Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P04554 (PRM2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 124. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protamine-2
Alternative name(s):
Sperm histone P2
Sperm protamine P2

Cleaved into the following 7 chains:

  1. Basic nuclear protein HPI1
  2. Basic nuclear protein HPI2
  3. Basic nuclear protein HPS1
  4. Basic nuclear protein HPS2
  5. Sperm histone HP4
    Alternative name(s):
    Sperm protamine P4
  6. Sperm histone HP2
    Alternative name(s):
    Sperm protamine P2
    Short name=P2'
  7. Sperm histone HP3
    Alternative name(s):
    P2''
    Sperm protamine P3
Gene names
Name:PRM2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length102 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex.

Subcellular location

Nucleus. Chromosome.

Tissue specificity

Testis.

Sequence similarities

Belongs to the protamine P2 family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P04554-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P04554-2)

The sequence of this isoform differs from the canonical sequence as follows:
     91-102: GCRTRKRTCRRH → ESLGDPLNQNFLSQKAAEPGREHAEGTKLPGPLTPSWKLRKSRPKHQVRP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain2 – 102101Basic nuclear protein HPI1
PRO_0000025758
Chain22 – 10281Basic nuclear protein HPI2
PRO_0000025759
Chain34 – 10269Basic nuclear protein HPS1
PRO_0000025760
Chain37 – 10266Basic nuclear protein HPS2
PRO_0000025761
Chain45 – 10258Sperm histone HP4
PRO_0000025762
Chain46 – 10257Sperm histone HP2
PRO_0000025763
Chain49 – 10254Sperm histone HP3
PRO_0000025764

Natural variations

Alternative sequence91 – 10212GCRTR…TCRRH → ESLGDPLNQNFLSQKAAEPG REHAEGTKLPGPLTPSWKLR KSRPKHQVRP in isoform 2.
VSP_054786

Experimental info

Sequence conflict38 – 392PE → RM in CAA30710. Ref.1
Sequence conflict521H → Q in CAA30710. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1990. Version 3.
Checksum: CBB8D6F2396F2F9C

FASTA10213,051
        10         20         30         40         50         60 
MVRYRVRSLS ERSHEVYRQQ LHGQEQGHHG QEEQGLSPEH VEVYERTHGQ SHYRRRHCSR 

        70         80         90        100 
RRLHRIHRRQ HRSCRRRKRR SCRHRRRHRR GCRTRKRTCR RH 

« Hide

Isoform 2 [UniParc].

Checksum: 03F307A0349E84F7
Show »

