Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myelin basic protein

Gene

Mbp

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The classic group of MBP isoforms (isoform 4-isoform 13) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined to optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function.1 Publication

GO - Molecular functioni

  • protease binding Source: BHF-UCL
  • structural constituent of myelin sheath Source: GO_Central

GO - Biological processi

  • central nervous system development Source: GO_Central
  • membrane organization Source: MGI
  • myelination Source: MGI
  • response to toxic substance Source: MGI
  • sensory perception of sound Source: MGI
  • substantia nigra development Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin basic protein
Short name:
MBP
Alternative name(s):
Myelin A1 protein
Gene namesi
Name:Mbp
Synonyms:Shi
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:96925. Mbp.

Subcellular locationi

GO - Cellular componenti

  • cell periphery Source: MGI
  • cell projection Source: MGI
  • compact myelin Source: GO_Central
  • cytoplasm Source: UniProtKB-SubCell
  • internode region of axon Source: MGI
  • myelin sheath Source: UniProtKB
  • neuronal cell body Source: MGI
  • nucleus Source: UniProtKB-SubCell
  • plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Involvement in diseasei

Defects in Mbp are a cause of dysmyelinating diseases such as the shiverer (SHI) and myelin deficient (MLD) diseases characterized by decreased myelination in the CNS, tremors, and convulsions of progressively increasing severity leading to early death. The shiverer mice only express isoform 2, the MLD mice have a reduced amount of Mbp.

Keywords - Diseasei

Autoimmune encephalomyelitis

Chemistry databases

ChEMBLiCHEMBL1764935.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001589911 – 250Myelin basic proteinAdd BLAST250
Isoform 4 (identifier: P04370-4)
Initiator methionineiRemoved By similarityCombined sourcesBy similarity
Isoform 5 (identifier: P04370-5)
Initiator methionineiRemoved By similarityCombined sourcesBy similarity
Isoform 6 (identifier: P04370-6)
Initiator methionineiRemoved By similarityCombined sourcesBy similarity
Isoform 7 (identifier: P04370-7)
Initiator methionineiRemovedBy similarity
Isoform 8 (identifier: P04370-8)
Initiator methionineiRemoved By similarityCombined sourcesBy similarity
Isoform 9 (identifier: P04370-9)
Initiator methionineiRemovedBy similarity

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei31PhosphoserineCombined sources1
Modified residuei40PhosphoserineCombined sources1
Modified residuei141PhosphoserineBy similarity1
Modified residuei144PhosphoserineCombined sources1
Modified residuei146PhosphotyrosineBy similarity1
Modified residuei149PhosphothreonineBy similarity1
Modified residuei151PhosphoserineCombined sources1
Modified residuei152PhosphothreonineBy similarity1
Modified residuei157CitrullineBy similarity1
Modified residuei163CitrullineBy similarity1
Modified residuei167PhosphothreonineCombined sources1
Modified residuei172PhosphoserineCombined sources1
Modified residuei175Omega-N-methylarginineCombined sources1
Modified residuei181Omega-N-methylarginineCombined sources1
Modified residuei188PhosphoserineBy similarity1
Modified residuei197PhosphothreonineCombined sources1
Modified residuei199PhosphotyrosineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei211PhosphothreonineCombined sources1
Modified residuei226PhosphothreonineBy similarity1
Modified residuei229PhosphothreonineCombined sources1
Modified residuei234Deamidated glutamineBy similarity1
Modified residuei239CitrullineBy similarity1
Modified residuei241PhosphoserineBy similarity1
Modified residuei245Phosphoserine; by UHMK1By similarity1
Modified residuei250CitrullineBy similarity1
Isoform 4 (identifier: P04370-4)
Modified residuei2N-acetylalanine By similarityCombined sourcesBy similarity1
Modified residuei122PhosphothreonineCombined sourcesBy similarity1
Modified residuei139PhosphoserineCombined sourcesBy similarity1
Modified residuei151PhosphotyrosineCombined sourcesBy similarity1
Isoform 5 (identifier: P04370-5)
Modified residuei2N-acetylalanine By similarityCombined sourcesBy similarity1
Modified residuei96PhosphothreonineCombined sourcesBy similarity1
Modified residuei113PhosphoserineCombined sourcesBy similarity1
Modified residuei125PhosphotyrosineCombined sourcesBy similarity1
Isoform 6 (identifier: P04370-6)
Modified residuei2N-acetylalanine By similarityCombined sourcesBy similarity1
Modified residuei122PhosphothreonineCombined sourcesBy similarity1
Isoform 7 (identifier: P04370-7)
Modified residuei2N-acetylalanineBy similarity1
Isoform 8 (identifier: P04370-8)
Modified residuei2N-acetylalanine By similarityCombined sourcesBy similarity1
Modified residuei96PhosphothreonineCombined sourcesBy similarity1
Isoform 9 (identifier: P04370-9)
Modified residuei2N-acetylalanineBy similarity1
Isoform 10 (identifier: P04370-10)
Modified residuei135PhosphoserineCombined sources1
Modified residuei147PhosphotyrosineCombined sources1

