SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P04554

- PRM2_HUMAN

UniProt

P04554 - PRM2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protamine-2
Gene
PRM2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex.

GO - Molecular functioni

  1. DNA binding Source: ProtInc
Complete GO annotation...

GO - Biological processi

  1. DNA packaging Source: ProtInc
  2. cell differentiation Source: UniProtKB-KW
  3. chromosome condensation Source: UniProtKB-KW
  4. multicellular organismal development Source: UniProtKB-KW
  5. spermatogenesis Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, DNA condensation, Spermatogenesis

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protamine-2
Alternative name(s):
Sperm histone P2
Sperm protamine P2
Cleaved into the following 7 chains:
Alternative name(s):
Sperm protamine P4
Alternative name(s):
Sperm protamine P2
Short name:
P2'
Alternative name(s):
P2''
Sperm protamine P3
Gene namesi
Name:PRM2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:9448. PRM2.

Subcellular locationi

GO - Cellular componenti

  1. nucleoplasm Source: ProtInc
  2. nucleosome Source: UniProtKB-KW
  3. nucleus Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleosome core, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33793.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini2 – 102101Basic nuclear protein HPI1
PRO_0000025758Add
BLAST
Chaini22 – 10281Basic nuclear protein HPI2
PRO_0000025759Add
BLAST
Chaini34 – 10269Basic nuclear protein HPS1
PRO_0000025760Add
BLAST
Chaini37 – 10266Basic nuclear protein HPS2
PRO_0000025761Add
BLAST
Chaini45 – 10258Sperm histone HP4
PRO_0000025762Add
BLAST
Chaini46 – 10257Sperm histone HP2
PRO_0000025763Add
BLAST
Chaini49 – 10254Sperm histone HP3
PRO_0000025764Add
BLAST

Proteomic databases

PRIDEiP04554.

PTM databases

PhosphoSiteiP04554.

Expressioni

Tissue specificityi

Testis.

Gene expression databases

ArrayExpressiP04554.
BgeeiP04554.
CleanExiHS_PRM2.
GenevestigatoriP04554.

Organism-specific databases

HPAiCAB032738.
HPA056386.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000241808.

Structurei

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2AWRmodel-B46-102[»]
ProteinModelPortaliP04554.

Family & Domainsi

Sequence similaritiesi

Belongs to the protamine P2 family.

Phylogenomic databases

eggNOGiNOG44137.
HOGENOMiHOG000143619.
HOVERGENiHBG082177.
InParanoidiP04554.
OrthoDBiEOG7SXW6X.
TreeFamiTF338206.

Family and domain databases

InterProiIPR000492. Protamine_P2.
[Graphical view]
PANTHERiPTHR21341. PTHR21341. 1 hit.
PfamiPF00841. Protamine_P2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P04554-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVRYRVRSLS ERSHEVYRQQ LHGQEQGHHG QEEQGLSPEH VEVYERTHGQ    50
SHYRRRHCSR RRLHRIHRRQ HRSCRRRKRR SCRHRRRHRR GCRTRKRTCR 100
RH 102
Length:102
Mass (Da):13,051
Last modified:November 1, 1990 - v3
Checksum:iCBB8D6F2396F2F9C
GO
Isoform 2 (identifier: P04554-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-102: GCRTRKRTCRRH → ESLGDPLNQNFLSQKAAEPGREHAEGTKLPGPLTPSWKLRKSRPKHQVRP

Note: No experimental confirmation available.

Show »
Length:140
Mass (Da):17,106
Checksum:i03F307A0349E84F7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei91 – 10212GCRTR…TCRRH → ESLGDPLNQNFLSQKAAEPG REHAEGTKLPGPLTPSWKLR KSRPKHQVRP in isoform 2.
VSP_054786Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti38 – 392PE → RM in CAA30710. 1 Publication
Sequence conflicti52 – 521H → Q in CAA30710. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X07862 mRNA. Translation: CAA30710.1.
M60332 Genomic DNA. Translation: AAA63250.1.
Z46940 Genomic DNA. Translation: CAA87066.1.
U15422 Genomic DNA. Translation: AAC50487.1.
AF215713 Genomic DNA. Translation: AAF34632.1.
AK131573 mRNA. Translation: BAD18705.1.
AC009121 Genomic DNA. No translation available.
BC005303 mRNA. Translation: AAH05303.1.
BC066338 mRNA. Translation: AAH66338.1.
CCDSiCCDS42118.1. [P04554-1]
CCDS66944.1. [P04554-2]
PIRiB38515. HSHUP2.
RefSeqiNP_001273285.1. NM_001286356.1. [P04554-2]
NP_001273287.1. NM_001286358.1.
NP_001273288.1. NM_001286359.1.
NP_002753.2. NM_002762.3. [P04554-1]
UniGeneiHs.2324.

Genome annotation databases

EnsembliENST00000241808; ENSP00000241808; ENSG00000122304.
ENST00000435245; ENSP00000403681; ENSG00000122304.
GeneIDi5620.
KEGGihsa:5620.
UCSCiuc002dau.1. human. [P04554-1]

Polymorphism databases

DMDMi123700.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X07862 mRNA. Translation: CAA30710.1 .
M60332 Genomic DNA. Translation: AAA63250.1 .
Z46940 Genomic DNA. Translation: CAA87066.1 .
U15422 Genomic DNA. Translation: AAC50487.1 .
AF215713 Genomic DNA. Translation: AAF34632.1 .
AK131573 mRNA. Translation: BAD18705.1 .
AC009121 Genomic DNA. No translation available.
BC005303 mRNA. Translation: AAH05303.1 .
BC066338 mRNA. Translation: AAH66338.1 .
CCDSi CCDS42118.1. [P04554-1 ]
CCDS66944.1. [P04554-2 ]
PIRi B38515. HSHUP2.
RefSeqi NP_001273285.1. NM_001286356.1. [P04554-2 ]
NP_001273287.1. NM_001286358.1.
NP_001273288.1. NM_001286359.1.
NP_002753.2. NM_002762.3. [P04554-1 ]
UniGenei Hs.2324.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2AWR model - B 46-102 [» ]
ProteinModelPortali P04554.
ModBasei Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000241808.

PTM databases

PhosphoSitei P04554.

Polymorphism databases

DMDMi 123700.

Proteomic databases

PRIDEi P04554.

Protocols and materials databases

DNASUi 5620.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000241808 ; ENSP00000241808 ; ENSG00000122304 .
ENST00000435245 ; ENSP00000403681 ; ENSG00000122304 .
GeneIDi 5620.
KEGGi hsa:5620.
UCSCi uc002dau.1. human. [P04554-1 ]

Organism-specific databases

CTDi 5620.
GeneCardsi GC16M011369.
HGNCi HGNC:9448. PRM2.
HPAi CAB032738.
HPA056386.
MIMi 182882. gene.
182890. gene.
neXtProti NX_P04554.
PharmGKBi PA33793.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44137.
HOGENOMi HOG000143619.
HOVERGENi HBG082177.
InParanoidi P04554.
OrthoDBi EOG7SXW6X.
TreeFami TF338206.

Miscellaneous databases

GenomeRNAii 5620.
NextBioi 21840.
PROi P04554.
SOURCEi Search...

Gene expression databases

ArrayExpressi P04554.
Bgeei P04554.
CleanExi HS_PRM2.
Genevestigatori P04554.

Family and domain databases

InterProi IPR000492. Protamine_P2.
[Graphical view ]
PANTHERi PTHR21341. PTHR21341. 1 hit.
Pfami PF00841. Protamine_P2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Genomic sequences of human protamines whose genes, PRM1 and PRM2, are clustered."
    Domenjoud L., Nussbaum G., Adham I.M., Greeske G., Engel W.
    Genomics 8:127-133(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. "Characterization of a human locus in transition."
    Nelson J.E., Krawetz S.A.
    J. Biol. Chem. 269:31067-31073(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "Rapid evolution of male reproductive genes in the descent of man."
    Wyckoff G.J., Wang W., Wu C.-I.
    Nature 403:304-309(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  6. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain and Testis.
  8. "Molecular characterization of nuclear basic protein HPI1, a putative precursor of human sperm protamines HP2 and HP3."
    Martinage A., Arkhis A., Alimi E., Sautiere P., Chevaillier P.
    Eur. J. Biochem. 191:449-451(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 2-102 (HPI1).
    Tissue: Sperm.
  9. "Amino acid sequence of the human intermediate basic protein 2 (HPI2) from sperm nuclei. Structural relationship with protamine P2."
    Alimi E., Martinage A., Arkhis A., Belaiche D., Sautiere P., Chevaillier P.
    Eur. J. Biochem. 214:445-450(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 22-102 (HPI2).
  10. "Comparison of the amino acid sequences of human protamines HP2 and HP3 and of intermediate basic nuclear proteins HPS1 and HPS2. Structural evidence that HPS1 and HPS2 are pro-protamines."
    Sautiere P., Martinage A., Belaiche D., Arkhis A., Chevaillier P.
    J. Biol. Chem. 263:11059-11063(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 34-102 (HPS1 AND HPS2).
    Tissue: Sperm.
  11. "Isolation and amino-acid sequence analysis of human sperm protamines P1 and P2. Occurrence of two forms of protamine P2."
    Ammer H., Henschen A., Lee C.-H.
    Biol. Chem. Hoppe-Seyler 367:515-522(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 46-102 (HP2 AND HP3).
    Tissue: Sperm.
  12. "Human sperm protamines. Amino-acid sequences of two forms of protamine P2."
    McKay D.J., Renaux B.S., Dixon G.H.
    Eur. J. Biochem. 156:5-8(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 46-102 (P2B).
    Tissue: Sperm.
  13. "Molecular structure of human protamine P4 (HP4), a minor basic protein of human sperm nuclei."
    Arkhis A., Martinage A., Sautiere P., Chevaillier P.
    Eur. J. Biochem. 200:387-392(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 45-102 (HP4).
    Tissue: Sperm.

Entry informationi

Entry nameiPRM2_HUMAN
AccessioniPrimary (citable) accession number: P04554
Secondary accession number(s): Q6ZMM0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 13, 1987
Last sequence update: November 1, 1990
Last modified: September 3, 2014
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi