Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P04370

- MBP_MOUSE

UniProt

P04370 - MBP_MOUSE

Protein

Myelin basic protein

Gene

Mbp

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 158 (01 Oct 2014)
      Sequence version 2 (18 Oct 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The classic group of MBP isoforms (isoform 4-isoform 13) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined to optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function.1 Publication

    GO - Molecular functioni

    1. protease binding Source: BHF-UCL
    2. structural constituent of myelin sheath Source: Ensembl

    GO - Biological processi

    1. membrane organization Source: MGI
    2. myelination Source: MGI
    3. negative regulation of axonogenesis Source: Ensembl
    4. response to toxic substance Source: MGI

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Myelin basic protein
    Short name:
    MBP
    Alternative name(s):
    Myelin A1 protein
    Gene namesi
    Name:Mbp
    Synonyms:Shi
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 18

    Organism-specific databases

    MGIiMGI:96925. Mbp.

    Subcellular locationi

    GO - Cellular componenti

    1. cell periphery Source: MGI
    2. cell projection Source: MGI
    3. compact myelin Source: Ensembl
    4. cytoplasm Source: UniProtKB-SubCell
    5. internode region of axon Source: MGI
    6. myelin sheath Source: MGI
    7. neuronal cell body Source: MGI
    8. nucleus Source: UniProtKB-SubCell
    9. plasma membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Defects in Mbp are a cause of dysmyelinating diseases such as the shiverer (SHI) and myelin deficient (MLD) diseases characterized by decreased myelination in the CNS, tremors, and convulsions of progressively increasing severity leading to early death. The shiverer mice only express isoform 2, the MLD mice have a reduced amount of Mbp.

    Keywords - Diseasei

    Autoimmune encephalomyelitis

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 250250Myelin basic proteinPRO_0000158991Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei141 – 1411PhosphoserineBy similarity
    Modified residuei157 – 1571CitrullineBy similarity
    Modified residuei163 – 1631CitrullineBy similarity
    Modified residuei167 – 1671Phosphothreonine1 Publication
    Modified residuei172 – 1721Phosphoserine1 Publication
    Modified residuei188 – 1881PhosphoserineBy similarity
    Modified residuei199 – 1991Phosphotyrosine1 Publication
    Modified residuei226 – 2261PhosphothreonineBy similarity
    Modified residuei229 – 2291Phosphothreonine1 Publication
    Modified residuei234 – 2341Deamidated glutamineBy similarity
    Modified residuei239 – 2391CitrullineBy similarity
    Modified residuei241 – 2411PhosphoserineBy similarity
    Modified residuei245 – 2451Phosphoserine; by UHMK1
    Modified residuei250 – 2501CitrullineBy similarity

    Post-translational modificationi

    As in other animals, several charge isomers may be produced as a result of optional post-translatonial modifications, such as phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues.3 Publications
    Methylated on arginine residues; decreases with the age of the animal, making MBP more cationic.
    Phosphorylated by TAOK2, VRK2, MAPK11, MAPK12, MAPK14 and MINK1.By similarity

    Keywords - PTMi

    Acetylation, Citrullination, Methylation, Phosphoprotein

    Proteomic databases

    MaxQBiP04370.
    PaxDbiP04370.
    PRIDEiP04370.

    PTM databases

    PhosphoSiteiP04370.

    Miscellaneous databases

    PMAP-CutDBP04370.

    Expressioni

    Tissue specificityi

    In the embryo, isoform 1-isoform 3 are found in neurons within the central nervous system (primarily in pioneer neurons important in the formation of the cortex) and the peripheral nervous system. They are also expressed in the thymus, gut, lung and kidney. In the adult, isoform 1-isoform 3 are highly expressed in the brain (mainly in brain regions rich in oligodendrocytes) and spleen. Lower levels are seen in the heart, kidney and lung. Isoform 2 is also found in cells of the immune system. The isoforms missing the 134 first amino acids (isoform 4-isoform 13) are almost exclusively produced in the myelin-forming cells, the mature oligodendrocytes.

