P05111 A8K8H5 INHA_HUMAN Inhibin alpha chain INHA Homo sapiens Human Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Inhibin A-subunit cDNAs from porcine ovary and human placenta. NUCLEOTIDE SEQUENCE [MRNA] Human inhibin genes. Genomic characterisation and sequencing. NUCLEOTIDE SEQUENCE [GENOMIC DNA] Cloning of human full-length CDSs in BD Creator(TM) system donor vector. NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Complete sequencing and characterization of 21,243 full-length human cDNAs. NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Testis NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Brain Structure of two human ovarian inhibins. NUCLEOTIDE SEQUENCE [MRNA] OF 16-366 Characterization and determination of the biological activities of noncleavable high molecular weight forms of inhibin A and activin A. PARTIAL PROTEIN SEQUENCE PROTEOLYTIC PROCESSING GLYCOSYLATION AT ASN-268 AND ASN-302 MUTAGENESIS Loss of the expression and localization of inhibin alpha-subunit in high grade prostate cancer. TISSUE SPECIFICITY INDUCTION Inhibin: a candidate gene for premature ovarian failure. VARIANT THR-257 Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. Dimeric, linked by one or more disulfide bonds. Inhibin A is a dimer of alpha and beta-A. Inhibin B is a dimer of alpha and beta-B. Secreted Originally found in ovary (granulosa cells) and testis (Sertoli cells), but widely distributed in many tissues including brain and placenta. In adrenal cortex expression is limited to the zona reticularis and the innermost zona fasciculata in the normal gland, extending centripetally into the zona fasciculata in hyperplasia. Also found in adrenocortical tumors. Also expressed in prostate epithelium of benign prostatic hyperplasia, in regions of basal cell hyperplasia and in nonmalignant regions of high grade prostate cancer. Only circulating inhibin B is found in male, whereas circulating inhibins A and B are found in female. Proteolytic processing yields a number of bioactive forms. The 20/23 kDa forms consist solely of the mature alpha chain, the 26/29 kDa forms consist of the most N-terminal propeptide linked through a disulfide bond to the mature alpha chain, the 50/53 kDa forms encompass the entire proprotein. Each type can be furthermore either mono- or diglycosylated, causing the mass difference. Belongs to the TGF-beta family. Inhibin entry Cleavage on pair of basic residues Complete proteome Direct protein sequencing Disulfide bond Glycoprotein Growth factor Hormone Polymorphism Reference proteome Secreted Signal G R A T RR AA RR AA RR EA N Q N Q H V C S MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPR RHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQH TRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLH LATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWP WSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLT QHCACI Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License