P04278 (SHBG_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 141.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sex hormone-binding globulin Short name=SHBG Alternative name(s): Sex steroid-binding protein Short name=SBP Testis-specific androgen-binding protein Short name=ABP Testosterone-estradiol-binding globulin Short name=TeBG Testosterone-estrogen-binding globulin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 402 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration. |
| Subunit structure | Homodimer. |
| Subcellular location | Secreted By similarity. Note: In testis, it is synthesized by the Sertoli cells, secreted into the lumen of the seminiferous tubule and transported to the epididymis By similarity. |
| Tissue specificity | |
| Post-translational modification | Variant Asn-356 contains one N-linked (GlcNAc...) at position 356. |
| Sequence similarities | Contains 2 laminin G-like domains. |
| Sequence caution | The sequence CAA29309.1 differs from that shown. Reason: Frameshift at positions 47, 52 and 54. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal |
| Ligand | Lipid-binding Steroid-binding |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | hormone transport Non-traceable author statement. Source: UniProtKB primary spermatocyte growthInferred from electronic annotation. Source: Compara |
| Cellular_component | extracellular region Non-traceable author statement PubMed 14718574. Source: UniProtKB |
| Molecular_function | androgen binding Traceable author statement Ref.1. Source: ProtInc protein homodimerization activityNon-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P04278-1) Also known as: SHBG; SHBGr-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P04278-2) Also known as: Sex hormone binding globulin-gene-related protein (SHBGgrp); SHBGr-2; The sequence of this isoform differs from the canonical sequence as follows: 1-37: MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQ → PRFKGSPAVLFKLTYAVITCFSLRLTHPPRPW 285-293: KVVLSSGSG → EKTLPPLFA 294-402: Missing. | ||||||
| Note: Incomplete sequence. | ||||||
| Isoform 3 (identifier: P04278-3) The sequence of this isoform differs from the canonical sequence as follows: 285-293: KVVLSSGSG → EKTLPPLFA 294-402: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P04278-4) The sequence of this isoform differs from the canonical sequence as follows: 239-353: Missing. | ||||||
| Isoform 5 (identifier: P04278-5) The sequence of this isoform differs from the canonical sequence as follows: 186-203: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Ref.10 Ref.11 | |||||||||||||||||||||||||||||||||||||||||
| Chain | 30 – 402 | 373 | Sex hormone-binding globulin Ref.11 | PRO_0000032557 | ||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||
| Domain | 45 – 217 | 173 | Laminin G-like 1 | |||||||||||||||||||||||||||||||||||||||||
| Domain | 224 – 390 | 167 | Laminin G-like 2 | |||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 36 | 1 | O-linked (GalNAc...) | CAR_000174 | ||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 380 | 1 | N-linked (GlcNAc...) Ref.11 Ref.12 Ref.13 | |||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 396 | 1 | N-linked (GlcNAc...) Ref.11 | |||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 193 ↔ 217 | Ref.11 | ||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 362 ↔ 390 | Ref.11 | ||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MESRG…VLPTQ → PRFKGSPAVLFKLTYAVITC FSLRLTHPPRPW in isoform 2. | VSP_006090 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 186 – 203 | 18 | Missing in isoform 5. | VSP_045376 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 239 – 353 | 115 | Missing in isoform 4. | VSP_045358 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 285 – 293 | 9 | KVVLSSGSG → EKTLPPLFA in isoform 2 and isoform 3. | VSP_006091 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 294 – 402 | 109 | Missing in isoform 2 and isoform 3. | VSP_006092 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 22 | 1 | R → H. Corresponds to variant rs9282845 [ dbSNP | Ensembl ]. | VAR_022002 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 25 | 1 | R → H. Ref.18 Corresponds to variant rs6260 [ dbSNP | Ensembl ]. | VAR_013946 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 185 | 1 | P → L. Corresponds to variant rs6258 [ dbSNP | Ensembl ]. | VAR_016182 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 356 | 1 | D → N Polymorphism that generates a N-glycosylation site. Ref.14 Ref.17 Ref.18 Corresponds to variant rs6259 [ dbSNP | Ensembl ]. | VAR_013129 | ||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 22 | 1 | R → Q in CAA28987. Ref.5 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 334 | 1 | A → L in AAC18778. Ref.2 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 336 | 1 | L → S in AAC18778. Ref.2 | |||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 44 – 47 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 56 – 62 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 63 – 65 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 78 | 9 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 80 – 90 | 11 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 91 – 93 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 94 – 101 | 8 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 104 – 113 | 10 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 119 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 126 – 128 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 130 – 137 | 8 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 140 – 145 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 148 – 153 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 160 – 162 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 167 – 174 | 8 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 179 – 181 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 182 – 184 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 192 – 200 | 9 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 204 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 205 – 209 | 5 | ||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the human sex hormone binding globulin (SHBG) gene and demonstration of two transcripts in both liver and testis." Gershagen S., Lundwall A., Fernlund P. Nucleic Acids Res. 17:9245-9258(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING. Tissue: Testis. |
| [2] | "The human sex hormone-binding globulin gene contains exons for androgen-binding protein and two other testicular messenger RNAs." Hammond G.L., Underhill D.A., Rykse H.M., Smith C.L. Mol. Endocrinol. 3:1869-1876(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING. Tissue: Testis. |
| [3] | "PCR isolation and cloning of novel splice variant mRNAs from known drug target genes." Jin P., Fu G.K., Wilson A.D., Yang J., Chien D., Hawkins P.R., Au-Young J., Stuve L.L. Genomics 83:566-571(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [4] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