    Developmental stagei

    The differential expression of MBP isoforms is developmentally regulated. Isoform 2 and isoform 3 are first expressed during embryonic stages (as early as at embryonic day 11.5), expression of isoform 1 is turned on shortly after birth. Expression of the isoforms missing the 134 first amino acids occurs later, presumably as the oligodendrocytes approach their terminally differentiated state.1 Publication

    Gene expression databases

    ArrayExpressiP04370.
    BgeeiP04370.
    CleanExiMM_MBP.
    GenevestigatoriP04370.

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Protein-protein interaction databases

    BioGridi201336. 42 interactions.
    IntActiP04370. 30 interactions.
    MINTiMINT-4101448.

    Structurei

    Secondary structure

    1
    250
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi209 – 2113
    Helixi216 – 22510
    Turni242 – 2443

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2LUGNMR-A206-245[»]
    DisProtiDP00237.
    ProteinModelPortaliP04370.
    SMRiP04370. Positions 206-237.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the myelin basic protein family.Curated

    Phylogenomic databases

    eggNOGiNOG75180.
    GeneTreeiENSGT00390000014772.
    HOVERGENiHBG008347.
    InParanoidiP04370.
    KOiK17269.
    OMAiCAERRGH.
    OrthoDBiEOG7M0NRZ.
    PhylomeDBiP04370.
    TreeFamiTF333391.

    Family and domain databases

    InterProiIPR000548. Myelin_BP.
    [Graphical view]
    PANTHERiPTHR11429. PTHR11429. 1 hit.
    PfamiPF01669. Myelin_MBP. 1 hit.
    [Graphical view]
    PRINTSiPR00212. MYELINMBP.
    PROSITEiPS00569. MYELIN_MBP. 1 hit.
    [Graphical view]

    Sequences (13)i

    Sequence statusi: Complete.

    This entry describes 13 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P04370-1) [UniParc]FASTAAdd to Basket

    Also known as: Golli-MBP1, J37

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGNHSGKREL SAEKASKDGE IHRGEAGKKR SVGKLSQTAS EDSDVFGEAD    50
    AIQNNGTSAE DTAVTDSKHT ADPKNNWQGA HPADPGNRPH LIRLFSRDAP 100
    GREDNTFKDR PSESDELQTI QEDPTAASGG LDVMASQKRP SQRSKYLATA 150
    STMDHARHGF LPRHRDTGIL DSIGRFFSGD RGAPKRGSGK DSHTRTTHYG 200
    SLPQKSQHGR TQDENPVVHF FKNIVTPRTP PPSQGKGGRD SRSGSPMARR 250
    Length:250
    Mass (Da):27,168
    Last modified:October 18, 2001 - v2
    Checksum:iB418ED11C27B0C43
    GO
    Isoform 2 (identifier: P04370-2) [UniParc]FASTAAdd to Basket

    Also known as: Golli-MBP2, BG21, HMBPR

    The sequence of this isoform differs from the canonical sequence as follows:
         191-250: DSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR → VSSEP

    Show »
    Length:195
    Mass (Da):21,004
    Checksum:i1C5C6AEFB561D2DA
    GO
    Isoform 3 (identifier: P04370-3) [UniParc]FASTAAdd to Basket

    Also known as: Golli-MBP3, TP8

    The sequence of this isoform differs from the canonical sequence as follows:
         48-250: EADAIQNNGT...SRSGSPMARR → LTHENYPLWLPAPEVAARPDPR

    Show »
    Length:69
    Mass (Da):7,498
    Checksum:i067EABB28D687D99
    GO
    Isoform 4 (identifier: P04370-4) [UniParc]FASTAAdd to Basket

    Also known as: 21.5-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
         236-236: K → KGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

    Note: Initiator Met-1 is removed (By similarity). Contains a N-acetylalanine at position 2 (By similarity). Contains a phosphothreonine at position 122. Contains a phosphoserine at position 139. Contains a phosphotyrosine at position 151.By similarity

