQAISKFR AKGRAGSVGR GASPAPRATS VRPQFDGLAF
1960
PPRFDLAPEN EF
Length:1,962
Mass (Da):224,465
Last modified:July 25, 2006 - v4
Checksum:iC8010B7971BB9576
GO
Isoform BDBBA (identifier: P05661-2) [UniParc]FASTAAdd to basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPAGIV...PDMYRIGHTK

Show »
Length:1,962
Mass (Da):224,410
Checksum:i092A1BEAEC61CC4F
GO
Isoform BABDB (identifier: P05661-3) [UniParc]FASTAAdd to basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,609
Checksum:i8D3511F4B0CC336D
GO
Isoform 3b (identifier: P05661-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY

Show »
Length:1,962
Mass (Da):224,542
Checksum:iEB283C6D53A31744
GO
Isoform 7b (identifier: P05661-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EYCLLSNNIYDYRIVSQGKTTIPSVNDGEEWVAVD

Show »
Length:1,962
Mass (Da):224,553
Checksum:iAAC2835D91C8368C
GO
Isoform 7c (identifier: P05661-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMVFLGQHIGDYPGICQGKTRIPGVNDGEEFELTD

Show »
Length:1,962
Mass (Da):224,427
Checksum:i5CCB39F649CED1EC
GO
Isoform 7d (identifier: P05661-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD

Show »
Length:1,962
Mass (Da):224,612
Checksum:iA76784F6BF9F1674
GO
Isoform 9b (identifier: P05661-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK

Show »
Length:1,962
Mass (Da):224,456
Checksum:i7C5946E3CEC0D5D9
GO
Isoform 9c (identifier: P05661-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LQLCIDLIEK

Show »
Length:1,962
Mass (Da):224,557
Checksum:iC15E3B4BADD7F542
GO
Isoform 11b (identifier: P05661-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPAGIV...PDMYRIGHTK

Show »
Length:1,962
Mass (Da):224,195
Checksum:iF13DEEEBBF268DD0
GO
Isoform 11c (identifier: P05661-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPKGIK...DDQYRLGNTK

Show »
Length:1,962
Mass (Da):224,429
Checksum:i6E0B16281726DD33
GO
Isoform 11d (identifier: P05661-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK

Show »
Length:1,962
Mass (Da):224,547
Checksum:i548FA7C10C2EFDC6
GO
Isoform 11e (identifier: P05661-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     723-761: YQILNPRGIK...EDLYRLGHTK → YMILAPAIMA...PDMYRIGHTK

Show »
Length:1,962
Mass (Da):224,127
Checksum:i00443D3DC35C2B2A
GO
Isoform 15b (identifier: P05661-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Show »
Length:1,962
Mass (Da):224,460
Checksum:i86CAC7C2503A9940
GO
Isoform 18 (identifier: P05661-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1936-1936: P → I
     1937-1962: Missing.

Show »
Length:1,936
Mass (Da):221,521
Checksum:i4EA20E0ED59DDC16
GO
Isoform C (identifier: P05661-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPKGIK...DDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Note: No experimental confirmation available.
Show »
Length:1,962
Mass (Da):224,415
Checksum:i9498970989DC91AA
GO
Isoform D (identifier: P05661-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPKGIK...DDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Note: No experimental confirmation available.
Show »
Length:1,962
Mass (Da):224,492
Checksum:iB7B1A01DABC41398
GO
Isoform E (identifier: P05661-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LQLCIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Note: No experimental confirmation available.
Show »
Length:1,962
Mass (Da):224,634
Checksum:i131B5B48F1C391C4
GO
Isoform F (identifier: P05661-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Note: No experimental confirmation available.
Show »
Length:1,962
Mass (Da):224,528
Checksum:i11BBBD4CCD595BDD
GO
Isoform G (identifier: P05661-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Note: No experimental confirmation available.
Show »
Length:1,962
Mass (Da):224,533
Checksum:iAE1C26E092D4B15F
GO
Isoform H (identifier: P05661-21) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LQLCIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Note: No experimental confirmation available.
Show »
Length:1,962
Mass (Da):224,711
Checksum:i30326C5CD3DB13F6
GO
Isoform I (identifier: P05661-22) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LQLCIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPKGIK...DDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Note: No experimental confirmation available.
Show »
Length:1,962
Mass (Da):224,593
Checksum:i0AB6DDB5C8D33303
GO
Isoform Q (identifier: P05661-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EYCLLSNNIYDYRIVSQGKTTIPSVNDGEEWVAVD
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YKIMCPKLLQ...EDQYRLGNTK
     1216-1241: AEHDRQTCHNELNQTRTACDQLGRDK → AEKEKNEYYGQLNDLRAGVDHITNEK

