P04234 (CD3D_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 139.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: T-cell surface glycoprotein CD3 delta chain Alternative name(s): T-cell receptor T3 delta chain CD_antigen=CD3d | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 171 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The CD3 complex mediates signal transduction. |
| Subunit structure | The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. Ref.12 |
| Subcellular location | |
| Involvement in disease | Severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)B(+)NK(+) SCID) [MIM:608971]: A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. |
| Sequence similarities | Contains 1 ITAM domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P04234-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P04234-2) The sequence of this isoform differs from the canonical sequence as follows: 92-136: MCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGA → T | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | |||||||||||||||||||||||
| Chain | 22 – 171 | 150 | T-cell surface glycoprotein CD3 delta chain | PRO_0000016487 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Topological domain | 22 – 105 | 84 | Extracellular Potential | ||||||||||||||||||||||
| Transmembrane | 106 – 126 | 21 | Helical; Potential | ||||||||||||||||||||||
| Topological domain | 127 – 171 | 45 | Cytoplasmic Potential | ||||||||||||||||||||||
| Domain | 138 – 166 | 29 | ITAM | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Modified residue | 149 | 1 | Phosphotyrosine Ref.9 Ref.10 | ||||||||||||||||||||||
| Modified residue | 160 | 1 | Phosphotyrosine Ref.11 | ||||||||||||||||||||||
| Glycosylation | 38 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||
| Glycosylation | 74 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||
| Disulfide bond | 37 ↔ 73 | Ref.12 | |||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 92 – 136 | 45 | MCQSC…RLSGA → T in isoform 2. | VSP_045800 | |||||||||||||||||||||
| Natural variant | 147 | 1 | Q → R. Corresponds to variant rs45510201 [ dbSNP | Ensembl ]. | VAR_049646 | |||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Beta strand | 26 – 29 | 4 | |||||||||||||||||||||||
| Beta strand | 32 – 36 | 5 | |||||||||||||||||||||||
| Beta strand | 41 – 46 | 6 | |||||||||||||||||||||||
| Beta strand | 50 – 52 | 3 | |||||||||||||||||||||||
| Helix | 53 – 55 | 3 | |||||||||||||||||||||||
| Beta strand | 57 – 62 | 6 | |||||||||||||||||||||||
| Helix | 63 – 65 | 3 | |||||||||||||||||||||||
| Beta strand | 68 – 73 | 6 | |||||||||||||||||||||||
| Beta strand | 84 – 91 | 8 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Exon/intron organization of the genes coding for the delta chains of the human and murine T-cell receptor/T3 complex." van den Elsen P., Georgopoulos K., Shepley B.-A., Orkin S., Terhorst C. Proc. Natl. Acad. Sci. U.S.A. 83:2944-2948(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "Isolation of cDNA clones encoding the 20K T3 glycoprotein of human T-cell receptor complex." van den Elsen P., Shepley B.-A., Borst J., Coligan J.E., Markham A.F., Orkin S., Terhorst C. Nature 312:413-418(1984) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "T3 delta pre-mRNA is transcribed from a non-TATA promoter and is alternatively spliced in human T cells." Tunnacliffe A., Sims J.E., Rabbitts T.H. EMBO J. 5:1245-1252(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "PCR isolation and cloning of novel splice variant mRNAs from known drug target genes." Jin P., Fu G.K., Wilson A.D., Yang J., Chien D., Hawkins P.R., Au-Young J., Stuve L.L. Genomics 83:566-571(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Blood. |
| [7] | "Dephosphorylation of the human T lymphocyte CD3 antigen." Alexander D., Goris J., Marais R., Rothbard J., Merlevede W., Crumpton M.J. Eur. J. Biochem. 181:55-65(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 128-171. |
| [8] | "Effect of CD3delta deficiency on maturation of alpha/beta and gamma/delta T-cell lineages in severe combined immunodeficiency." Dadi H.K., Simon A.J., Roifman C.M. N. Engl. J. Med. 349:1821-1828(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN T(-)B(+)NK(+) SCID. |