| [6] | "The cDNA-deduced primary structure of human sex hormone-binding globulin and location of its steroid-binding domain." Hammond G.L., Underhill D.A., Smith C.L., Goping I.S., Harley M.J., Musto N.A., Cheng C.Y., Bardin C.W. FEBS Lett. 215:100-104(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-402 (ISOFORM 1). Tissue: Liver. |
| [7] | "Human sex hormone-binding globulin gene transcript expression in liver, prostate, breast, testis, and brain- multiple promoters and complex alternative splicing." Kahn S.M., Nakhla A.M., Hryb D.J., Rosner W., Romas N.A. Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 28-402 (ISOFORM 4). Tissue: Liver. |
| [8] | "A cDNA coding for human sex hormone binding globulin. Homology to vitamin K-dependent protein S." Gershagen S., Fernlund P., Lundwall A. FEBS Lett. 220:129-135(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 47-402 (ISOFORM 1). Tissue: Liver. |
| [9] | "Characterization of a cDNA coding for sex steroid-binding protein of human plasma." Que B.G., Petra P.H. FEBS Lett. 219:405-409(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 121-402 (ISOFORM 1). Tissue: Liver. |
| [10] | "Physicochemical characteristics of human sex hormone binding globulin: evidence for two identical subunits." Hammond G.L., Robinson P.A., Sugino H., Ward D.N., Finne J. J. Steroid Biochem. 24:815-824(1986) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 30-54. |
| [11] | "Amino acid sequence of the sex steroid binding protein of human blood plasma." Walsh K.A., Titani K., Takio K., Kumar S., Hayes R., Petra P.H. Biochemistry 25:7584-7590(1986) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 30-402. |
| [12] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-380, MASS SPECTROMETRY. Tissue: Plasma. |
| [13] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-380, MASS SPECTROMETRY. Tissue: Liver. |
| [14] | "Molecular analyses of a human sex hormone-binding globulin variant: evidence for an additional carbohydrate chain." Power S.G.A., Bocchinfuso W.P., Pallesen M., Warmels-Rodenhiser S., Van Baelen H., Hammond G.L. J. Clin. Endocrinol. Metab. 75:1066-1070(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ASN-356, CHARACTERIZATION OF VARIANT ASN-356, GLYCOSYLATION. |
| [15] | "Crystal structure of human sex hormone-binding globulin: steroid transport by a laminin G-like domain." Grishkovskaya I., Avvakumov G.V., Sklenar G., Dales D., Hammond G.L., Muller Y.A. EMBO J. 19:504-512(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 42-211. |
| [16] | "Steroid ligands bind human sex hormone-binding globulin in specific orientations and produce distinct changes in protein conformation." Grishkovskaya I., Avvakumov G.V., Hammond G.L., Catalano M.G., Muller Y.A. J. Biol. Chem. 277:32086-32093(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 42-218. |
| [17] | "Molecular characterization of a genetic variant of the steroid hormone-binding globulin gene in heterozygous subjects." Hardy D.O., Carino C., Catterall J.F., Larrea F. J. Clin. Endocrinol. Metab. 80:1253-1256(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ASN-356. |
| [18] | "Characterization of single-nucleotide polymorphisms in coding regions of human genes." Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 22:231-238(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HIS-25 AND ASN-356. |
| [19] | Erratum Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 23:373-373(1999) |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Androgen-binding protein entry |
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X16349 Genomic DNA. Translation: CAA34398.1. X16350 Genomic DNA. Translation: CAA34399.1. X16351 mRNA. Translation: CAA34400.1. M31651 Genomic DNA. Translation: AAC18778.1. CD013955 mRNA. No translation available. BC069597 mRNA. Translation: AAH69597.1. BC101785 mRNA. Translation: AAI01786.1. BC112186 mRNA. Translation: AAI12187.1. AC007421 Genomic DNA. No translation available. X05403 mRNA. Translation: CAA28987.1. EU352661 mRNA. Translation: ABY67999.1. X05885 mRNA. Translation: CAA29309.1. Frameshift. X05792 mRNA. Translation: CAA29234.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00023019. IPI00219583. IPI00884913. IPI00940099. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | BOHUS. S09606. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001031.2. NM_001040.3. NP_001139752.1. NM_001146280.1. NP_001139753.1. NM_001146281.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.632235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P04278. 2 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000369816. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GlycoSuiteDB | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 134907. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PeptideAtlas | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 6462. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000380450; ENSP00000369816; ENSG00000129214. ENST00000416273; ENSP00000388867; ENSG00000129214. ENST00000441599; ENSP00000393426; ENSG00000129214. ENST00000575903; ENSP00000458973; ENSG00000129214. ENST00000576830; ENSP00000460219; ENSG00000129214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 6462. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:6462. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002gie.2. human. uc010cmp.2. human. uc010cnb.2. human. uc010vuf.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 6462. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC17P007519. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:10839. SHBG. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 182205. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA35745. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG39525. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000285982. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG017800. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | EIQLHNH. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4RFKTB. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SHBG. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000129214. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 2.60.120.200. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR008985. ConA-like_lec_gl_sf. IPR013320. ConA-like_subgrp. IPR001791. Laminin_G. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00054. Laminin_G_1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00282. LamG. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49899. ConA_like_lec_gl. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50025. LAM_G_DOMAIN. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL3305. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | SHBG. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB01406. Danazol. DB00858. Dromostanolone. DB00783. Estradiol. DB00655. Estrone. DB01185. Fluoxymesterone. DB00741. Hydrocortisone. DB00648. Mitotane. DB00717. Norethindrone. DB00624. Testosterone. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P04278. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 6462. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 25109. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SHBG_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P04278 Secondary accession number(s): B0FWH4 Q6ISD2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