Note: No experimental confirmation available.
Show »
Length:1,962
Mass (Da):224,621
Checksum:iCCDFAEC472A712A5
GO
Isoform K (identifier: P05661-24) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD
     723-761: YQILNPRGIK...EDLYRLGHTK → YMILAPAIMA...PDMYRIGHTK
     1936-1936: P → I
     1937-1962: Missing.

Note: No experimental confirmation available.
Show »
Length:1,936
Mass (Da):221,407
Checksum:i2097C007C6F2CC8B
GO
Isoform L (identifier: P05661-25) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPAGIV...PDMYRIGHTK
     1936-1936: P → I
     1937-1962: Missing.

Note: No experimental confirmation available.
Show »
Length:1,936
Mass (Da):221,475
Checksum:i5A7B2028DE9DB4EC
GO
Isoform M (identifier: P05661-26) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-116: VRDIKSEKVE...RQRYYAKLIY → TRDLKKDLLQ...RQRYYNKLIY
     298-332: DICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTD → EMCFLSDNIYDYYNVSQGKVTVPNMDDGEEFQLAD
     469-525: YNGFEQLCIN...LLACIDLIEK → YNGFEQLCIN...LLACIDLIEK
     723-761: YQILNPRGIK...EDLYRLGHTK → YQILNPAGIV...PDMYRIGHTK
     1936-1936: P → I
     1937-1962: Missing.