Post-translational modificationi

As in other animals, several charge isomers may be produced as a result of optional post-translatonial modifications, such as phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues.
Methylated on arginine residues; decreases with the age of the animal, making MBP more cationic.
Phosphorylated by TAOK2, VRK2, MAPK11, MAPK12, MAPK14 and MINK1.By similarity

Keywords - PTMi

Acetylation, Citrullination, Methylation, Phosphoprotein

Proteomic databases

MaxQBiP04370.
PaxDbiP04370.
PeptideAtlasiP04370.
PRIDEiP04370.

PTM databases

iPTMnetiP04370.
PhosphoSitePlusiP04370.
SwissPalmiP04370.

Miscellaneous databases

PMAP-CutDBP04370.

Expressioni

Tissue specificityi

In the embryo, isoform 1-isoform 3 are found in neurons within the central nervous system (primarily in pioneer neurons important in the formation of the cortex) and the peripheral nervous system. They are also expressed in the thymus, gut, lung and kidney. In the adult, isoform 1-isoform 3 are highly expressed in the brain (mainly in brain regions rich in oligodendrocytes) and spleen. Lower levels are seen in the heart, kidney and lung. Isoform 2 is also found in cells of the immune system. The isoforms missing the 134 first amino acids (isoform 4-isoform 13) are almost exclusively produced in the myelin-forming cells, the mature oligodendrocytes.

Developmental stagei

The differential expression of MBP isoforms is developmentally regulated. Isoform 2 and isoform 3 are first expressed during embryonic stages (as early as at embryonic day 11.5), expression of isoform 1 is turned on shortly after birth. Expression of the isoforms missing the 134 first amino acids occurs later, presumably as the oligodendrocytes approach their terminally differentiated state.1 Publication

Gene expression databases

BgeeiENSMUSG00000041607.
CleanExiMM_MBP.
ExpressionAtlasiP04370. baseline and differential.
GenevisibleiP04370. MM.

Interactioni

Subunit structurei

Homodimer.By similarity

GO - Molecular functioni

  • protease binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi201336. 45 interactors.
IntActiP04370. 31 interactors.
MINTiMINT-4101448.
STRINGi10090.ENSMUSP00000046185.

Structurei

Secondary structure

1250
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi209 – 211Combined sources3
Helixi216 – 225Combined sources10
Turni242 – 244Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LUGNMR-A206-245[»]
DisProtiDP00237.
ProteinModelPortaliP04370.
SMRiP04370.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the myelin basic protein family.Curated

Phylogenomic databases

eggNOGiENOG410IIUJ. Eukaryota.
ENOG4111PMJ. LUCA.
GeneTreeiENSGT00390000014772.
HOVERGENiHBG008347.
InParanoidiP04370.
KOiK17269.
OrthoDBiEOG091G11QQ.
PhylomeDBiP04370.
TreeFamiTF333391.

