Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P04899

- GNAI2_HUMAN

UniProt

P04899 - GNAI2_HUMAN

Protein

Guanine nucleotide-binding protein G(i) subunit alpha-2

Gene

GNAI2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 169 (01 Oct 2014)
      Sequence version 3 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. May play a role in cell division.
    Isoform sGi2: Regulates the cell surface density of dopamine receptors DRD2 by sequestrating them as an intracellular pool.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi47 – 471MagnesiumBy similarity
    Metal bindingi182 – 1821MagnesiumBy similarity
    Binding sitei327 – 3271GTP; via amide nitrogenBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi40 – 478GTPBy similarity
    Nucleotide bindingi176 – 1827GTPBy similarity
    Nucleotide bindingi201 – 2055GTPBy similarity
    Nucleotide bindingi270 – 2734GTPBy similarity

    GO - Molecular functioni

    1. G-protein beta/gamma-subunit complex binding Source: RefGenome
    2. G-protein coupled receptor binding Source: RefGenome
    3. GTPase activity Source: RefGenome
    4. GTP binding Source: UniProtKB-KW
    5. metal ion binding Source: UniProtKB-KW
    6. protein binding Source: IntAct
    7. signal transducer activity Source: RefGenome

    GO - Biological processi

    1. activation of MAPKK activity Source: Ensembl
    2. adenosine receptor signaling pathway Source: RefGenome
    3. adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway Source: RefGenome
    4. blood coagulation Source: Reactome
    5. cell cycle Source: UniProtKB-KW
    6. cell division Source: UniProtKB
    7. cell proliferation Source: Ensembl
    8. gamma-aminobutyric acid signaling pathway Source: RefGenome
    9. G-protein coupled acetylcholine receptor signaling pathway Source: Ensembl
    10. G-protein coupled receptor signaling pathway Source: ProtInc
    11. negative regulation of adenylate cyclase activity Source: ProtInc
    12. negative regulation of synaptic transmission Source: Ensembl
    13. platelet activation Source: Reactome
    14. positive regulation of cell proliferation Source: Ensembl
    15. regulation of calcium ion transport Source: Ensembl
    16. response to nutrient Source: ProtInc
    17. signal transduction Source: ProtInc
    18. synaptic transmission Source: Reactome

    Keywords - Molecular functioni

    Transducer

    Keywords - Biological processi

    Cell cycle, Cell division

    Keywords - Ligandi

    GTP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_15333. Adenylate cyclase inhibitory pathway.
    REACT_15426. PLC beta mediated events.
    REACT_15457. G-protein activation.
    REACT_18325. Regulation of insulin secretion.
    REACT_18339. Adrenaline,noradrenaline inhibits insulin secretion.
    REACT_19231. G alpha (i) signalling events.
    REACT_19327. G alpha (s) signalling events.
    REACT_19333. G alpha (z) signalling events.
    REACT_20653. ADP signalling through P2Y purinoceptor 12.
    SignaLinkiP04899.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Guanine nucleotide-binding protein G(i) subunit alpha-2
    Alternative name(s):
    Adenylate cyclase-inhibiting G alpha protein
    Gene namesi
    Name:GNAI2
    Synonyms:GNAI2B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:4385. GNAI2.

    Subcellular locationi

    Cytoplasm 1 Publication. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 1 Publication. Cell membrane 1 Publication
    Note: Localizes in the centrosomes of interphase and mitotic cells. Detected at the cleavage furrow and/or the midbody.