Note: No experimental confirmation available.
Show »
Length:1,936
Mass (Da):221,466
Checksum:iA3C51D7E61B5536A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti43 – 442EK → RE in AAA28706 (PubMed:3038896).Curated
Sequence conflicti43 – 442EK → RE in AAA28707 (PubMed:3038896).Curated
Sequence conflicti68 – 681E → K in AAA28706 (PubMed:3038896).Curated
Sequence conflicti68 – 681E → K in AAA28707 (PubMed:3038896).Curated
Sequence conflicti215 – 2151L → M in AAA28706 (PubMed:3038896).Curated
Sequence conflicti215 – 2151L → M in AAA28707 (PubMed:3038896).Curated
Sequence conflicti281 – 2811S → C in AAA28686 (PubMed:2506434).Curated
Sequence conflicti281 – 2811S → C in AAA28687 (PubMed:2506434).Curated
Sequence conflicti1922 – 19221K → KFRAK AA sequence (Ref. 8) Curated
Sequence conflicti1933 – 19386SPAPRA → GPAVSY AA sequence (Ref. 8) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei69 – 11648VRDIK…AKLIY → TRDLKKDLLQQVNPPKYEKA EDMSNLTYLNDASVLHNLRQ RYYNKLIY in isoform 3b, isoform BDBBA, isoform BABDB, isoform D, isoform F, isoform H, isoform I, isoform K, isoform L and isoform M. CuratedVSP_003329Add
BLAST
Alternative sequencei298 – 33235DICLL…FSLTD → EYCLLSNNIYDYRIVSQGKT TIPSVNDGEEWVAVD in isoform 7b and isoform Q. CuratedVSP_003330Add
BLAST
Alternative sequencei298 – 33235DICLL…FSLTD → EMVFLGQHIGDYPGICQGKT RIPGVNDGEEFELTD in isoform 7c. CuratedVSP_003331Add
BLAST
Alternative sequencei298 – 33235DICLL…FSLTD → EMCFLSDNIYDYYNVSQGKV TVPNMDDGEEFQLAD in isoform 7d, isoform BDBBA, isoform K, isoform L and isoform M. CuratedVSP_003332Add
BLAST
Alternative sequencei469 – 52557YNGFE…DLIEK → YNGFEQLCINFTNEKLQQFF NHHMFVLEQEEYKREGIDWA FIDFGMDLLACIDLIEK in isoform 9b, isoform BDBBA, isoform BABDB, isoform C, isoform D, isoform F, isoform G, isoform Q and isoform M. CuratedVSP_003333Add
BLAST
Alternative sequencei469 – 52557YNGFE…DLIEK → YNGFEQLCINFTNEKLQQFF NHHMFVLEQEEYQREGIEWT FIDFGMDLQLCIDLIEK in isoform 9c, isoform E, isoform H and isoform I. CuratedVSP_003334Add
BLAST
Alternative sequencei723 – 76139YQILN…LGHTK → YQILNPAGIVGVDDPKKCGS IILESTALDPDMYRIGHTK in isoform 11b, isoform BDBBA, isoform L and isoform M. CuratedVSP_003335Add
BLAST
Alternative sequencei723 – 76139YQILN…LGHTK → YQILNPKGIKGIEDPKKCTK VLIESTELNDDQYRLGNTK in isoform 11c, isoform C, isoform D and isoform I. CuratedVSP_003336Add
BLAST
Alternative sequencei723 – 76139YQILN…LGHTK → YKIMCPKLLQGVEKDKKATE IIIKFIDLPEDQYRLGNTK in isoform 11d, isoform BABDB, isoform E, isoform G, isoform H and isoform Q. CuratedVSP_003337Add
BLAST
Alternative sequencei723 – 76139YQILN…LGHTK → YMILAPAIMAAEKVAKNAAG KCLEAVGLDPDMYRIGHTK in isoform 11e and isoform K. CuratedVSP_003338Add
BLAST
Alternative sequencei1216 – 124126AEHDR…LGRDK → AEKEKNEYYGQLNDLRAGVD HITNEK in isoform 15b, isoform BABDB, isoform C, isoform D, isoform E, isoform F, isoform G, isoform H, isoform I and isoform Q. CuratedVSP_003339Add
BLAST
Alternative sequencei1936 – 19361P → I in isoform 18, isoform K, isoform L and isoform M. CuratedVSP_003340
Alternative sequencei1937 – 196226Missing in isoform 18, isoform K, isoform L and isoform M. CuratedVSP_003341Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M61229 Genomic DNA. Translation: AAA28686.1.
M61229 Genomic DNA. Translation: AAA28687.1.
X53155 Genomic DNA. Translation: CAA37308.1.
X53155 Genomic DNA. Translation: CAA37309.1.
X53155 Genomic DNA. Translation: CAA37310.1.
X53155 Genomic DNA. Translation: CAA37311.1.
AE014134 Genomic DNA. Translation: AAF53566.4.
AE014134 Genomic DNA. Translation: AAN10959.1.
AE014134 Genomic DNA. Translation: AAN10960.1.
AE014134 Genomic DNA. Translation: AAN10961.1.
AE014134 Genomic DNA. Translation: AAN10962.1.
AE014134 Genomic DNA. Translation: AAN10963.1.
AE014134 Genomic DNA. Translation: AAN10964.1.
AE014134 Genomic DNA. Translation: AAN10965.1.
AE014134 Genomic DNA. Translation: AAN10966.1.
AE014134 Genomic DNA. Translation: AAN10967.1.
AE014134 Genomic DNA. Translation: AAN10968.1.
AE014134 Genomic DNA. Translation: AAN10969.1.
AE014134 Genomic DNA. Translation: AAN10970.1.
J02788 Genomic DNA. Translation: AAA28706.1.
J02788 Genomic DNA. Translation: AAA28707.1.
X60196 Genomic DNA. Translation: CAA42752.1.
X60196 Genomic DNA. Translation: CAA42753.1.
X60196 Genomic DNA. Translation: CAA42754.1.
M13360 Genomic DNA. Translation: AAA28708.1.
M13360 Genomic DNA. Translation: AAA28709.1.
PIRiA18942.
A25380.
A28492.
A32491.
A35815.
B25380.
B32491.
B35815.
C35815.
D35815.
S16600.
S16601.
S16602.
RefSeqiNP_001162991.1. NM_001169520.3. [P05661-20]
NP_523587.4. NM_078863.6. [P05661-21]
NP_723999.1. NM_165181.3. [P05661-16]
NP_724000.1. NM_165182.3. [P05661-20]
NP_724001.1. NM_165183.3. [P05661-18]
NP_724002.2. NM_165184.3. [P05661-23]
NP_724003.1. NM_165185.3. [P05661-19]
NP_724004.1. NM_165186.3. [P05661-17]
NP_724005.1. NM_165187.3. [P05661-3]
NP_724006.1. NM_165188.3. [P05661-22]
NP_724007.1. NM_165189.3. [P05661-2]
NP_724008.1. NM_165190.4. [P05661-24]
NP_724009.1. NM_165191.3. [P05661-25]
NP_724010.1. NM_165192.4. [P05661-26]
UniGeneiDm.2761.