Family and domain databases

InterProiIPR000548. Myelin_BP.
[Graphical view]
PANTHERiPTHR11429. PTHR11429. 1 hit.
PfamiPF01669. Myelin_MBP. 1 hit.
[Graphical view]
PRINTSiPR00212. MYELINMBP.
PROSITEiPS00569. MYELIN_MBP. 1 hit.
[Graphical view]

Sequences (13)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 13 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P04370-1) [UniParc]FASTAAdd to basket
Also known as: Golli-MBP1, J37

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNHSGKREL SAEKASKDGE IHRGEAGKKR SVGKLSQTAS EDSDVFGEAD
60 70 80 90 100
AIQNNGTSAE DTAVTDSKHT ADPKNNWQGA HPADPGNRPH LIRLFSRDAP
110 120 130 140 150
GREDNTFKDR PSESDELQTI QEDPTAASGG LDVMASQKRP SQRSKYLATA
160 170 180 190 200
STMDHARHGF LPRHRDTGIL DSIGRFFSGD RGAPKRGSGK DSHTRTTHYG
210 220 230 240 250
SLPQKSQHGR TQDENPVVHF FKNIVTPRTP PPSQGKGGRD SRSGSPMARR
Length:250
Mass (Da):27,168
Last modified:October 18, 2001 - v2
Checksum:iB418ED11C27B0C43
GO
Isoform 2 (identifier: P04370-2) [UniParc]FASTAAdd to basket
Also known as: Golli-MBP2, BG21, HMBPR

The sequence of this isoform differs from the canonical sequence as follows:
     191-250: DSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR → VSSEP

Show »
Length:195
Mass (Da):21,004
Checksum:i1C5C6AEFB561D2DA
GO
Isoform 3 (identifier: P04370-3) [UniParc]FASTAAdd to basket
Also known as: Golli-MBP3, TP8

The sequence of this isoform differs from the canonical sequence as follows:
     48-250: EADAIQNNGT...SRSGSPMARR → LTHENYPLWLPAPEVAARPDPR

Show »
Length:69
Mass (Da):7,498
Checksum:i067EABB28D687D99
GO
Isoform 4 (identifier: P04370-4) [UniParc]FASTAAdd to basket
Also known as: 21.5-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
     236-236: K → KGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

Show »
Length:195
Mass (Da):21,502
Checksum:i4B57CA6F06C4AC7D
GO
Isoform 5 (identifier: P04370-5) [UniParc]FASTAAdd to basket
Also known as: 18.5-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     236-236: K → KGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

Show »
Length:169
Mass (Da):18,488
Checksum:iE609240A863F36CD
GO
Isoform 6 (identifier: P04370-6) [UniParc]FASTAAdd to basket
Also known as: 17-kDa-a

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
     236-236: K → KGRGLSLSRFSW

Show »
Length:154
Mass (Da):17,225
Checksum:i00F1F10ECF90421B
GO
Isoform 7 (identifier: P04370-7) [UniParc]FASTAAdd to basket
Also known as: 17-kDa-b

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     236-236: K → KGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

Show »
Length:158
Mass (Da):17,240
Checksum:i7AA39D2A263A2BF3
GO
Isoform 8 (identifier: P04370-8) [UniParc]FASTAAdd to basket
Also known as: 14-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     236-236: K → KGRGLSLSRFSW

Show »
Length:128
Mass (Da):14,211
Checksum:iE1DB77B2010455FB
GO
Isoform 9 (identifier: P04370-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
     236-236: K → KGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKL

Show »
Length:184
Mass (Da):20,255
Checksum:iB7F672275771E3F4
GO
Isoform 10 (identifier: P04370-10) [UniParc]FASTAAdd to basket
Also known as: 21-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     236-236: K → KDFVPGDHHV...QGTLSKIFKL