    GO - Cellular componenti

    1. centrosome Source: UniProtKB
    2. cytoplasm Source: UniProtKB
    3. cytosol Source: Ensembl
    4. extracellular vesicular exosome Source: UniProt
    5. heterotrimeric G-protein complex Source: RefGenome
    6. membrane Source: UniProtKB
    7. membrane raft Source: Ensembl
    8. midbody Source: UniProtKB
    9. nucleus Source: HPA
    10. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24347.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedCurated
    Chaini2 – 355354Guanine nucleotide-binding protein G(i) subunit alpha-2PRO_0000203679Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi2 – 21N-myristoyl glycineCurated
    Lipidationi3 – 31S-palmitoyl cysteineBy similarity
    Modified residuei179 – 1791ADP-ribosylarginine; by cholera toxinBy similarity
    Modified residuei352 – 3521ADP-ribosylcysteine; by pertussis toxinBy similarity

    Keywords - PTMi

    ADP-ribosylation, Lipoprotein, Myristate, Palmitate

    Proteomic databases

    MaxQBiP04899.
    PaxDbiP04899.
    PRIDEiP04899.

    PTM databases

    PhosphoSiteiP04899.

    Expressioni

    Gene expression databases

    ArrayExpressiP04899.
    BgeeiP04899.
    CleanExiHS_GNAI2.
    GenevestigatoriP04899.

    Organism-specific databases

    HPAiHPA007704.

    Interactioni

    Subunit structurei

    G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site. Interacts with GPSM1. Interacts with RGS12 and RGS14 By similarity. Interacts with UNC5B.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CXCR5P323025EBI-353997,EBI-2835269
    MDFIQ997502EBI-353997,EBI-724076
    NCF1P145982EBI-353997,EBI-395044
    NCF2P198784EBI-353997,EBI-489611

    Protein-protein interaction databases

    BioGridi109033. 68 interactions.
    DIPiDIP-602N.
    IntActiP04899. 24 interactions.
    MINTiMINT-7901704.
    STRINGi9606.ENSP00000312999.

    Structurei

    3D structure databases

    ProteinModelPortaliP04899.
    SMRiP04899. Positions 5-354.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the G-alpha family. G(i/o/t/z) subfamily.Curated

    Phylogenomic databases

    eggNOGiNOG322962.
    HOGENOMiHOG000038730.
    HOVERGENiHBG063184.
    InParanoidiP04899.
    KOiK04630.
    OMAiEYAGANK.
    OrthoDBiEOG72C50B.
    PhylomeDBiP04899.
    TreeFamiTF300673.

    Family and domain databases

    Gene3Di1.10.400.10. 1 hit.
    3.40.50.300. 2 hits.
    InterProiIPR001408. Gprotein_alpha_I.
    IPR001019. Gprotein_alpha_su.
    IPR011025. GproteinA_insert.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PANTHERiPTHR10218. PTHR10218. 1 hit.
    PfamiPF00503. G-alpha. 1 hit.
    [Graphical view]
    PRINTSiPR00318. GPROTEINA.
    PR00441. GPROTEINAI.
    SMARTiSM00275. G_alpha. 1 hit.
    [Graphical view]
    SUPFAMiSSF47895. SSF47895. 1 hit.
    SSF52540. SSF52540. 2 hits.

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P04899-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGCTVSAEDK AAAERSKMID KNLREDGEKA AREVKLLLLG AGESGKSTIV    50
    KQMKIIHEDG YSEEECRQYR AVVYSNTIQS IMAIVKAMGN LQIDFADPSR 100
    ADDARQLFAL SCTAEEQGVL PDDLSGVIRR LWADHGVQAC FGRSREYQLN 150
    DSAAYYLNDL ERIAQSDYIP TQQDVLRTRV KTTGIVETHF TFKDLHFKMF 200
    DVGGQRSERK KWIHCFEGVT AIIFCVALSA YDLVLAEDEE MNRMHESMKL 250
    FDSICNNKWF TDTSIILFLN KKDLFEEKIT HSPLTICFPE YTGANKYDEA 300
    ASYIQSKFED LNKRKDTKEI YTHFTCATDT KNVQFVFDAV TDVIIKNNLK 350
    DCGLF 355
    Length:355
    Mass (Da):40,451
    Last modified:January 23, 2007 - v3
    Checksum:iBE6D6FF720CF3DCC
    GO
    Isoform 2 (identifier: P04899-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MEYAGHLPASSAQGTILACTSCT

    Show »
    Length:339
    Mass (Da):38,473
    Checksum:iF14AB734881535C5
    GO
    Isoform 3 (identifier: P04899-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MR

    Note: No experimental confirmation available.