FASTA14017,106

References

« Hide 'large scale' references
[1]"Sequence of human protamine 2 cDNA."
Domenjoud L., Fronia C., Uhde F., Engel W.
Nucleic Acids Res. 16:7733-7733(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Testis.
[2]"Genomic sequences of human protamines whose genes, PRM1 and PRM2, are clustered."
Domenjoud L., Nussbaum G., Adham I.M., Greeske G., Engel W.
Genomics 8:127-133(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3]"Characterization of a human locus in transition."
Nelson J.E., Krawetz S.A.
J. Biol. Chem. 269:31067-31073(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[4]"Rapid evolution of male reproductive genes in the descent of man."
Wyckoff G.J., Wang W., Wu C.-I.
Nature 403:304-309(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[6]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain and Testis.
[8]"Molecular characterization of nuclear basic protein HPI1, a putative precursor of human sperm protamines HP2 and HP3."
Martinage A., Arkhis A., Alimi E., Sautiere P., Chevaillier P.
Eur. J. Biochem. 191:449-451(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 2-102 (HPI1).
Tissue: Sperm.
[9]"Amino acid sequence of the human intermediate basic protein 2 (HPI2) from sperm nuclei. Structural relationship with protamine P2."
Alimi E., Martinage A., Arkhis A., Belaiche D., Sautiere P., Chevaillier P.
Eur. J. Biochem. 214:445-450(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 22-102 (HPI2).
[10]"Comparison of the amino acid sequences of human protamines HP2 and HP3 and of intermediate basic nuclear proteins HPS1 and HPS2. Structural evidence that HPS1 and HPS2 are pro-protamines."
Sautiere P., Martinage A., Belaiche D., Arkhis A., Chevaillier P.
J. Biol. Chem. 263:11059-11063(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 34-102 (HPS1 AND HPS2).
Tissue: Sperm.
[11]"Isolation and amino-acid sequence analysis of human sperm protamines P1 and P2. Occurrence of two forms of protamine P2."
Ammer H., Henschen A., Lee C.-H.
Biol. Chem. Hoppe-Seyler 367:515-522(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 46-102 (HP2 AND HP3).
Tissue: Sperm.
[12]"Human sperm protamines. Amino-acid sequences of two forms of protamine P2."
McKay D.J., Renaux B.S., Dixon G.H.
Eur. J. Biochem. 156:5-8(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 46-102 (P2B).
Tissue: Sperm.
[13]"Molecular structure of human protamine P4 (HP4), a minor basic protein of human sperm nuclei."
Arkhis A., Martinage A., Sautiere P., Chevaillier P.
Eur. J. Biochem. 200:387-392(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 45-102 (HP4).
Tissue: Sperm.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X07862 mRNA. Translation: CAA30710.1.
M60332 Genomic DNA. Translation: AAA63250.1.
Z46940 Genomic DNA. Translation: CAA87066.1.
U15422 Genomic DNA. Translation: AAC50487.1.
AF215713 Genomic DNA. Translation: AAF34632.1.
AK131573 mRNA. Translation: BAD18705.1.
AC009121 Genomic DNA. No translation available.
BC005303 mRNA. Translation: AAH05303.1.
BC066338 mRNA. Translation: AAH66338.1.
CCDSCCDS42118.1.
PIRHSHUP2. B38515.
RefSeqNP_001273285.1. NM_001286356.1. [P04554-2]
NP_001273287.1. NM_001286358.1.
NP_001273288.1. NM_001286359.1.
NP_002753.2. NM_002762.3. [P04554-1]
UniGeneHs.2324.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2AWRmodel-B46-102[»]
ProteinModelPortalP04554.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000241808.

PTM databases

PhosphoSiteP04554.

Polymorphism databases

DMDM123700.

Proteomic databases

PRIDEP04554.

Protocols and materials databases

DNASU5620.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000241808; ENSP00000241808; ENSG00000122304.
ENST00000435245; ENSP00000403681; ENSG00000122304.
GeneID5620.
KEGGhsa:5620.
UCSCuc002dau.1. human. [P04554-1]

Organism-specific databases

CTD5620.
GeneCardsGC16M011369.
HGNCHGNC:9448. PRM2.
HPACAB032738.
HPA056386.
MIM182882. gene.
182890. gene.
neXtProtNX_P04554.
PharmGKBPA33793.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG44137.
HOGENOMHOG000143619.
HOVERGENHBG082177.
InParanoidP04554.
OrthoDBEOG7SXW6X.
TreeFamTF338206.

Gene expression databases

ArrayExpressP04554.
BgeeP04554.
CleanExHS_PRM2.
GenevestigatorP04554.

Family and domain databases

InterProIPR000492. Protamine_P2.
[Graphical view]
PANTHERPTHR21341. PTHR21341. 1 hit.
PfamPF00841. Protamine_P2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi5620.
NextBio21840.
PROP04554.
SOURCESearch...

Entry information

Entry namePRM2_HUMAN
AccessionPrimary (citable) accession number: P04554
Secondary accession number(s): Q6ZMM0
Entry history
Integrated into UniProtKB/Swiss-Prot: August 13, 1987
Last sequence update: November 1, 1990
Last modified: July 9, 2014
This is version 124 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM