Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protamine-2

Gene

PRM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex.

GO - Molecular functioni

  • DNA binding Source: ProtInc

GO - Biological processi

  • chromosome condensation Source: GO_Central
  • DNA packaging Source: ProtInc
  • multicellular organism development Source: UniProtKB-KW
  • nucleus organization Source: GO_Central
  • spermatid development Source: GO_Central
  • spermatogenesis Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, DNA condensation, Spermatogenesis

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122304-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protamine-2
Alternative name(s):
Sperm histone P2
Sperm protamine P2
Cleaved into the following 7 chains:
Alternative name(s):
Sperm protamine P4
Alternative name(s):
Sperm protamine P2
Short name:
P2'
Alternative name(s):
P2''
Sperm protamine P3
Gene namesi
Name:PRM2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:9448. PRM2.

Subcellular locationi

GO - Cellular componenti

  • nucleoplasm Source: ProtInc
  • nucleosome Source: UniProtKB-KW
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleosome core, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5620.
OpenTargetsiENSG00000122304.
PharmGKBiPA33793.

Polymorphism and mutation databases

DMDMi123700.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000257582 – 102Basic nuclear protein HPI1Add BLAST101
ChainiPRO_000002575922 – 102Basic nuclear protein HPI2Add BLAST81
ChainiPRO_000002576034 – 102Basic nuclear protein HPS1Add BLAST69
ChainiPRO_000002576137 – 102Basic nuclear protein HPS2Add BLAST66
ChainiPRO_000002576245 – 102Sperm histone HP4Add BLAST58
ChainiPRO_000002576346 – 102Sperm histone HP2Add BLAST57
ChainiPRO_000002576449 – 102Sperm histone HP3Add BLAST54

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei8PhosphoserineBy similarity1
Modified residuei10PhosphoserineBy similarity1
Modified residuei37PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP04554.
PeptideAtlasiP04554.
PRIDEiP04554.

PTM databases

iPTMnetiP04554.
PhosphoSitePlusiP04554.

Expressioni

Tissue specificityi

Testis.

Gene expression databases

BgeeiENSG00000122304.
CleanExiHS_PRM2.
ExpressionAtlasiP04554. baseline and differential.
GenevisibleiP04554. HS.

Organism-specific databases

HPAiCAB032738.
HPA056386.

Interactioni

Protein-protein interaction databases

BioGridi111605. 2 interactors.
IntActiP04554. 4 interactors.
STRINGi9606.ENSP00000241808.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AWRmodel-B46-102[»]
ProteinModelPortaliP04554.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the protamine P2 family.Curated

Phylogenomic databases

eggNOGiENOG410KFYE. Eukaryota.
ENOG4110SVE. LUCA.
GeneTreeiENSGT00730000111973.
HOGENOMiHOG000143619.
HOVERGENiHBG082177.
InParanoidiP04554.
OMAiHVEVYER.
OrthoDBiEOG091G15QZ.
TreeFamiTF338206.

Family and domain databases

InterProiIPR000492. PRM2.
[Graphical view]
PANTHERiPTHR21341. PTHR21341. 1 hit.
PfamiPF00841. Protamine_P2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P04554-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRYRVRSLS ERSHEVYRQQ LHGQEQGHHG QEEQGLSPEH VEVYERTHGQ
60 70 80 90 100
SHYRRRHCSR RRLHRIHRRQ HRSCRRRKRR SCRHRRRHRR GCRTRKRTCR

RH
Length:102
Mass (Da):13,051
Last modified:November 1, 1990 - v3
Checksum:iCBB8D6F2396F2F9C
GO
Isoform 2 (identifier: P04554-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-102: GCRTRKRTCRRH → ESLGDPLNQNFLSQKAAEPGREHAEGTKLPGPLTPSWKLRKSRPKHQVRP

