Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P04899

- GNAI2_HUMAN

UniProt

P04899 - GNAI2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Guanine nucleotide-binding protein G(i) subunit alpha-2

Gene

GNAI2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. May play a role in cell division.
Isoform sGi2: Regulates the cell surface density of dopamine receptors DRD2 by sequestrating them as an intracellular pool.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi47 – 471MagnesiumBy similarity
Metal bindingi182 – 1821MagnesiumBy similarity
Binding sitei327 – 3271GTP; via amide nitrogenBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi40 – 478GTPBy similarity
Nucleotide bindingi176 – 1827GTPBy similarity
Nucleotide bindingi201 – 2055GTPBy similarity
Nucleotide bindingi270 – 2734GTPBy similarity

GO - Molecular functioni

  1. G-protein beta/gamma-subunit complex binding Source: RefGenome
  2. G-protein coupled receptor binding Source: RefGenome
  3. GTPase activity Source: RefGenome
  4. GTP binding Source: UniProtKB-KW
  5. metal ion binding Source: UniProtKB-KW
  6. signal transducer activity Source: RefGenome

GO - Biological processi

  1. activation of MAPKK activity Source: Ensembl
  2. adenosine receptor signaling pathway Source: RefGenome
  3. adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway Source: RefGenome
  4. blood coagulation Source: Reactome
  5. cell cycle Source: UniProtKB-KW
  6. cell division Source: UniProtKB
  7. cell proliferation Source: Ensembl
  8. gamma-aminobutyric acid signaling pathway Source: RefGenome
  9. G-protein coupled acetylcholine receptor signaling pathway Source: Ensembl
  10. G-protein coupled receptor signaling pathway Source: ProtInc
  11. negative regulation of adenylate cyclase activity Source: ProtInc
  12. negative regulation of synaptic transmission Source: Ensembl
  13. platelet activation Source: Reactome
  14. positive regulation of cell proliferation Source: Ensembl
  15. regulation of calcium ion transport Source: Ensembl
  16. response to nutrient Source: ProtInc
  17. signal transduction Source: ProtInc
  18. synaptic transmission Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Transducer

Keywords - Biological processi

Cell cycle, Cell division

Keywords - Ligandi

GTP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_15333. Adenylate cyclase inhibitory pathway.
REACT_15426. PLC beta mediated events.
REACT_15457. G-protein activation.
REACT_18325. Regulation of insulin secretion.
REACT_18339. Adrenaline,noradrenaline inhibits insulin secretion.
REACT_19231. G alpha (i) signalling events.
REACT_19327. G alpha (s) signalling events.
REACT_19333. G alpha (z) signalling events.
REACT_20653. ADP signalling through P2Y purinoceptor 12.
SignaLinkiP04899.

Names & Taxonomyi

Protein namesi
Recommended name:
Guanine nucleotide-binding protein G(i) subunit alpha-2
Alternative name(s):
Adenylate cyclase-inhibiting G alpha protein
Gene namesi
Name:GNAI2
Synonyms:GNAI2B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:4385. GNAI2.

Subcellular locationi

Cytoplasm 1 Publication. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 1 Publication. Cell membrane 1 Publication
Note: Localizes in the centrosomes of interphase and mitotic cells. Detected at the cleavage furrow and/or the midbody.

GO - Cellular componenti

  1. centrosome Source: UniProtKB
  2. cytoplasm Source: UniProtKB
  3. cytosol Source: Ensembl
  4. extracellular vesicular exosome Source: UniProt
  5. heterotrimeric G-protein complex Source: RefGenome
  6. membrane Source: UniProtKB
  7. membrane raft Source: Ensembl
  8. midbody Source: UniProtKB
  9. nucleus Source: HPA
  10. plasma membrane Source: UniProtKB
  11. vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24347.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedCurated
Chaini2 – 355354Guanine nucleotide-binding protein G(i) subunit alpha-2PRO_0000203679Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycineCurated
Lipidationi3 – 31S-palmitoyl cysteineBy similarity
Modified residuei179 – 1791ADP-ribosylarginine; by cholera toxinBy similarity
Modified residuei352 – 3521ADP-ribosylcysteine; by pertussis toxinBy similarity

Keywords - PTMi

ADP-ribosylation, Lipoprotein, Myristate, Palmitate

Proteomic databases

MaxQBiP04899.
PaxDbiP04899.
PRIDEiP04899.

