Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Guanine nucleotide-binding protein G(i) subunit alpha-2

Gene

GNAI2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. May play a role in cell division.1 Publication
Isoform sGi2: Regulates the cell surface density of dopamine receptors DRD2 by sequestrating them as an intracellular pool.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi47MagnesiumBy similarity1
Metal bindingi182MagnesiumBy similarity1
Binding sitei327GTP; via amide nitrogenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi40 – 47GTPBy similarity8
Nucleotide bindingi176 – 182GTPBy similarity7
Nucleotide bindingi201 – 205GTPBy similarity5
Nucleotide bindingi270 – 273GTPBy similarity4

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransducer
Biological processCell cycle, Cell division
LigandGTP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-112043 PLC beta mediated events
R-HSA-170670 Adenylate cyclase inhibitory pathway
R-HSA-202040 G-protein activation
R-HSA-392170 ADP signalling through P2Y purinoceptor 12
R-HSA-400042 Adrenaline,noradrenaline inhibits insulin secretion
R-HSA-418555 G alpha (s) signalling events
R-HSA-418594 G alpha (i) signalling events
R-HSA-418597 G alpha (z) signalling events
R-HSA-422356 Regulation of insulin secretion
R-HSA-6814122 Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
SignaLinkiP04899
SIGNORiP04899

Names & Taxonomyi

Protein namesi
Recommended name:
Guanine nucleotide-binding protein G(i) subunit alpha-2
Alternative name(s):
Adenylate cyclase-inhibiting G alpha protein
Gene namesi
Name:GNAI2
Synonyms:GNAI2B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114353.16
HGNCiHGNC:4385 GNAI2
MIMi139360 gene
neXtProtiNX_P04899

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi2771
MalaCardsiGNAI2
OpenTargetsiENSG00000114353
PharmGKBiPA24347

Polymorphism and mutation databases

DMDMi121023

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources3 Publications
ChainiPRO_00002036792 – 355Guanine nucleotide-binding protein G(i) subunit alpha-2Add BLAST354

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycine3 Publications1
Lipidationi3S-palmitoyl cysteineBy similarity1
Modified residuei179ADP-ribosylarginine; by cholera toxinBy similarity1
Modified residuei205Deamidated glutamine; by Photorhabdus PAU_022301 Publication1
Modified residuei352ADP-ribosylcysteine; by pertussis toxinBy similarity1

Post-translational modificationi

(Microbial infection) Deamidated at Gln-205 by Photorhabdus asymbiotica toxin PAU_02230, blocking GTP hydrolysis of heterotrimeric GNAQ or GNA11 and G-alphai (GNAI1, GNAI2 or GNAI3) proteins, thereby activating RhoA.1 Publication

Keywords - PTMi

ADP-ribosylation, Lipoprotein, Myristate, Palmitate

Proteomic databases

EPDiP04899
MaxQBiP04899
PaxDbiP04899
PeptideAtlasiP04899
PRIDEiP04899

PTM databases

iPTMnetiP04899
PhosphoSitePlusiP04899
SwissPalmiP04899

Expressioni

Gene expression databases

BgeeiENSG00000114353
CleanExiHS_GNAI2
ExpressionAtlasiP04899 baseline and differential
GenevisibleiP04899 HS

Organism-specific databases

HPAiHPA007704

Interactioni

Subunit structurei

G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site. Interacts with GPSM1. Interacts with RGS12 and RGS14 (By similarity). Interacts with UNC5B.By similarity1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109033, 121 interactors
CORUMiP04899
DIPiDIP-602N
IntActiP04899, 48 interactors
MINTiP04899
STRINGi9606.ENSP00000312999

Structurei

3D structure databases

ProteinModelPortaliP04899
SMRiP04899
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-alpha family. G(i/o/t/z) subfamily.Curated

Phylogenomic databases

eggNOGiKOG0082 Eukaryota
ENOG410XNVQ LUCA
GeneTreeiENSGT00760000118851
HOGENOMiHOG000038730
HOVERGENiHBG063184
InParanoidiP04899
KOiK04630
OMAiEQGIMPD
OrthoDBiEOG091G0VUT
PhylomeDBiP04899
TreeFamiTF300673

Family and domain databases

CDDicd00066 G-alpha, 1 hit
Gene3Di1.10.400.10, 1 hit
InterProiView protein in InterPro
IPR001408 Gprotein_alpha_I
IPR001019 Gprotein_alpha_su
IPR011025 GproteinA_insert
IPR027417 P-loop_NTPase
PANTHERiPTHR10218 PTHR10218, 1 hit
PfamiView protein in Pfam
PF00503 G-alpha, 1 hit
PRINTSiPR00318 GPROTEINA
PR00441 GPROTEINAI
SMARTiView protein in SMART
SM00275 G_alpha, 1 hit
SUPFAMiSSF47895 SSF47895, 1 hit
SSF52540 SSF52540, 2 hits

