Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P04554

- PRM2_HUMAN

UniProt

P04554 - PRM2_HUMAN

Protein

Protamine-2

Gene

PRM2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex.

    GO - Molecular functioni

    1. DNA binding Source: ProtInc

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. chromosome condensation Source: UniProtKB-KW
    3. DNA packaging Source: ProtInc
    4. multicellular organismal development Source: UniProtKB-KW
    5. spermatogenesis Source: ProtInc

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, DNA condensation, Spermatogenesis

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protamine-2
    Alternative name(s):
    Sperm histone P2
    Sperm protamine P2
    Cleaved into the following 7 chains:
    Alternative name(s):
    Sperm protamine P4
    Alternative name(s):
    Sperm protamine P2
    Short name:
    P2'
    Alternative name(s):
    P2''
    Sperm protamine P3
    Gene namesi
    Name:PRM2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:9448. PRM2.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleoplasm Source: ProtInc
    2. nucleosome Source: UniProtKB-KW
    3. nucleus Source: UniProt

    Keywords - Cellular componenti

    Chromosome, Nucleosome core, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33793.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini2 – 102101Basic nuclear protein HPI1PRO_0000025758Add
    BLAST
    Chaini22 – 10281Basic nuclear protein HPI2PRO_0000025759Add
    BLAST
    Chaini34 – 10269Basic nuclear protein HPS1PRO_0000025760Add
    BLAST
    Chaini37 – 10266Basic nuclear protein HPS2PRO_0000025761Add
    BLAST
    Chaini45 – 10258Sperm histone HP4PRO_0000025762Add
    BLAST
    Chaini46 – 10257Sperm histone HP2PRO_0000025763Add
    BLAST
    Chaini49 – 10254Sperm histone HP3PRO_0000025764Add
    BLAST

    Proteomic databases

    PRIDEiP04554.

    PTM databases

    PhosphoSiteiP04554.

    Expressioni

    Tissue specificityi

    Testis.

    Gene expression databases

    ArrayExpressiP04554.
    BgeeiP04554.
    CleanExiHS_PRM2.
    GenevestigatoriP04554.

    Organism-specific databases

    HPAiCAB032738.
    HPA056386.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000241808.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2AWRmodel-B46-102[»]
    ProteinModelPortaliP04554.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the protamine P2 family.Curated

    Phylogenomic databases

    eggNOGiNOG44137.
    HOGENOMiHOG000143619.
    HOVERGENiHBG082177.
    InParanoidiP04554.
    OrthoDBiEOG7SXW6X.
    TreeFamiTF338206.

    Family and domain databases

    InterProiIPR000492. Protamine_P2.
    [Graphical view]
    PANTHERiPTHR21341. PTHR21341. 1 hit.
    PfamiPF00841. Protamine_P2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P04554-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVRYRVRSLS ERSHEVYRQQ LHGQEQGHHG QEEQGLSPEH VEVYERTHGQ    50
    SHYRRRHCSR RRLHRIHRRQ HRSCRRRKRR SCRHRRRHRR GCRTRKRTCR 100
    RH 102
    Length:102
    Mass (Da):13,051
    Last modified:November 1, 1990 - v3
    Checksum:iCBB8D6F2396F2F9C
    GO
    Isoform 2 (identifier: P04554-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         91-102: GCRTRKRTCRRH → ESLGDPLNQNFLSQKAAEPGREHAEGTKLPGPLTPSWKLRKSRPKHQVRP

    Note: No experimental confirmation available.

    Show »
    Length:140
    Mass (Da):17,106
    Checksum:i03F307A0349E84F7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti38 – 392PE → RM in CAA30710. (PubMed:3412906)Curated
    Sequence conflicti52 – 521H → Q in CAA30710. (PubMed:3412906)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei91 – 10212GCRTR…TCRRH → ESLGDPLNQNFLSQKAAEPG REHAEGTKLPGPLTPSWKLR KSRPKHQVRP in isoform 2. 1 PublicationVSP_054786Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X07862 mRNA. Translation: CAA30710.1.
    M60332 Genomic DNA. Translation: AAA63250.1.
    Z46940 Genomic DNA. Translation: CAA87066.1.
    U15422 Genomic DNA. Translation: AAC50487.1.
    AF215713 Genomic DNA. Translation: AAF34632.1.
    AK131573 mRNA. Translation: BAD18705.1.
    AC009121 Genomic DNA. No translation available.
    BC005303 mRNA. Translation: AAH05303.1.
    BC066338 mRNA. Translation: AAH66338.1.
    CCDSiCCDS42118.1. [P04554-1]
    CCDS66944.1. [P04554-2]
    PIRiB38515. HSHUP2.
    RefSeqiNP_001273285.1. NM_001286356.1. [P04554-2]
    NP_001273287.1. NM_001286358.1.
    NP_001273288.1. NM_001286359.1.
    NP_002753.2. NM_002762.3. [P04554-1]
    UniGeneiHs.2324.