    Show »
    Length:195
    Mass (Da):21,502
    Checksum:i4B57CA6F06C4AC7D
    GO
    Isoform 5 (identifier: P04370-5) [UniParc]FASTAAdd to Basket

    Also known as: 18.5-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         236-236: K → KGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

    Note: Initiator Met-1 is removed (By similarity). Contains a N-acetylalanine at position 2 (By similarity). Contains a phosphothreonine at position 96. Contains a phosphoserine at position 113. Contains a phosphotyrosine at position 125.By similarity

    Show »
    Length:169
    Mass (Da):18,488
    Checksum:iE609240A863F36CD
    GO
    Isoform 6 (identifier: P04370-6) [UniParc]FASTAAdd to Basket

    Also known as: 17-kDa-a

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
         236-236: K → KGRGLSLSRFSW

    Note: Initiator Met-1 is removed (By similarity). Contains a N-acetylalanine at position 2 (By similarity). Contains a phosphothreonine at position 122.By similarity

    Show »
    Length:154
    Mass (Da):17,225
    Checksum:i00F1F10ECF90421B
    GO
    Isoform 7 (identifier: P04370-7) [UniParc]FASTAAdd to Basket

    Also known as: 17-kDa-b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         236-236: K → KGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

    Note: Initiator Met-1 is removed. Contains a N-acetylalanine at position 2.By similarity

    Show »
    Length:158
    Mass (Da):17,240
    Checksum:i7AA39D2A263A2BF3
    GO
    Isoform 8 (identifier: P04370-8) [UniParc]FASTAAdd to Basket

    Also known as: 14-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         236-236: K → KGRGLSLSRFSW

    Note: Initiator Met-1 is removed (By similarity). Contains a N-acetylalanine at position 2 (By similarity). Contains a phosphothreonine at position 96.By similarity

    Show »
    Length:128
    Mass (Da):14,211
    Checksum:iE1DB77B2010455FB
    GO
    Isoform 9 (identifier: P04370-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
         236-236: K → KGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

    Note: Initiator Met-1 is removed. Contains a N-acetylalanine at position 2.By similarity

    Show »
    Length:184
    Mass (Da):20,255
    Checksum:iB7F672275771E3F4
    GO
    Isoform 10 (identifier: P04370-10) [UniParc]FASTAAdd to Basket

    Also known as: 21-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         236-236: K → KDFVPGDHHV...QGTLSKIFKL

    Note: Contains a phosphoserine at position 135. Contains a phosphotyrosine at position 147.

    Show »
    Length:191
    Mass (Da):20,814
    Checksum:iD986AA8B506E2AE9
    GO
    Isoform 11 (identifier: P04370-11) [UniParc]FASTAAdd to Basket

    Also known as: 19.7-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
         236-236: K → KDFVPGDHHVNVSVVTVSFSSSQGRGLSLSRFSW

    Show »
    Length:176
    Mass (Da):19,552
    Checksum:i159154971A58A0CF
    GO
    Isoform 12 (identifier: P04370-13) [UniParc]FASTAAdd to Basket

    Also known as: 15.6-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.
         190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK

    Show »
    Length:143
    Mass (Da):15,978
    Checksum:i932F8612537F93E2
    GO
    Isoform 13 (identifier: P04370-14) [UniParc]FASTAAdd to Basket

    Also known as: 13-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-133: Missing.