Note: No experimental confirmation available.
Show »
Length:140
Mass (Da):17,106
Checksum:i03F307A0349E84F7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti38 – 39PE → RM in CAA30710 (PubMed:3412906).Curated2
Sequence conflicti52H → Q in CAA30710 (PubMed:3412906).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05478691 – 102GCRTR…TCRRH → ESLGDPLNQNFLSQKAAEPG REHAEGTKLPGPLTPSWKLR KSRPKHQVRP in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07862 mRNA. Translation: CAA30710.1.
M60332 Genomic DNA. Translation: AAA63250.1.
Z46940 Genomic DNA. Translation: CAA87066.1.
U15422 Genomic DNA. Translation: AAC50487.1.
AF215713 Genomic DNA. Translation: AAF34632.1.
AK131573 mRNA. Translation: BAD18705.1.
AC009121 Genomic DNA. No translation available.
BC005303 mRNA. Translation: AAH05303.1.
BC066338 mRNA. Translation: AAH66338.1.
CCDSiCCDS42118.1. [P04554-1]
CCDS66944.1. [P04554-2]
PIRiB38515. HSHUP2.
RefSeqiNP_001273285.1. NM_001286356.1. [P04554-2]
NP_001273287.1. NM_001286358.1.
NP_001273288.1. NM_001286359.1.
NP_002753.2. NM_002762.3. [P04554-1]
UniGeneiHs.2324.

Genome annotation databases

EnsembliENST00000241808; ENSP00000241808; ENSG00000122304. [P04554-1]
ENST00000435245; ENSP00000403681; ENSG00000122304. [P04554-2]
GeneIDi5620.
KEGGihsa:5620.
UCSCiuc032drg.2. human. [P04554-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07862 mRNA. Translation: CAA30710.1.
M60332 Genomic DNA. Translation: AAA63250.1.
Z46940 Genomic DNA. Translation: CAA87066.1.
U15422 Genomic DNA. Translation: AAC50487.1.
AF215713 Genomic DNA. Translation: AAF34632.1.
AK131573 mRNA. Translation: BAD18705.1.
AC009121 Genomic DNA. No translation available.
BC005303 mRNA. Translation: AAH05303.1.
BC066338 mRNA. Translation: AAH66338.1.
CCDSiCCDS42118.1. [P04554-1]
CCDS66944.1. [P04554-2]
PIRiB38515. HSHUP2.
RefSeqiNP_001273285.1. NM_001286356.1. [P04554-2]
NP_001273287.1. NM_001286358.1.
NP_001273288.1. NM_001286359.1.
NP_002753.2. NM_002762.3. [P04554-1]
UniGeneiHs.2324.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AWRmodel-B46-102[»]
ProteinModelPortaliP04554.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111605. 2 interactors.
IntActiP04554. 4 interactors.
STRINGi9606.ENSP00000241808.

PTM databases

iPTMnetiP04554.
PhosphoSitePlusiP04554.

Polymorphism and mutation databases

DMDMi123700.

Proteomic databases

PaxDbiP04554.
PeptideAtlasiP04554.
PRIDEiP04554.

Protocols and materials databases

DNASUi5620.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000241808; ENSP00000241808; ENSG00000122304. [P04554-1]
ENST00000435245; ENSP00000403681; ENSG00000122304. [P04554-2]
GeneIDi5620.
KEGGihsa:5620.
UCSCiuc032drg.2. human. [P04554-1]

Organism-specific databases

CTDi5620.
DisGeNETi5620.
GeneCardsiPRM2.
HGNCiHGNC:9448. PRM2.
HPAiCAB032738.
HPA056386.
MIMi182882. gene.
182890. gene.
neXtProtiNX_P04554.
OpenTargetsiENSG00000122304.
PharmGKBiPA33793.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410KFYE. Eukaryota.
ENOG4110SVE. LUCA.
GeneTreeiENSGT00730000111973.
HOGENOMiHOG000143619.
HOVERGENiHBG082177.
InParanoidiP04554.
OMAiHVEVYER.
OrthoDBiEOG091G15QZ.
TreeFamiTF338206.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122304-MONOMER.

Miscellaneous databases

GenomeRNAii5620.
PROiP04554.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122304.
CleanExiHS_PRM2.
ExpressionAtlasiP04554. baseline and differential.
GenevisibleiP04554. HS.

Family and domain databases

InterProiIPR000492. PRM2.
[Graphical view]
PANTHERiPTHR21341. PTHR21341. 1 hit.
PfamiPF00841. Protamine_P2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPRM2_HUMAN
AccessioniPrimary (citable) accession number: P04554
Secondary accession number(s): Q6ZMM0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 13, 1987
Last sequence update: November 1, 1990
Last modified: November 30, 2016
This is version 143 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.