    Genome annotation databases

    EnsembliENST00000241808; ENSP00000241808; ENSG00000122304. [P04554-1]
    ENST00000435245; ENSP00000403681; ENSG00000122304. [P04554-2]
    GeneIDi5620.
    KEGGihsa:5620.
    UCSCiuc002dau.1. human. [P04554-1]

    Polymorphism databases

    DMDMi123700.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X07862 mRNA. Translation: CAA30710.1 .
    M60332 Genomic DNA. Translation: AAA63250.1 .
    Z46940 Genomic DNA. Translation: CAA87066.1 .
    U15422 Genomic DNA. Translation: AAC50487.1 .
    AF215713 Genomic DNA. Translation: AAF34632.1 .
    AK131573 mRNA. Translation: BAD18705.1 .
    AC009121 Genomic DNA. No translation available.
    BC005303 mRNA. Translation: AAH05303.1 .
    BC066338 mRNA. Translation: AAH66338.1 .
    CCDSi CCDS42118.1. [P04554-1 ]
    CCDS66944.1. [P04554-2 ]
    PIRi B38515. HSHUP2.
    RefSeqi NP_001273285.1. NM_001286356.1. [P04554-2 ]
    NP_001273287.1. NM_001286358.1.
    NP_001273288.1. NM_001286359.1.
    NP_002753.2. NM_002762.3. [P04554-1 ]
    UniGenei Hs.2324.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2AWR model - B 46-102 [» ]
    ProteinModelPortali P04554.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000241808.

    PTM databases

    PhosphoSitei P04554.

    Polymorphism databases

    DMDMi 123700.

    Proteomic databases

    PRIDEi P04554.

    Protocols and materials databases

    DNASUi 5620.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000241808 ; ENSP00000241808 ; ENSG00000122304 . [P04554-1 ]
    ENST00000435245 ; ENSP00000403681 ; ENSG00000122304 . [P04554-2 ]
    GeneIDi 5620.
    KEGGi hsa:5620.
    UCSCi uc002dau.1. human. [P04554-1 ]

    Organism-specific databases

    CTDi 5620.
    GeneCardsi GC16M011369.
    HGNCi HGNC:9448. PRM2.
    HPAi CAB032738.
    HPA056386.
    MIMi 182882. gene.
    182890. gene.
    neXtProti NX_P04554.
    PharmGKBi PA33793.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG44137.
    HOGENOMi HOG000143619.
    HOVERGENi HBG082177.
    InParanoidi P04554.
    OrthoDBi EOG7SXW6X.
    TreeFami TF338206.

    Miscellaneous databases

    GenomeRNAii 5620.
    NextBioi 21840.
    PROi P04554.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P04554.
    Bgeei P04554.
    CleanExi HS_PRM2.
    Genevestigatori P04554.

    Family and domain databases

    InterProi IPR000492. Protamine_P2.
    [Graphical view ]
    PANTHERi PTHR21341. PTHR21341. 1 hit.
    Pfami PF00841. Protamine_P2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Testis.
    2. "Genomic sequences of human protamines whose genes, PRM1 and PRM2, are clustered."
      Domenjoud L., Nussbaum G., Adham I.M., Greeske G., Engel W.
      Genomics 8:127-133(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Characterization of a human locus in transition."
      Nelson J.E., Krawetz S.A.
      J. Biol. Chem. 269:31067-31073(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "Rapid evolution of male reproductive genes in the descent of man."
      Wyckoff G.J., Wang W., Wu C.-I.
      Nature 403:304-309(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    6. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain and Testis.
    8. "Molecular characterization of nuclear basic protein HPI1, a putative precursor of human sperm protamines HP2 and HP3."
      Martinage A., Arkhis A., Alimi E., Sautiere P., Chevaillier P.
      Eur. J. Biochem. 191:449-451(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 2-102 (HPI1).
      Tissue: Sperm.
    9. "Amino acid sequence of the human intermediate basic protein 2 (HPI2) from sperm nuclei. Structural relationship with protamine P2."
      Alimi E., Martinage A., Arkhis A., Belaiche D., Sautiere P., Chevaillier P.
      Eur. J. Biochem. 214:445-450(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 22-102 (HPI2).
    10. "Comparison of the amino acid sequences of human protamines HP2 and HP3 and of intermediate basic nuclear proteins HPS1 and HPS2. Structural evidence that HPS1 and HPS2 are pro-protamines."
      Sautiere P., Martinage A., Belaiche D., Arkhis A., Chevaillier P.
      J. Biol. Chem. 263:11059-11063(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 34-102 (HPS1 AND HPS2).
      Tissue: Sperm.
    11. "Isolation and amino-acid sequence analysis of human sperm protamines P1 and P2. Occurrence of two forms of protamine P2."
      Ammer H., Henschen A., Lee C.-H.
      Biol. Chem. Hoppe-Seyler 367:515-522(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 46-102 (HP2 AND HP3).
      Tissue: Sperm.
    12. "Human sperm protamines. Amino-acid sequences of two forms of protamine P2."
      McKay D.J., Renaux B.S., Dixon G.H.
      Eur. J. Biochem. 156:5-8(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 46-102 (P2B).
      Tissue: Sperm.
    13. "Molecular structure of human protamine P4 (HP4), a minor basic protein of human sperm nuclei."
      Arkhis A., Martinage A., Sautiere P., Chevaillier P.
      Eur. J. Biochem. 200:387-392(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 45-102 (HP4).
      Tissue: Sperm.

    Entry informationi

    Entry nameiPRM2_HUMAN
    AccessioniPrimary (citable) accession number: P04554
    Secondary accession number(s): Q6ZMM0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 13, 1987
    Last sequence update: November 1, 1990
    Last modified: October 1, 2014
    This is version 126 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3