| [9] | "Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry." Salomon A.R., Ficarro S.B., Brill L.M., Brinker A., Phung Q.T., Ericson C., Sauer K., Brock A., Horn D.M., Schultz P.G., Peters E.C. Proc. Natl. Acad. Sci. U.S.A. 100:443-448(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-149, MASS SPECTROMETRY. |
| [10] | "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry." Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C. Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-149, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-160, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "Crystal structure of a human CD3-epsilon/delta dimer in complex with a UCHT1 single-chain antibody fragment." Arnett K.L., Harrison S.C., Wiley D.C. Proc. Natl. Acad. Sci. U.S.A. 101:16268-16273(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 23-100 IN COMPLEX WITH CD3E AND ANTIBODY FRAGMENT, SUBUNIT, DISULFIDE BOND. |
| + | Additional computationally mapped references. |
Web resources
| CD3Dbase CD3D mutation db |
| GeneReviews |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X03934 Genomic DNA. Translation: CAA27573.1. M12727, M12726 Genomic DNA. Translation: AAA51792.1. CD014058 mRNA. No translation available. AP001582 Genomic DNA. No translation available. BC039035 mRNA. Translation: AAH39035.1. BC070321 mRNA. Translation: AAH70321.1. X01451 Genomic DNA. Translation: CAA25683.1. | ||||||||||||
| IPI | IPI00022934. IPI00759573. | ||||||||||||
| PIR | RWHUD1. A94706. | ||||||||||||
| RefSeq | NP_000723.1. NM_000732.4. NP_001035741.1. NM_001040651.1. | ||||||||||||
| UniGene | Hs.504048. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| DisProt | DP00505. | ||||||||||||
| ProteinModelPortal | P04234. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P04234. 1 interaction. | ||||||||||||
| MINT | MINT-3374023. | ||||||||||||
| STRING | 9606.ENSP00000300692. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P04234. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 115985. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P04234. | ||||||||||||
| PRIDE | P04234. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000300692; ENSP00000300692; ENSG00000167286. ENST00000392884; ENSP00000376622; ENSG00000167286. | ||||||||||||
| GeneID | 915. | ||||||||||||
| KEGG | hsa:915. | ||||||||||||
| UCSC | uc001pss.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 915. | ||||||||||||
| GeneCards | GC11M118212. | ||||||||||||
| HGNC | HGNC:1673. CD3D. | ||||||||||||
| HPA | CAB013055. | ||||||||||||
| MIM | 186790. gene. 608971. phenotype. | ||||||||||||
| neXtProt | NX_P04234. | ||||||||||||
| Orphanet | 169160. Severe combined immunodeficiency T- B+ due to CD3delta/CD3epsilon/CD3zeta. | ||||||||||||
| PharmGKB | PA26215. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG41968. | ||||||||||||
| HOGENOM | HOG000015287. | ||||||||||||
| HOVERGEN | HBG005278. | ||||||||||||
| InParanoid | P04234. | ||||||||||||
| KO | K06450. | ||||||||||||
| OMA | IIVTDVI. | ||||||||||||
| OrthoDB | EOG4VHK7K. | ||||||||||||
| PhylomeDB | P04234. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | cd8tcrdownstreampathway. Downstream signaling in naive CD8+ T cells. il12_stat4pathway. IL12 signaling mediated by STAT4. il12_2pathway. IL12-mediated signaling events. tcrpathway. TCR signaling in naive CD4+ T cells. cd8tcrpathway. TCR signaling in naive CD8+ T cells. | ||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P04234. | ||||||||||||
| Bgee | P04234. | ||||||||||||
| CleanEx | HS_CD3D. | ||||||||||||
| Genevestigator | P04234. | ||||||||||||
| GermOnline | ENSG00000167286. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.60.40.10. 1 hit. | ||||||||||||
| InterPro | IPR015485. CD3_delta. IPR015484. CD3_gsu/dsu. IPR013783. Ig-like_fold. IPR003110. Phos_immunorcpt_sig_ITAM. [Graphical view] | ||||||||||||
| PANTHER | PTHR10570. PTHR10570. 1 hit. PTHR10570:SF1. PTHR10570:SF1. 1 hit. | ||||||||||||
| Pfam | PF02189. ITAM. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00077. ITAM. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS51055. ITAM_1. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | CD3D. human. | ||||||||||||
| EvolutionaryTrace | P04234. | ||||||||||||
| GenomeRNAi | 915. | ||||||||||||
| NextBio | 3784. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CD3D_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P04234 Secondary accession number(s): A8MVP6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