PTM databases

PhosphoSiteiP04899.

Expressioni

Gene expression databases

BgeeiP04899.
CleanExiHS_GNAI2.
ExpressionAtlasiP04899. baseline and differential.
GenevestigatoriP04899.

Organism-specific databases

HPAiHPA007704.

Interactioni

Subunit structurei

G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site. Interacts with GPSM1. Interacts with RGS12 and RGS14 (By similarity). Interacts with UNC5B.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CXCR5P323025EBI-353997,EBI-2835269
MDFIQ997502EBI-353997,EBI-724076
NCF1P145982EBI-353997,EBI-395044
NCF2P198784EBI-353997,EBI-489611

Protein-protein interaction databases

BioGridi109033. 94 interactions.
DIPiDIP-602N.
IntActiP04899. 24 interactions.
MINTiMINT-7901704.
STRINGi9606.ENSP00000312999.

Structurei

3D structure databases

ProteinModelPortaliP04899.
SMRiP04899. Positions 5-354.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-alpha family. G(i/o/t/z) subfamily.Curated

Phylogenomic databases

eggNOGiNOG322962.
GeneTreeiENSGT00760000118851.
HOGENOMiHOG000038730.
HOVERGENiHBG063184.
InParanoidiP04899.
KOiK04630.
OMAiEYAGANK.
OrthoDBiEOG72C50B.
PhylomeDBiP04899.
TreeFamiTF300673.

Family and domain databases

Gene3Di1.10.400.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR001408. Gprotein_alpha_I.
IPR001019. Gprotein_alpha_su.
IPR011025. GproteinA_insert.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10218. PTHR10218. 1 hit.
PfamiPF00503. G-alpha. 1 hit.
[Graphical view]
PRINTSiPR00318. GPROTEINA.
PR00441. GPROTEINAI.
SMARTiSM00275. G_alpha. 1 hit.
[Graphical view]
SUPFAMiSSF47895. SSF47895. 1 hit.
SSF52540. SSF52540. 2 hits.

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P04899-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCTVSAEDK AAAERSKMID KNLREDGEKA AREVKLLLLG AGESGKSTIV
60 70 80 90 100
KQMKIIHEDG YSEEECRQYR AVVYSNTIQS IMAIVKAMGN LQIDFADPSR
110 120 130 140 150
ADDARQLFAL SCTAEEQGVL PDDLSGVIRR LWADHGVQAC FGRSREYQLN
160 170 180 190 200
DSAAYYLNDL ERIAQSDYIP TQQDVLRTRV KTTGIVETHF TFKDLHFKMF
210 220 230 240 250
DVGGQRSERK KWIHCFEGVT AIIFCVALSA YDLVLAEDEE MNRMHESMKL
260 270 280 290 300
FDSICNNKWF TDTSIILFLN KKDLFEEKIT HSPLTICFPE YTGANKYDEA
310 320 330 340 350
ASYIQSKFED LNKRKDTKEI YTHFTCATDT KNVQFVFDAV TDVIIKNNLK

DCGLF
Length:355
Mass (Da):40,451
Last modified:January 23, 2007 - v3
Checksum:iBE6D6FF720CF3DCC
GO
Isoform 2 (identifier: P04899-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MEYAGHLPASSAQGTILACTSCT

Show »
Length:339
Mass (Da):38,473
Checksum:iF14AB734881535C5
GO
Isoform 3 (identifier: P04899-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MR

Note: No experimental confirmation available.