    Show »
    Length:117
    Mass (Da):12,963
    Checksum:i7FC65A7A1A8C7E53
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti204 – 2052QK → HN(PubMed:7681106)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 133133Missing in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13. 4 PublicationsVSP_003312Add
    BLAST
    Alternative sequencei48 – 250203EADAI…PMARR → LTHENYPLWLPAPEVAARPD PR in isoform 3. 1 PublicationVSP_003313Add
    BLAST
    Alternative sequencei190 – 1901K → KVPWLKQSRSPLPSHARSRP GLCHMYK in isoform 4, isoform 6, isoform 9, isoform 11 and isoform 12. 2 PublicationsVSP_003315
    Alternative sequencei191 – 25060DSHTR…PMARR → VSSEP in isoform 2. 2 PublicationsVSP_003314Add
    BLAST
    Alternative sequencei236 – 2361K → KDFVPGDHHVNVSVVTVSFS SSQGRGLSLSRFSWGAEGQK PGFGYGGRASDYKSAHKGFK GAYDAQGTLSKIFKL in isoform 10. CuratedVSP_003317
    Alternative sequencei236 – 2361K → KDFVPGDHHVNVSVVTVSFS SSQGRGLSLSRFSW in isoform 11. CuratedVSP_003316
    Alternative sequencei236 – 2361K → KGRGLSLSRFSWGAEGQKPG FGYGGRASDYKSAHKGFKGA YDAQGTLSKIFKL in isoform 4 and isoform 5. CuratedVSP_003319
    Alternative sequencei236 – 2361K → KGRGLSLSRFSW in isoform 6 and isoform 8. 3 PublicationsVSP_003318
    Alternative sequencei236 – 2361K → KGAEGQKPGFGYGGRASDYK SAHKGFKGAYDAQGTLSKIF KL in isoform 7 and isoform 9. 2 PublicationsVSP_003320

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M11533
    , M11291, M11529, M11530, M11531, M11532 Genomic DNA. Translation: AAA39496.1.
    M11533
    , M11291, M11529, M11530, M11531 Genomic DNA. Translation: AAA39497.1.
    L00404
    , L00398, L00400, L00401, L00402 Genomic DNA. Translation: AAA39499.1.
    L00404
    , L00398, L00399, L00400, L00401, L00402 Genomic DNA. Translation: AAA39500.1.
    L00404
    , L00398, L00400, L00401, L00402, L00403 Genomic DNA. Translation: AAA39501.1.
    L00404
    , L00398, L00399, L00400, L00401, L00402, L00403 Genomic DNA. Translation: AAA39502.1.
    M15060 mRNA. Translation: AAB59711.1.
    M15062 mRNA. Translation: AAB59712.1.
    X67319 mRNA. Translation: CAA47733.1.
    L07507 mRNA. Translation: AAA37720.1.
    L07508 mRNA. Translation: AAA37721.1.
    L07509 mRNA. Translation: AAA37722.1.
    L07505, L07504 Genomic DNA. Translation: AAA37719.1.
    AK005129 mRNA. Translation: BAB23830.1.
    BC004704 mRNA. Translation: AAH04704.1.
    M24410 Genomic DNA. Translation: AAA39498.1.
    M36275 Genomic DNA. Translation: AAA39504.1.
    K00989 mRNA. Translation: AAA39495.1.
    M20010 mRNA. Translation: AAA39503.1.
    CCDSiCCDS29373.1. [P04370-1]
    CCDS29374.1. [P04370-2]
    CCDS29376.1. [P04370-4]
    CCDS29377.1. [P04370-5]
    CCDS29378.1. [P04370-6]
    CCDS29379.1. [P04370-7]
    CCDS37875.1. [P04370-9]
    PIRiA45421. MBMSB.
    RefSeqiNP_001020416.1. NM_001025245.1. [P04370-2]
    NP_001020422.1. NM_001025251.2. [P04370-4]
    NP_001020425.1. NM_001025254.2. [P04370-9]
    NP_001020426.1. NM_001025255.2. [P04370-5]
    NP_001020427.1. NM_001025256.2. [P04370-6]
    NP_001020429.1. NM_001025258.2. [P04370-7]
    NP_001020430.1. NM_001025259.2. [P04370-8]
    NP_034907.1. NM_010777.3. [P04370-1]
    UniGeneiMm.252063.
    Mm.454459.