Show »
Length:191
Mass (Da):20,814
Checksum:iD986AA8B506E2AE9
GO
Isoform 11 (identifier: P04370-11) [UniParc]FASTAAdd to basket
Also known as: 19.7-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK
     236-236: K → KDFVPGDHHVNVSVVTVSFSSSQGRGLSLSRFSW

Show »
Length:176
Mass (Da):19,552
Checksum:i159154971A58A0CF
GO
Isoform 12 (identifier: P04370-13) [UniParc]FASTAAdd to basket
Also known as: 15.6-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     190-190: K → KVPWLKQSRSPLPSHARSRPGLCHMYK

Show »
Length:143
Mass (Da):15,978
Checksum:i932F8612537F93E2
GO
Isoform 13 (identifier: P04370-14) [UniParc]FASTAAdd to basket
Also known as: 13-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.

Show »
Length:117
Mass (Da):12,963
Checksum:i7FC65A7A1A8C7E53
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti204 – 205QK → HN (PubMed:7681106).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0033121 – 133Missing in isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11, isoform 12 and isoform 13. 4 PublicationsAdd BLAST133
Alternative sequenceiVSP_00331348 – 250EADAI…PMARR → LTHENYPLWLPAPEVAARPD PR in isoform 3. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_003315190K → KVPWLKQSRSPLPSHARSRP GLCHMYK in isoform 4, isoform 6, isoform 9, isoform 11 and isoform 12. 2 Publications1
Alternative sequenceiVSP_003314191 – 250DSHTR…PMARR → VSSEP in isoform 2. 2 PublicationsAdd BLAST60
Alternative sequenceiVSP_003317236K → KDFVPGDHHVNVSVVTVSFS SSQGRGLSLSRFSWGAEGQK PGFGYGGRASDYKSAHKGFK GAYDAQGTLSKIFKL in isoform 10. Curated1
Alternative sequenceiVSP_003316236K → KDFVPGDHHVNVSVVTVSFS SSQGRGLSLSRFSW in isoform 11. Curated1
Alternative sequenceiVSP_003319236K → KGRGLSLSRFSWGAEGQKPG FGYGGRASDYKSAHKGFKGA YDAQGTLSKIFKL in isoform 4 and isoform 5. Curated1
Alternative sequenceiVSP_003318236K → KGRGLSLSRFSW in isoform 6 and isoform 8. 3 Publications1
Alternative sequenceiVSP_003320236K → KGAEGQKPGFGYGGRASDYK SAHKGFKGAYDAQGTLSKIF KL in isoform 7 and isoform 9. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M11533
, M11291, M11529, M11530, M11531, M11532 Genomic DNA. Translation: AAA39496.1.
M11533
, M11291, M11529, M11530, M11531 Genomic DNA. Translation: AAA39497.1.
L00404
, L00398, L00400, L00401, L00402 Genomic DNA. Translation: AAA39499.1.
L00404
, L00398, L00399, L00400, L00401, L00402 Genomic DNA. Translation: AAA39500.1.
L00404
, L00398, L00400, L00401, L00402, L00403 Genomic DNA. Translation: AAA39501.1.
L00404
, L00398, L00399, L00400, L00401, L00402, L00403 Genomic DNA. Translation: AAA39502.1.
M15060 mRNA. Translation: AAB59711.1.
M15062 mRNA. Translation: AAB59712.1.
X67319 mRNA. Translation: CAA47733.1.
L07507 mRNA. Translation: AAA37720.1.
L07508 mRNA. Translation: AAA37721.1.
L07509 mRNA. Translation: AAA37722.1.
L07505, L07504 Genomic DNA. Translation: AAA37719.1.
AK005129 mRNA. Translation: BAB23830.1.
BC004704 mRNA. Translation: AAH04704.1.
M24410 Genomic DNA. Translation: AAA39498.1.
M36275 Genomic DNA. Translation: AAA39504.1.
K00989 mRNA. Translation: AAA39495.1.
M20010 mRNA. Translation: AAA39503.1.
CCDSiCCDS29373.1. [P04370-1]
CCDS29374.1. [P04370-2]
CCDS29376.1. [P04370-4]
CCDS29377.1. [P04370-5]
CCDS29378.1. [P04370-6]
CCDS29379.1. [P04370-7]
CCDS37875.1. [P04370-9]
PIRiA45421. MBMSB.
RefSeqiNP_001020416.1. NM_001025245.1. [P04370-2]
NP_001020422.1. NM_001025251.2. [P04370-4]
NP_001020425.1. NM_001025254.2. [P04370-9]
NP_001020426.1. NM_001025255.2. [P04370-5]
NP_001020427.1. NM_001025256.2. [P04370-6]
NP_001020429.1. NM_001025258.2. [P04370-7]
NP_001020430.1. NM_001025259.2. [P04370-8]
NP_034907.1. NM_010777.3. [P04370-1]
UniGeneiMm.252063.
Mm.454459.