Show »
Length:318
Mass (Da):36,465
Checksum:iA0131D7E46EC5370
GO
Isoform sGi2 (identifier: P04899-4) [UniParc]FASTAAdd to Basket

Also known as: sGalphai2

The sequence of this isoform differs from the canonical sequence as follows:
     332-355: NVQFVFDAVTDVIIKNNLKDCGLF → SRKLFRETYLKLSGPDQHPHPSPAPAPPLSSDSVP

Show »
Length:366
Mass (Da):41,548
Checksum:iEF7FED14C8A0A8B4
GO
Isoform 5 (identifier: P04899-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MTEGVKTLGWTKQKGGCHWGRSE

Note: No experimental confirmation available.

Show »
Length:339
Mass (Da):38,737
Checksum:iBFCDD8678696698F
GO
Isoform 6 (identifier: P04899-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Note: No experimental confirmation available.

Show »
Length:303
Mass (Da):34,935
Checksum:i9E676EE9177E166C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5252Missing in isoform 6. 1 PublicationVSP_054788Add
BLAST
Alternative sequencei1 – 3939MGCTV…KLLLL → MEYAGHLPASSAQGTILACT SCT in isoform 2. 1 PublicationVSP_017497Add
BLAST
Alternative sequencei1 – 3939MGCTV…KLLLL → MR in isoform 3. 1 PublicationVSP_043473Add
BLAST
Alternative sequencei1 – 3939MGCTV…KLLLL → MTEGVKTLGWTKQKGGCHWG RSE in isoform 5. 1 PublicationVSP_054789Add
BLAST
Alternative sequencei332 – 35524NVQFV…DCGLF → SRKLFRETYLKLSGPDQHPH PSPAPAPPLSSDSVP in isoform sGi2. 1 PublicationVSP_043903Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X04828 mRNA. Translation: CAA28512.1.
J03004 mRNA. Translation: AAA52556.1. Sequence problems.
M20593
, M20586, M20587, M20588, M20589, M20590, M20591, M20592 Genomic DNA. Translation: AAA35894.1.
AY677118 mRNA. Translation: AAT78421.1.
AF493906 mRNA. Translation: AAM12620.1.
AK096299 mRNA. Translation: BAG53252.1.
AK096595 mRNA. Translation: BAG53334.1.
AK302330 mRNA. Translation: BAG63662.1.
AK304473 mRNA. Translation: BAG65287.1.
AC002077 Genomic DNA. No translation available.
U73166 Genomic DNA. No translation available.
U73169 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW65053.1.
CH471055 Genomic DNA. Translation: EAW65055.1.
CH471055 Genomic DNA. Translation: EAW65056.1.
BC012138 mRNA. Translation: AAH12138.1.
BC016995 mRNA. Translation: AAH16995.1.
X07854 Genomic DNA. Translation: CAA30703.1.
CCDSiCCDS2813.1. [P04899-1]
CCDS54587.1. [P04899-3]
CCDS63642.1. [P04899-5]
CCDS63644.1. [P04899-6]
PIRiS02319. RGHUI2.
RefSeqiNP_001159897.1. NM_001166425.1. [P04899-3]
NP_001269546.1. NM_001282617.1. [P04899-6]
NP_001269547.1. NM_001282618.1.
NP_001269548.1. NM_001282619.1. [P04899-2]
NP_001269549.1. NM_001282620.1. [P04899-5]
NP_002061.1. NM_002070.3. [P04899-1]
UniGeneiHs.77269.