    Genome annotation databases

    EnsembliENSMUST00000047865; ENSMUSP00000046185; ENSMUSG00000041607. [P04370-1]
    ENSMUST00000062446; ENSMUSP00000053495; ENSMUSG00000041607. [P04370-4]
    ENSMUST00000075372; ENSMUSP00000074836; ENSMUSG00000041607. [P04370-7]
    ENSMUST00000080658; ENSMUSP00000079488; ENSMUSG00000041607. [P04370-6]
    ENSMUST00000091789; ENSMUSP00000089393; ENSMUSG00000041607. [P04370-2]
    ENSMUST00000102812; ENSMUSP00000099876; ENSMUSG00000041607. [P04370-5]
    ENSMUST00000114674; ENSMUSP00000110322; ENSMUSG00000041607. [P04370-9]
    ENSMUST00000143506; ENSMUSP00000138313; ENSMUSG00000041607. [P04370-3]
    GeneIDi17196.
    KEGGimmu:17196.
    UCSCiuc008fts.1. mouse. [P04370-1]
    uc008ftu.1. mouse. [P04370-4]
    uc008ftv.1. mouse. [P04370-9]
    uc008ftw.1. mouse. [P04370-5]
    uc008fty.1. mouse. [P04370-7]
    uc029tqh.1. mouse. [P04370-14]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M11533
    , M11291 , M11529 , M11530 , M11531 , M11532 Genomic DNA. Translation: AAA39496.1 .
    M11533
    , M11291 , M11529 , M11530 , M11531 Genomic DNA. Translation: AAA39497.1 .
    L00404
    , L00398 , L00400 , L00401 , L00402 Genomic DNA. Translation: AAA39499.1 .
    L00404
    , L00398 , L00399 , L00400 , L00401 , L00402 Genomic DNA. Translation: AAA39500.1 .
    L00404
    , L00398 , L00400 , L00401 , L00402 , L00403 Genomic DNA. Translation: AAA39501.1 .
    L00404
    , L00398 , L00399 , L00400 , L00401 , L00402 , L00403 Genomic DNA. Translation: AAA39502.1 .
    M15060 mRNA. Translation: AAB59711.1 .
    M15062 mRNA. Translation: AAB59712.1 .
    X67319 mRNA. Translation: CAA47733.1 .
    L07507 mRNA. Translation: AAA37720.1 .
    L07508 mRNA. Translation: AAA37721.1 .
    L07509 mRNA. Translation: AAA37722.1 .
    L07505 , L07504 Genomic DNA. Translation: AAA37719.1 .
    AK005129 mRNA. Translation: BAB23830.1 .
    BC004704 mRNA. Translation: AAH04704.1 .
    M24410 Genomic DNA. Translation: AAA39498.1 .
    M36275 Genomic DNA. Translation: AAA39504.1 .
    K00989 mRNA. Translation: AAA39495.1 .
    M20010 mRNA. Translation: AAA39503.1 .
    CCDSi CCDS29373.1. [P04370-1 ]
    CCDS29374.1. [P04370-2 ]
    CCDS29376.1. [P04370-4 ]
    CCDS29377.1. [P04370-5 ]
    CCDS29378.1. [P04370-6 ]
    CCDS29379.1. [P04370-7 ]
    CCDS37875.1. [P04370-9 ]
    PIRi A45421. MBMSB.
    RefSeqi NP_001020416.1. NM_001025245.1. [P04370-2 ]
    NP_001020422.1. NM_001025251.2. [P04370-4 ]
    NP_001020425.1. NM_001025254.2. [P04370-9 ]
    NP_001020426.1. NM_001025255.2. [P04370-5 ]
    NP_001020427.1. NM_001025256.2. [P04370-6 ]
    NP_001020429.1. NM_001025258.2. [P04370-7 ]
    NP_001020430.1. NM_001025259.2. [P04370-8 ]
    NP_034907.1. NM_010777.3. [P04370-1 ]
    UniGenei Mm.252063.
    Mm.454459.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2LUG NMR - A 206-245 [» ]
    DisProti DP00237.
    ProteinModelPortali P04370.
    SMRi P04370. Positions 206-237.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 201336. 42 interactions.
    IntActi P04370. 30 interactions.
    MINTi MINT-4101448.