Genome annotation databases

EnsembliENSMUST00000047865; ENSMUSP00000046185; ENSMUSG00000041607. [P04370-1]
ENSMUST00000062446; ENSMUSP00000053495; ENSMUSG00000041607. [P04370-4]
ENSMUST00000075372; ENSMUSP00000074836; ENSMUSG00000041607. [P04370-7]
ENSMUST00000080658; ENSMUSP00000079488; ENSMUSG00000041607. [P04370-6]
ENSMUST00000091789; ENSMUSP00000089393; ENSMUSG00000041607. [P04370-2]
ENSMUST00000102812; ENSMUSP00000099876; ENSMUSG00000041607. [P04370-5]
ENSMUST00000114674; ENSMUSP00000110322; ENSMUSG00000041607. [P04370-9]
ENSMUST00000143506; ENSMUSP00000138313; ENSMUSG00000041607. [P04370-3]
GeneIDi17196.
KEGGimmu:17196.
UCSCiuc008fts.1. mouse. [P04370-1]
uc008ftu.1. mouse. [P04370-4]
uc008ftv.1. mouse. [P04370-9]
uc008ftw.1. mouse. [P04370-5]
uc008fty.1. mouse. [P04370-7]
uc029tqh.1. mouse. [P04370-14]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M11533
, M11291, M11529, M11530, M11531, M11532 Genomic DNA. Translation: AAA39496.1.
M11533
, M11291, M11529, M11530, M11531 Genomic DNA. Translation: AAA39497.1.
L00404
, L00398, L00400, L00401, L00402 Genomic DNA. Translation: AAA39499.1.
L00404
, L00398, L00399, L00400, L00401, L00402 Genomic DNA. Translation: AAA39500.1.
L00404
, L00398, L00400, L00401, L00402, L00403 Genomic DNA. Translation: AAA39501.1.
L00404
, L00398, L00399, L00400, L00401, L00402, L00403 Genomic DNA. Translation: AAA39502.1.
M15060 mRNA. Translation: AAB59711.1.
M15062 mRNA. Translation: AAB59712.1.
X67319 mRNA. Translation: CAA47733.1.
L07507 mRNA. Translation: AAA37720.1.
L07508 mRNA. Translation: AAA37721.1.
L07509 mRNA. Translation: AAA37722.1.
L07505, L07504 Genomic DNA. Translation: AAA37719.1.
AK005129 mRNA. Translation: BAB23830.1.
BC004704 mRNA. Translation: AAH04704.1.
M24410 Genomic DNA. Translation: AAA39498.1.
M36275 Genomic DNA. Translation: AAA39504.1.
K00989 mRNA. Translation: AAA39495.1.
M20010 mRNA. Translation: AAA39503.1.
CCDSiCCDS29373.1. [P04370-1]
CCDS29374.1. [P04370-2]
CCDS29376.1. [P04370-4]
CCDS29377.1. [P04370-5]
CCDS29378.1. [P04370-6]
CCDS29379.1. [P04370-7]
CCDS37875.1. [P04370-9]
PIRiA45421. MBMSB.
RefSeqiNP_001020416.1. NM_001025245.1. [P04370-2]
NP_001020422.1. NM_001025251.2. [P04370-4]
NP_001020425.1. NM_001025254.2. [P04370-9]
NP_001020426.1. NM_001025255.2. [P04370-5]
NP_001020427.1. NM_001025256.2. [P04370-6]
NP_001020429.1. NM_001025258.2. [P04370-7]
NP_001020430.1. NM_001025259.2. [P04370-8]
NP_034907.1. NM_010777.3. [P04370-1]
UniGeneiMm.252063.
Mm.454459.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LUGNMR-A206-245[»]
DisProtiDP00237.
ProteinModelPortaliP04370.
SMRiP04370.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201336. 45 interactors.
IntActiP04370. 31 interactors.
MINTiMINT-4101448.
STRINGi10090.ENSMUSP00000046185.