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P04899-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCTVSAEDK AAAERSKMID KNLREDGEKA AREVKLLLLG AGESGKSTIV
60 70 80 90 100
KQMKIIHEDG YSEEECRQYR AVVYSNTIQS IMAIVKAMGN LQIDFADPSR
110 120 130 140 150
ADDARQLFAL SCTAEEQGVL PDDLSGVIRR LWADHGVQAC FGRSREYQLN
160 170 180 190 200
DSAAYYLNDL ERIAQSDYIP TQQDVLRTRV KTTGIVETHF TFKDLHFKMF
210 220 230 240 250
DVGGQRSERK KWIHCFEGVT AIIFCVALSA YDLVLAEDEE MNRMHESMKL
260 270 280 290 300
FDSICNNKWF TDTSIILFLN KKDLFEEKIT HSPLTICFPE YTGANKYDEA
310 320 330 340 350
ASYIQSKFED LNKRKDTKEI YTHFTCATDT KNVQFVFDAV TDVIIKNNLK

DCGLF
Length:355
Mass (Da):40,451
Last modified:January 23, 2007 - v3
Checksum:iBE6D6FF720CF3DCC
GO
Isoform 2 (identifier: P04899-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MEYAGHLPASSAQGTILACTSCT

Show »
Length:339
Mass (Da):38,473
Checksum:iF14AB734881535C5
GO
Isoform 3 (identifier: P04899-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MR

Note: No experimental confirmation available.
Show »
Length:318
Mass (Da):36,465
Checksum:iA0131D7E46EC5370
GO
Isoform sGi2 (identifier: P04899-4) [UniParc]FASTAAdd to basket
Also known as: sGalphai2

The sequence of this isoform differs from the canonical sequence as follows:
     332-355: NVQFVFDAVTDVIIKNNLKDCGLF → SRKLFRETYLKLSGPDQHPHPSPAPAPPLSSDSVP

Show »
Length:366
Mass (Da):41,548
Checksum:iEF7FED14C8A0A8B4
GO
Isoform 5 (identifier: P04899-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLL → MTEGVKTLGWTKQKGGCHWGRSE

Note: No experimental confirmation available.
Show »
Length:339
Mass (Da):38,737
Checksum:iBFCDD8678696698F
GO
Isoform 6 (identifier: P04899-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Note: No experimental confirmation available.
Show »
Length:303
Mass (Da):34,935
Checksum:i9E676EE9177E166C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0547881 – 52Missing in isoform 6. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_0174971 – 39MGCTV…KLLLL → MEYAGHLPASSAQGTILACT SCT in isoform 2. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_0434731 – 39MGCTV…KLLLL → MR in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_0547891 – 39MGCTV…KLLLL → MTEGVKTLGWTKQKGGCHWG RSE in isoform 5. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_043903332 – 355NVQFV…DCGLF → SRKLFRETYLKLSGPDQHPH PSPAPAPPLSSDSVP in isoform sGi2. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X04828 mRNA Translation: CAA28512.1
J03004 mRNA Translation: AAA52556.1 Sequence problems.
M20593
, M20586, M20587, M20588, M20589, M20590, M20591, M20592 Genomic DNA Translation: AAA35894.1
AY677118 mRNA Translation: AAT78421.1
AF493906 mRNA Translation: AAM12620.1
AK096299 mRNA Translation: BAG53252.1
AK096595 mRNA Translation: BAG53334.1
AK302330 mRNA Translation: BAG63662.1
AK304473 mRNA Translation: BAG65287.1
AC002077 Genomic DNA No translation available.
U73166 Genomic DNA No translation available.
U73169 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW65053.1
CH471055 Genomic DNA Translation: EAW65055.1
CH471055 Genomic DNA Translation: EAW65056.1
BC012138 mRNA Translation: AAH12138.1
BC016995 mRNA Translation: AAH16995.1
X07854 Genomic DNA Translation: CAA30703.1
CCDSiCCDS2813.1 [P04899-1]
CCDS54587.1 [P04899-3]
CCDS63642.1 [P04899-5]
CCDS63644.1 [P04899-6]
PIRiS02319 RGHUI2
RefSeqiNP_001159897.1, NM_001166425.1 [P04899-3]
NP_001269546.1, NM_001282617.1 [P04899-6]
NP_001269547.1, NM_001282618.1
NP_001269548.1, NM_001282619.1 [P04899-2]
NP_001269549.1, NM_001282620.1 [P04899-5]
NP_002061.1, NM_002070.3 [P04899-1]
UniGeneiHs.77269

Genome annotation databases

EnsembliENST00000266027; ENSP00000266027; ENSG00000114353 [P04899-6]
ENST00000313601; ENSP00000312999; ENSG00000114353 [P04899-1]
ENST00000422163; ENSP00000406871; ENSG00000114353 [P04899-5]
ENST00000440628; ENSP00000395736; ENSG00000114353 [P04899-6]
ENST00000451956; ENSP00000406369; ENSG00000114353 [P04899-3]
GeneIDi2771
KEGGihsa:2771
UCSCiuc003cyp.3 human [P04899-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiGNAI2_HUMAN
AccessioniPrimary (citable) accession number: P04899
Secondary accession number(s): B3KTZ0
, B4DYA0, B4E2X5, Q6B6N3, Q8IZ71
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 13, 1987
Last sequence update: January 23, 2007
Last modified: May 23, 2018
This is version 206 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health