Genome annotation databases

EnsembliENST00000266027; ENSP00000266027; ENSG00000114353. [P04899-6]
ENST00000313601; ENSP00000312999; ENSG00000114353. [P04899-1]
ENST00000422163; ENSP00000406871; ENSG00000114353. [P04899-5]
ENST00000440628; ENSP00000395736; ENSG00000114353. [P04899-6]
ENST00000451956; ENSP00000406369; ENSG00000114353. [P04899-3]
GeneIDi2771.
KEGGihsa:2771.
UCSCiuc003cyo.1. human. [P04899-2]
uc003cyp.1. human.
uc003cyq.1. human. [P04899-1]
uc011bdn.2. human. [P04899-3]

Polymorphism databases

DMDMi121023.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X04828 mRNA. Translation: CAA28512.1 .
J03004 mRNA. Translation: AAA52556.1 . Sequence problems.
M20593
, M20586 , M20587 , M20588 , M20589 , M20590 , M20591 , M20592 Genomic DNA. Translation: AAA35894.1 .
AY677118 mRNA. Translation: AAT78421.1 .
AF493906 mRNA. Translation: AAM12620.1 .
AK096299 mRNA. Translation: BAG53252.1 .
AK096595 mRNA. Translation: BAG53334.1 .
AK302330 mRNA. Translation: BAG63662.1 .
AK304473 mRNA. Translation: BAG65287.1 .
AC002077 Genomic DNA. No translation available.
U73166 Genomic DNA. No translation available.
U73169 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW65053.1 .
CH471055 Genomic DNA. Translation: EAW65055.1 .
CH471055 Genomic DNA. Translation: EAW65056.1 .
BC012138 mRNA. Translation: AAH12138.1 .
BC016995 mRNA. Translation: AAH16995.1 .
X07854 Genomic DNA. Translation: CAA30703.1 .
CCDSi CCDS2813.1. [P04899-1 ]
CCDS54587.1. [P04899-3 ]
CCDS63642.1. [P04899-5 ]
CCDS63644.1. [P04899-6 ]
PIRi S02319. RGHUI2.
RefSeqi NP_001159897.1. NM_001166425.1. [P04899-3 ]
NP_001269546.1. NM_001282617.1. [P04899-6 ]
NP_001269547.1. NM_001282618.1.
NP_001269548.1. NM_001282619.1. [P04899-2 ]
NP_001269549.1. NM_001282620.1. [P04899-5 ]
NP_002061.1. NM_002070.3. [P04899-1 ]
UniGenei Hs.77269.

3D structure databases

ProteinModelPortali P04899.
SMRi P04899. Positions 5-354.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109033. 94 interactions.
DIPi DIP-602N.
IntActi P04899. 24 interactions.
MINTi MINT-7901704.
STRINGi 9606.ENSP00000312999.

PTM databases

PhosphoSitei P04899.

Polymorphism databases

DMDMi 121023.

Proteomic databases

MaxQBi P04899.
PaxDbi P04899.
PRIDEi P04899.

Protocols and materials databases

DNASUi 2771.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000266027 ; ENSP00000266027 ; ENSG00000114353 . [P04899-6 ]
ENST00000313601 ; ENSP00000312999 ; ENSG00000114353 . [P04899-1 ]
ENST00000422163 ; ENSP00000406871 ; ENSG00000114353 . [P04899-5 ]
ENST00000440628 ; ENSP00000395736 ; ENSG00000114353 . [P04899-6 ]
ENST00000451956 ; ENSP00000406369 ; ENSG00000114353 . [P04899-3 ]
GeneIDi 2771.
KEGGi hsa:2771.
UCSCi uc003cyo.1. human. [P04899-2 ]
uc003cyp.1. human.
uc003cyq.1. human. [P04899-1 ]
uc011bdn.2. human. [P04899-3 ]

Organism-specific databases

CTDi 2771.
GeneCardsi GC03P050263.
H-InvDB HIX0003320.
HGNCi HGNC:4385. GNAI2.
HPAi HPA007704.
MIMi 139360. gene.
neXtProti NX_P04899.
PharmGKBi PA24347.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG322962.
GeneTreei ENSGT00760000118851.
HOGENOMi HOG000038730.
HOVERGENi HBG063184.
InParanoidi P04899.
KOi K04630.
OMAi EYAGANK.
OrthoDBi EOG72C50B.
PhylomeDBi P04899.
TreeFami TF300673.