Chemistry databases

ChEMBLiCHEMBL1764935.

PTM databases

iPTMnetiP04370.
PhosphoSitePlusiP04370.
SwissPalmiP04370.

Proteomic databases

MaxQBiP04370.
PaxDbiP04370.
PeptideAtlasiP04370.
PRIDEiP04370.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000047865; ENSMUSP00000046185; ENSMUSG00000041607. [P04370-1]
ENSMUST00000062446; ENSMUSP00000053495; ENSMUSG00000041607. [P04370-4]
ENSMUST00000075372; ENSMUSP00000074836; ENSMUSG00000041607. [P04370-7]
ENSMUST00000080658; ENSMUSP00000079488; ENSMUSG00000041607. [P04370-6]
ENSMUST00000091789; ENSMUSP00000089393; ENSMUSG00000041607. [P04370-2]
ENSMUST00000102812; ENSMUSP00000099876; ENSMUSG00000041607. [P04370-5]
ENSMUST00000114674; ENSMUSP00000110322; ENSMUSG00000041607. [P04370-9]
ENSMUST00000143506; ENSMUSP00000138313; ENSMUSG00000041607. [P04370-3]
GeneIDi17196.
KEGGimmu:17196.
UCSCiuc008fts.1. mouse. [P04370-1]
uc008ftu.1. mouse. [P04370-4]
uc008ftv.1. mouse. [P04370-9]
uc008ftw.1. mouse. [P04370-5]
uc008fty.1. mouse. [P04370-7]
uc029tqh.1. mouse. [P04370-14]

Organism-specific databases

CTDi4155.
MGIiMGI:96925. Mbp.

Phylogenomic databases

eggNOGiENOG410IIUJ. Eukaryota.
ENOG4111PMJ. LUCA.
GeneTreeiENSGT00390000014772.
HOVERGENiHBG008347.
InParanoidiP04370.
KOiK17269.
OrthoDBiEOG091G11QQ.
PhylomeDBiP04370.
TreeFamiTF333391.

Miscellaneous databases

ChiTaRSiMbp. mouse.
PMAP-CutDBP04370.
PROiP04370.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000041607.
CleanExiMM_MBP.
ExpressionAtlasiP04370. baseline and differential.
GenevisibleiP04370. MM.

Family and domain databases

InterProiIPR000548. Myelin_BP.
[Graphical view]
PANTHERiPTHR11429. PTHR11429. 1 hit.
PfamiPF01669. Myelin_MBP. 1 hit.
[Graphical view]
PRINTSiPR00212. MYELINMBP.
PROSITEiPS00569. MYELIN_MBP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMBP_MOUSE
AccessioniPrimary (citable) accession number: P04370
Secondary accession number(s): Q01585
, Q03139, Q03176, Q61836, Q61837, Q99KE4, Q9QWP1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 1987
Last sequence update: October 18, 2001
Last modified: November 2, 2016
This is version 177 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.