    Show »
    Length:318
    Mass (Da):36,465
    Checksum:iA0131D7E46EC5370
    GO
    Isoform sGi2 (identifier: P04899-4) [UniParc]FASTAAdd to Basket

    Also known as: sGalphai2

    The sequence of this isoform differs from the canonical sequence as follows:
         332-355: NVQFVFDAVTDVIIKNNLKDCGLF → SRKLFRETYLKLSGPDQHPHPSPAPAPPLSSDSVP

    Show »
    Length:366
    Mass (Da):41,548
    Checksum:iEF7FED14C8A0A8B4
    GO
    Isoform 5 (identifier: P04899-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MTEGVKTLGWTKQKGGCHWGRSE

    Note: No experimental confirmation available.

    Show »
    Length:339
    Mass (Da):38,737
    Checksum:iBFCDD8678696698F
    GO
    Isoform 6 (identifier: P04899-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:303
    Mass (Da):34,935
    Checksum:i9E676EE9177E166C
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5252Missing in isoform 6. 1 PublicationVSP_054788Add
    BLAST
    Alternative sequencei1 – 3939MGCTV…KLLLL → MEYAGHLPASSAQGTILACT SCT in isoform 2. 1 PublicationVSP_017497Add
    BLAST
    Alternative sequencei1 – 3939MGCTV…KLLLL → MR in isoform 3. 1 PublicationVSP_043473Add
    BLAST
    Alternative sequencei1 – 3939MGCTV…KLLLL → MTEGVKTLGWTKQKGGCHWG RSE in isoform 5. 1 PublicationVSP_054789Add
    BLAST
    Alternative sequencei332 – 35524NVQFV…DCGLF → SRKLFRETYLKLSGPDQHPH PSPAPAPPLSSDSVP in isoform sGi2. 1 PublicationVSP_043903Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X04828 mRNA. Translation: CAA28512.1.
    J03004 mRNA. Translation: AAA52556.1. Sequence problems.
    M20593
    , M20586, M20587, M20588, M20589, M20590, M20591, M20592 Genomic DNA. Translation: AAA35894.1.
    AY677118 mRNA. Translation: AAT78421.1.
    AF493906 mRNA. Translation: AAM12620.1.
    AK096299 mRNA. Translation: BAG53252.1.
    AK096595 mRNA. Translation: BAG53334.1.
    AK302330 mRNA. Translation: BAG63662.1.
    AK304473 mRNA. Translation: BAG65287.1.
    AC002077 Genomic DNA. No translation available.
    U73166 Genomic DNA. No translation available.
    U73169 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW65053.1.
    CH471055 Genomic DNA. Translation: EAW65055.1.
    CH471055 Genomic DNA. Translation: EAW65056.1.
    BC012138 mRNA. Translation: AAH12138.1.
    BC016995 mRNA. Translation: AAH16995.1.
    X07854 Genomic DNA. Translation: CAA30703.1.
    CCDSiCCDS2813.1. [P04899-1]
    CCDS54587.1. [P04899-3]
    CCDS63642.1. [P04899-5]
    CCDS63644.1. [P04899-6]
    PIRiS02319. RGHUI2.
    RefSeqiNP_001159897.1. NM_001166425.1. [P04899-3]
    NP_001269546.1. NM_001282617.1. [P04899-6]
    NP_001269547.1. NM_001282618.1.
    NP_001269548.1. NM_001282619.1. [P04899-2]
    NP_001269549.1. NM_001282620.1. [P04899-5]
    NP_002061.1. NM_002070.3. [P04899-1]
    UniGeneiHs.77269.