    Chemistry

    ChEMBLi CHEMBL1764935.

    PTM databases

    PhosphoSitei P04370.

    Proteomic databases

    MaxQBi P04370.
    PaxDbi P04370.
    PRIDEi P04370.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000047865 ; ENSMUSP00000046185 ; ENSMUSG00000041607 . [P04370-1 ]
    ENSMUST00000062446 ; ENSMUSP00000053495 ; ENSMUSG00000041607 . [P04370-4 ]
    ENSMUST00000075372 ; ENSMUSP00000074836 ; ENSMUSG00000041607 . [P04370-7 ]
    ENSMUST00000080658 ; ENSMUSP00000079488 ; ENSMUSG00000041607 . [P04370-6 ]
    ENSMUST00000091789 ; ENSMUSP00000089393 ; ENSMUSG00000041607 . [P04370-2 ]
    ENSMUST00000102812 ; ENSMUSP00000099876 ; ENSMUSG00000041607 . [P04370-5 ]
    ENSMUST00000114674 ; ENSMUSP00000110322 ; ENSMUSG00000041607 . [P04370-9 ]
    ENSMUST00000143506 ; ENSMUSP00000138313 ; ENSMUSG00000041607 . [P04370-3 ]
    GeneIDi 17196.
    KEGGi mmu:17196.
    UCSCi uc008fts.1. mouse. [P04370-1 ]
    uc008ftu.1. mouse. [P04370-4 ]
    uc008ftv.1. mouse. [P04370-9 ]
    uc008ftw.1. mouse. [P04370-5 ]
    uc008fty.1. mouse. [P04370-7 ]
    uc029tqh.1. mouse. [P04370-14 ]

    Organism-specific databases

    CTDi 4155.
    MGIi MGI:96925. Mbp.

    Phylogenomic databases

    eggNOGi NOG75180.
    GeneTreei ENSGT00390000014772.
    HOVERGENi HBG008347.
    InParanoidi P04370.
    KOi K17269.
    OMAi CAERRGH.
    OrthoDBi EOG7M0NRZ.
    PhylomeDBi P04370.
    TreeFami TF333391.

    Miscellaneous databases

    ChiTaRSi MBP. mouse.
    NextBioi 291554.
    PMAP-CutDB P04370.
    PROi P04370.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P04370.
    Bgeei P04370.
    CleanExi MM_MBP.
    Genevestigatori P04370.