Genome annotation databases

GeneIDi35007.
KEGGidme:Dmel_CG17927.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M61229 Genomic DNA. Translation: AAA28686.1.
M61229 Genomic DNA. Translation: AAA28687.1.
X53155 Genomic DNA. Translation: CAA37308.1.
X53155 Genomic DNA. Translation: CAA37309.1.
X53155 Genomic DNA. Translation: CAA37310.1.
X53155 Genomic DNA. Translation: CAA37311.1.
AE014134 Genomic DNA. Translation: AAF53566.4.
AE014134 Genomic DNA. Translation: AAN10959.1.
AE014134 Genomic DNA. Translation: AAN10960.1.
AE014134 Genomic DNA. Translation: AAN10961.1.
AE014134 Genomic DNA. Translation: AAN10962.1.
AE014134 Genomic DNA. Translation: AAN10963.1.
AE014134 Genomic DNA. Translation: AAN10964.1.
AE014134 Genomic DNA. Translation: AAN10965.1.
AE014134 Genomic DNA. Translation: AAN10966.1.
AE014134 Genomic DNA. Translation: AAN10967.1.
AE014134 Genomic DNA. Translation: AAN10968.1.
AE014134 Genomic DNA. Translation: AAN10969.1.
AE014134 Genomic DNA. Translation: AAN10970.1.
J02788 Genomic DNA. Translation: AAA28706.1.
J02788 Genomic DNA. Translation: AAA28707.1.
X60196 Genomic DNA. Translation: CAA42752.1.
X60196 Genomic DNA. Translation: CAA42753.1.
X60196 Genomic DNA. Translation: CAA42754.1.
M13360 Genomic DNA. Translation: AAA28708.1.
M13360 Genomic DNA. Translation: AAA28709.1.
PIRiA18942.
A25380.
A28492.
A32491.
A35815.
B25380.
B32491.
B35815.
C35815.
D35815.
S16600.
S16601.
S16602.
RefSeqiNP_001162991.1. NM_001169520.3. [P05661-20]
NP_523587.4. NM_078863.6. [P05661-21]
NP_723999.1. NM_165181.3. [P05661-16]
NP_724000.1. NM_165182.3. [P05661-20]
NP_724001.1. NM_165183.3. [P05661-18]
NP_724002.2. NM_165184.3. [P05661-23]
NP_724003.1. NM_165185.3. [P05661-19]
NP_724004.1. NM_165186.3. [P05661-17]
NP_724005.1. NM_165187.3. [P05661-3]
NP_724006.1. NM_165188.3. [P05661-22]
NP_724007.1. NM_165189.3. [P05661-2]
NP_724008.1. NM_165190.4. [P05661-24]
NP_724009.1. NM_165191.3. [P05661-25]
NP_724010.1. NM_165192.4. [P05661-26]
UniGeneiDm.2761.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4QBDX-ray2.23A/C2-805[»]
ProteinModelPortaliP05661.
SMRiP05661. Positions 5-839.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi61014. 43 interactions.
IntActiP05661. 8 interactions.
MINTiMINT-2884939.
STRINGi7227.FBpp0080452.