    Genome annotation databases

    EnsembliENST00000266027; ENSP00000266027; ENSG00000114353. [P04899-2]
    ENST00000313601; ENSP00000312999; ENSG00000114353. [P04899-1]
    ENST00000422163; ENSP00000406871; ENSG00000114353. [P04899-5]
    ENST00000440628; ENSP00000395736; ENSG00000114353. [P04899-6]
    ENST00000451956; ENSP00000406369; ENSG00000114353. [P04899-3]
    GeneIDi2771.
    KEGGihsa:2771.
    UCSCiuc003cyo.1. human. [P04899-2]
    uc003cyp.1. human.
    uc003cyq.1. human. [P04899-1]
    uc011bdn.2. human. [P04899-3]

    Polymorphism databases

    DMDMi121023.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X04828 mRNA. Translation: CAA28512.1 .
    J03004 mRNA. Translation: AAA52556.1 . Sequence problems.
    M20593
    , M20586 , M20587 , M20588 , M20589 , M20590 , M20591 , M20592 Genomic DNA. Translation: AAA35894.1 .
    AY677118 mRNA. Translation: AAT78421.1 .
    AF493906 mRNA. Translation: AAM12620.1 .
    AK096299 mRNA. Translation: BAG53252.1 .
    AK096595 mRNA. Translation: BAG53334.1 .
    AK302330 mRNA. Translation: BAG63662.1 .
    AK304473 mRNA. Translation: BAG65287.1 .
    AC002077 Genomic DNA. No translation available.
    U73166 Genomic DNA. No translation available.
    U73169 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW65053.1 .
    CH471055 Genomic DNA. Translation: EAW65055.1 .
    CH471055 Genomic DNA. Translation: EAW65056.1 .
    BC012138 mRNA. Translation: AAH12138.1 .
    BC016995 mRNA. Translation: AAH16995.1 .
    X07854 Genomic DNA. Translation: CAA30703.1 .
    CCDSi CCDS2813.1. [P04899-1 ]
    CCDS54587.1. [P04899-3 ]
    CCDS63642.1. [P04899-5 ]
    CCDS63644.1. [P04899-6 ]
    PIRi S02319. RGHUI2.
    RefSeqi NP_001159897.1. NM_001166425.1. [P04899-3 ]
    NP_001269546.1. NM_001282617.1. [P04899-6 ]
    NP_001269547.1. NM_001282618.1.
    NP_001269548.1. NM_001282619.1. [P04899-2 ]
    NP_001269549.1. NM_001282620.1. [P04899-5 ]
    NP_002061.1. NM_002070.3. [P04899-1 ]
    UniGenei Hs.77269.

    3D structure databases

    ProteinModelPortali P04899.
    SMRi P04899. Positions 5-354.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109033. 68 interactions.
    DIPi DIP-602N.
    IntActi P04899. 24 interactions.
    MINTi MINT-7901704.
    STRINGi 9606.ENSP00000312999.

    PTM databases

    PhosphoSitei P04899.

    Polymorphism databases

    DMDMi 121023.

    Proteomic databases

    MaxQBi P04899.
    PaxDbi P04899.
    PRIDEi P04899.

    Protocols and materials databases

    DNASUi 2771.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000266027 ; ENSP00000266027 ; ENSG00000114353 . [P04899-2 ]
    ENST00000313601 ; ENSP00000312999 ; ENSG00000114353 . [P04899-1 ]
    ENST00000422163 ; ENSP00000406871 ; ENSG00000114353 . [P04899-5 ]
    ENST00000440628 ; ENSP00000395736 ; ENSG00000114353 . [P04899-6 ]
    ENST00000451956 ; ENSP00000406369 ; ENSG00000114353 . [P04899-3 ]
    GeneIDi 2771.
    KEGGi hsa:2771.
    UCSCi uc003cyo.1. human. [P04899-2 ]
    uc003cyp.1. human.
    uc003cyq.1. human. [P04899-1 ]
    uc011bdn.2. human. [P04899-3 ]

    Organism-specific databases

    CTDi 2771.
    GeneCardsi GC03P050263.
    H-InvDB HIX0003320.
    HGNCi HGNC:4385. GNAI2.
    HPAi HPA007704.
    MIMi 139360. gene.
    neXtProti NX_P04899.
    PharmGKBi PA24347.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG322962.
    HOGENOMi HOG000038730.
    HOVERGENi HBG063184.
    InParanoidi P04899.
    KOi K04630.
    OMAi EYAGANK.
    OrthoDBi EOG72C50B.
    PhylomeDBi P04899.
    TreeFami TF300673.