    Family and domain databases

    InterProi IPR000548. Myelin_BP.
    [Graphical view ]
    PANTHERi PTHR11429. PTHR11429. 1 hit.
    Pfami PF01669. Myelin_MBP. 1 hit.
    [Graphical view ]
    PRINTSi PR00212. MYELINMBP.
    PROSITEi PS00569. MYELIN_MBP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of the myelin basic protein gene from mouse: one gene can encode both 14 kd and 18.5 kd MBPs by alternate use of exons."
      Takahashi N., Roach A., Teplow D.B., Prusiner S.B., Hood L.E.
      Cell 42:139-148(1985) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    2. "Alternative splicing accounts for the four forms of myelin basic protein."
      de Ferra F., Engh H., Hudson L., Kamholz J., Puckett C., Molineaux S., Lazzarini R.A.
      Cell 43:721-727(1985) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Identification of a cDNA coding for a fifth form of myelin basic protein in mouse."
      Newman S., Kitamura K., Campagnoni A.T.
      Proc. Natl. Acad. Sci. U.S.A. 84:886-890(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6 AND 7), NUCLEOTIDE SEQUENCE [MRNA] OF 9-194.
      Strain: C57BL/6J.
      Tissue: Brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8).
    5. "A novel transcript overlapping the myelin basic protein gene."
      Grima B., Zelenika D., Pessac B.
      J. Neurochem. 59:2318-2323(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: C57BL/6.
      Tissue: Bone marrow.
    6. "Structure and developmental regulation of Golli-mbp, a 105-kilobase gene that encompasses the myelin basic protein gene and is expressed in cells in the oligodendrocyte lineage in the brain."
      Campagnoni A.T., Pribyl T.M., Campagnoni C.W., Kampf K., Amur-Umarjee S., Landry C.F., Handley V.W., Newman S., Garbay B., Kitamura K.
      J. Biol. Chem. 268:4930-4938(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3).
      Strain: C57BL/6.
      Tissue: Brain.
    7. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
      Strain: C57BL/6J.
      Tissue: Cerebellum.
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9).
      Tissue: Mammary tumor.
    9. "The promoter elements of the mouse myelin basic protein gene function efficiently in NG108-15 neuronal/glial cells."
      Miura M., Tamura T.A., Aoyama A., Mikoshiba K.
      Gene 75:31-38(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 135-157.
    10. Lubec G., Kang S.U.
      Submitted (APR-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 146-157; 164-175; 196-205 AND 211-222, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: C57BL/6.
      Tissue: Brain.
    11. "Gene organization and transcription of duplicated MBP genes of myelin deficient (shi(mld)) mutant mouse."
      Okano H., Tamura T., Miura M., Aoyama A., Ikenaka K., Oshimura M., Mikoshiba K.
      EMBO J. 7:77-83(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 191-224.
    12. "Characterization of mouse myelin basic protein messenger RNAs with a myelin basic protein cDNA clone."
      Zeller N.K., Hunkeler M.J., Campagnoni A.T., Sprague J., Lazzarini R.A.
      Proc. Natl. Acad. Sci. U.S.A. 81:18-22(1984) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 193-222.
    13. "Identification of three forms of human myelin basic protein by cDNA cloning."
      Kamholz J., de Ferra F., Puckett C., Lazzarini R.A.
      Proc. Natl. Acad. Sci. U.S.A. 83:4962-4966(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 6 AND 9).
    14. "Identification of the new isoforms of mouse myelin basic protein: the existence of exon 5a."
      Aruga J., Okano H., Mikoshiba K.
      J. Neurochem. 56:1222-1226(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 10 AND 11).
      Tissue: Spinal cord.
    15. "Novel isoforms of mouse myelin basic protein predominantly expressed in embryonic stage."
      Nakajima K., Ikenaka K., Kagawa T., Aruga J., Nakao J., Nakahira K., Shiota C., Kim S.U., Mikoshiba K.
      J. Neurochem. 60:1554-1563(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 12 AND 13).
      Tissue: Embryonic brain.
    16. "Embryonic expression of the myelin basic protein gene: identification of a promoter region that targets transgene expression to pioneer neurons."
      Landry C.F., Pribyl T.M., Ellison J.A., Givogri M.I., Kampf K., Campagnoni C.W., Campagnoni A.T.
      J. Neurosci. 18:7315-7327(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: DEVELOPMENTAL STAGE.
    17. "The pathobiology of myelin mutants reveal novel biological functions of the MBP and PLP genes."
      Campagnoni A.T., Skoff R.P.
      Brain Pathol. 11:74-91(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    18. "Quantitative analysis of both protein expression and serine / threonine post-translational modifications through stable isotope labeling with dithiothreitol."
      Vosseller K., Hansen K.C., Chalkley R.J., Trinidad J.C., Wells L., Hart G.W., Burlingame A.L.
      Proteomics 5:388-398(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-172, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    19. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-167 AND THR-229, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-135 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-139 (ISOFORM 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-122 (ISOFORMS 4 AND 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-113 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-96 (ISOFORMS 5 AND 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    20. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
      Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
      J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-199, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-147 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-151 (ISOFORM 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-125 (ISOFORM 5), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    21. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiMBP_MOUSE
    AccessioniPrimary (citable) accession number: P04370
    Secondary accession number(s): Q01585
    , Q03139, Q03176, Q61836, Q61837, Q99KE4, Q9QWP1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 20, 1987
    Last sequence update: October 18, 2001
    Last modified: October 1, 2014
    This is version 158 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3