Proteomic databases

PaxDbiP05661.
PeptideAtlasiP05661.
PRIDEiP05661.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi35007.
KEGGidme:Dmel_CG17927.

Organism-specific databases

CTDi35007.
FlyBaseiFBgn0264695. Mhc.

Phylogenomic databases

eggNOGiKOG0161. Eukaryota.
COG5022. LUCA.
InParanoidiP05661.
KOiK17751.
OMAiAGKCLEA.
PhylomeDBiP05661.

Miscellaneous databases

ChiTaRSizip. fly.
GenomeRNAii35007.
PROiP05661.

Gene expression databases

BgeeiP05661.
ExpressionAtlasiP05661. differential.
GenevisibleiP05661. DM.

Family and domain databases

Gene3Di4.10.270.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR027401. Myosin-like_IQ_dom.
IPR001609. Myosin_head_motor_dom.
IPR004009. Myosin_N.
IPR002928. Myosin_tail.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00063. Myosin_head. 1 hit.
PF02736. Myosin_N. 1 hit.
PF01576. Myosin_tail_1. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00242. MYSc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50096. IQ. 1 hit.
PS51456. MYOSIN_MOTOR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Functional domains of the Drosophila melanogaster muscle myosin heavy-chain gene are encoded by alternatively spliced exons."
    George E.L., Ober M.B., Emerson C.P. Jr.
    Mol. Cell. Biol. 9:2957-2974(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS BDBBA AND BABDB).
    Strain: Canton-S.
    Tissue: Pupae.
  2. "Alternative myosin hinge regions are utilized in a tissue-specific fashion that correlates with musle contraction speed."
    Collier V.L., Kronert W.A., O'Donnell P.T., Edwards K.A., Bernstein S.I.
    Genes Dev. 4:885-895(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM M), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 762-1962, TISSUE SPECIFICITY.
    Strain: Canton-S.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. "Analysis of the 5' end of the Drosophila muscle myosin heavy chain gene. Alternatively spliced transcripts initiate at a single site and intron locations are conserved compared to myosin genes of other organisms."
    Wassenberg D.R. II, Kronert W.A., O'Donnell P.T., Bernstein S.I.
    J. Biol. Chem. 262:10741-10747(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-264.
  6. "Muscle-specific accumulation of Drosophila myosin heavy chains: a splicing mutation in an alternative exon results in an isoform substitution."
    Kronert W.A., Edwards K.A., Roche E.S., Wells L., Bernstein S.I.
    EMBO J. 10:2479-2488(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 333-614.
    Strain: Canton-S.
    Tissue: Embryonic muscle.
  7. "Alternative RNA splicing generates transcripts encoding a thorax-specific isoform of Drosophila melanogaster myosin heavy chain."
    Bernstein S.I., Hansen C.J., Becker K.D., Wassenberg D.R. II, Roche E.S., Donady J.J., Emerson C.P. Jr.
    Mol. Cell. Biol. 6:2511-2519(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1774-1962.
  8. Bernstein S.I.
    Unpublished observations (JAN-1982)
    Cited for: PROTEIN SEQUENCE OF 1778-1938.

Entry informationi

Entry nameiMYSA_DROME
AccessioniPrimary (citable) accession number: P05661
Secondary accession number(s): O18392
, O18393, Q24412, Q7JN62, Q7JN63, Q7JQ08, Q7JQ09, Q7M4K4, Q8INZ9, Q8IP00, Q8IP01, Q8IP02, Q8IP03, Q8IP04, Q8IP05, Q8IP06, Q8IP07, Q8IP08, Q8IP09, Q8IP10, Q9TY21, Q9TY22, Q9TYD7, Q9VJI3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: July 25, 2006
Last modified: July 6, 2016
This is version 164 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.