    Enzyme and pathway databases

    Reactomei REACT_15333. Adenylate cyclase inhibitory pathway.
    REACT_15426. PLC beta mediated events.
    REACT_15457. G-protein activation.
    REACT_18325. Regulation of insulin secretion.
    REACT_18339. Adrenaline,noradrenaline inhibits insulin secretion.
    REACT_19231. G alpha (i) signalling events.
    REACT_19327. G alpha (s) signalling events.
    REACT_19333. G alpha (z) signalling events.
    REACT_20653. ADP signalling through P2Y purinoceptor 12.
    SignaLinki P04899.

    Miscellaneous databases

    ChiTaRSi GNAI2. human.
    GeneWikii GNAI2.
    GenomeRNAii 2771.
    NextBioi 10900.
    PROi P04899.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P04899.
    Bgeei P04899.
    CleanExi HS_GNAI2.
    Genevestigatori P04899.

    Family and domain databases

    Gene3Di 1.10.400.10. 1 hit.
    3.40.50.300. 2 hits.
    InterProi IPR001408. Gprotein_alpha_I.
    IPR001019. Gprotein_alpha_su.
    IPR011025. GproteinA_insert.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    PANTHERi PTHR10218. PTHR10218. 1 hit.
    Pfami PF00503. G-alpha. 1 hit.
    [Graphical view ]
    PRINTSi PR00318. GPROTEINA.
    PR00441. GPROTEINAI.
    SMARTi SM00275. G_alpha. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47895. SSF47895. 1 hit.
    SSF52540. SSF52540. 2 hits.
    ProtoNeti Search...

    Publicationsi

    1. "Human Gi protein alpha-subunit: deduction of amino acid structure from a cloned cDNA."
      Didsbury J.R., Ho Y.-S., Snyderman R.
      FEBS Lett. 211:160-164(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "A small multigene family encodes Gi signal-transduction proteins."
      Beals C.R., Wilson C.B., Perlmutter R.M.
      Proc. Natl. Acad. Sci. U.S.A. 84:7886-7890(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs."
      Itoh H., Toyama R., Kozasa T., Tsukamoto T., Matsuoka M., Kaziro Y.
      J. Biol. Chem. 263:6656-6664(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "Role of a Galphai2 protein splice variant in the formation of an intracellular dopamine D2 receptor pool."
      Lopez-Aranda M.F., Acevedo M.J., Gutierrez A., Koulen P., Khan Z.U.
      J. Cell Sci. 120:2171-2178(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SGI2), FUNCTION.
      Tissue: Brain.
    5. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Puhl H.L. III, Ikeda S.R., Aronstam R.S.
      Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 5 AND 6).
      Tissue: Brain, Teratocarcinoma, Testis and Uterus.
    7. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Kidney and Mammary gland.
    10. "Cloning and characterization of the human gene for the alpha-subunit of Gi2, a GTP-binding signal transduction protein."
      Weinstein L.S., Spiegel A.M., Carter A.D.
      FEBS Lett. 232:333-340(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-39.
    11. "Modulation of G(ialpha(2)) signaling by the axonal guidance molecule UNC5H2."
      Komatsuzaki K., Dalvin S., Kinane T.B.
      Biochem. Biophys. Res. Commun. 297:898-905(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH UNC5B.
    12. "Localization of Gi alpha proteins in the centrosomes and at the midbody: implication for their role in cell division."
      Cho H., Kehrl J.H.
      J. Cell Biol. 178:245-255(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiGNAI2_HUMAN
    AccessioniPrimary (citable) accession number: P04899
    Secondary accession number(s): B3KTZ0
    , B4DYA0, B4E2X5, Q6B6N3, Q8IZ71
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 13, 1987
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 169 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3