Enzyme and pathway databases

Reactomei REACT_15333. Adenylate cyclase inhibitory pathway.
REACT_15426. PLC beta mediated events.
REACT_15457. G-protein activation.
REACT_18325. Regulation of insulin secretion.
REACT_18339. Adrenaline,noradrenaline inhibits insulin secretion.
REACT_19231. G alpha (i) signalling events.
REACT_19327. G alpha (s) signalling events.
REACT_19333. G alpha (z) signalling events.
REACT_20653. ADP signalling through P2Y purinoceptor 12.
SignaLinki P04899.

Miscellaneous databases

ChiTaRSi GNAI2. human.
GeneWikii GNAI2.
GenomeRNAii 2771.
NextBioi 10900.
PROi P04899.
SOURCEi Search...

Gene expression databases

Bgeei P04899.
CleanExi HS_GNAI2.
ExpressionAtlasi P04899. baseline and differential.
Genevestigatori P04899.

Family and domain databases

Gene3Di 1.10.400.10. 1 hit.
3.40.50.300. 2 hits.
InterProi IPR001408. Gprotein_alpha_I.
IPR001019. Gprotein_alpha_su.
IPR011025. GproteinA_insert.
IPR027417. P-loop_NTPase.
[Graphical view ]
PANTHERi PTHR10218. PTHR10218. 1 hit.
Pfami PF00503. G-alpha. 1 hit.
[Graphical view ]
PRINTSi PR00318. GPROTEINA.
PR00441. GPROTEINAI.
SMARTi SM00275. G_alpha. 1 hit.
[Graphical view ]
SUPFAMi SSF47895. SSF47895. 1 hit.
SSF52540. SSF52540. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human Gi protein alpha-subunit: deduction of amino acid structure from a cloned cDNA."
    Didsbury J.R., Ho Y.-S., Snyderman R.
    FEBS Lett. 211:160-164(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "A small multigene family encodes Gi signal-transduction proteins."
    Beals C.R., Wilson C.B., Perlmutter R.M.
    Proc. Natl. Acad. Sci. U.S.A. 84:7886-7890(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. "Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs."
    Itoh H., Toyama R., Kozasa T., Tsukamoto T., Matsuoka M., Kaziro Y.
    J. Biol. Chem. 263:6656-6664(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "Role of a Galphai2 protein splice variant in the formation of an intracellular dopamine D2 receptor pool."
    Lopez-Aranda M.F., Acevedo M.J., Gutierrez A., Koulen P., Khan Z.U.
    J. Cell Sci. 120:2171-2178(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SGI2), FUNCTION.
    Tissue: Brain.
  5. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Puhl H.L. III, Ikeda S.R., Aronstam R.S.
    Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 5 AND 6).
    Tissue: Brain, Teratocarcinoma, Testis and Uterus.
  7. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Kidney and Mammary gland.
  10. "Cloning and characterization of the human gene for the alpha-subunit of Gi2, a GTP-binding signal transduction protein."
    Weinstein L.S., Spiegel A.M., Carter A.D.
    FEBS Lett. 232:333-340(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-39.
  11. "Modulation of G(ialpha(2)) signaling by the axonal guidance molecule UNC5H2."
    Komatsuzaki K., Dalvin S., Kinane T.B.
    Biochem. Biophys. Res. Commun. 297:898-905(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH UNC5B.
  12. "Localization of Gi alpha proteins in the centrosomes and at the midbody: implication for their role in cell division."
    Cho H., Kehrl J.H.
    J. Cell Biol. 178:245-255(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiGNAI2_HUMAN
AccessioniPrimary (citable) accession number: P04899
Secondary accession number(s): B3KTZ0
, B4DYA0, B4E2X5, Q6B6N3, Q8IZ71
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 13, 1987
Last sequence update: January 23, 2007
Last modified: October 29, 2014
This is version 170 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3