Reviewed,
UniProtKB/Swiss-Prot P04150 (GCR_HUMAN)
Last modified
January 19, 2010.
Version 158.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Glucocorticoid receptor Short name=GR Alternative name(s): Nuclear receptor subfamily 3 group C member 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 777 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Involved in chromatin remodeling. Plays a significant role in transactivation. Involved in nuclear translocation By similarity. |
| Subunit structure | Heteromultimeric cytoplasmic complex with HSP90, HSP70, and FKBP5 or another immunophilin, or the immunophilin homolog PPP5C. Directly interacts with UNC45A. Upon ligand binding FKBP5 dissociates from the complex and FKBP4 takes its place, thereby linking the complex to dynein and mediating transport to the nucleus, where the complex dissociates By similarity. Binds to DNA as a homodimer, and as a heterodimer with NR3C2 or the retinoid X receptor. Binds STAT5A and STAT5B homodimers and heterodimers. Interacts with NRIP1, POU2F1, POU2F2 and TRIM28. Interacts with NCOA1, NCOA3, SMARCA4, SMARCC1, SMARCD1, and SMARCE1 By similarity. Interacts with several coactivator complexes, including the SMARCA4 complex, CREBBP/EP300, TADA2L and p160 coactivators such as NCOA2 and NCOA6. Interaction with BAG1 inhibits transactivation. Interacts with HEXIM1, PELP1 and TGFB1I1. Ref.15 Ref.16 Ref.17 Ref.20 Ref.27 Ref.29 Ref.30 Ref.31 Ref.52 |
| Subcellular location | Cytoplasm. Nucleus. Note: Cytoplasmic in the absence of ligand, nuclear after ligand-binding. Isoform Beta: Nucleus. Note: Localized largely in the nucleus. |
| Tissue specificity | Widely expressed. In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node as well as whole adult and fetal heart. Ref.19 |
| Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal steroid-binding domain. Ref.13 |
| Post-translational modification | Increased proteasome-mediated degradation in response to glucocorticoids. Phosphorylated in the absence of hormone; becomes hyperphosphorylated in the presence of glucocorticoid. The Ser-203-phosphorylated form is mainly cytoplasmic, and the Ser-211-phosphorylated form is nuclear. Transcriptional activity correlates with the amount of phosphorylation at Ser-211. Ref.26 Ref.32 Ref.33 Ref.35 Sumoylated; this reduces transcription transactivation. Ref.25 Ubiquitinated; restricts glucocorticoid-mediated transcriptional signaling By similarity. |
| Polymorphism | Carriers of the 22-Glu-Lys-23 allele are relatively more resistant to the effects of GCs with respect to the sensitivity of the adrenal feedback mechanism than non-carriers, resulting in a better metabolic health profile. Carriers have a better survival than non-carriers, as well as lower serum CRP levels. The 22-Glu-Lys-23 polymorphism is associated with a sex-specific, beneficial body composition at young-adult age, as well as greater muscle strength in males. |
| Involvement in disease | Defects in NR3C1 are a cause of glucocorticoid resistance [MIM:138040]; also known as cortisol resistance. It is a hypertensive, hyperandrogenic disorder characterized by increased serum cortisol concentrations. Inheritance is autosomal dominant. Ref.52 Ref.38 Ref.41 Ref.47 Ref.49 |
| Miscellaneous | High constitutive expression of isoform beta by neutrophils may provide a mechanism by which these cells escape glucocorticoid-induced cell death. Up-regulation by proinflammatory cytokines such as IL8 further enhances their survival in the presence of glucocorticoids during inflammation. Can up- or down-modulate aggregation and nuclear localization of expanded polyglutamine polypeptides derived from AR and HD through specific regulation of gene expression. Aggregation and nuclear localization of expanded polyglutamine proteins are regulated cellular processes that can be modulated by this receptor, a well-characterized transcriptional regulator. |
| Sequence similarities | Belongs to the nuclear hormone receptor family. NR3 subfamily. Contains 1 nuclear receptor DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Mvp | Q62667 | 1 | EBI-493507,EBI-918333 | From a different organism. |
| SMARCA4 | P51532 | 1 | EBI-493507,EBI-302489 | |
| SMARCC1 | Q92922 | 1 | EBI-493507,EBI-355653 |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] Note: At least 4 isoforms, Alpha (shown here), Alpha-B, Beta and Beta-B, are produced by alternative initiation at Met-1 and Met-27. The existence of isoform Alpha and isoform Alpha-B has been proved by mutagenesis. As the sequence environment of the 2 potential ATG initiator codons is the same for the other altrnatively spliced isoforms, alternative initiation of translation could also occur on these transcripts. Additional isoforms seem to exist. | ||||||
| Isoform Alpha (identifier: P04150-1) Also known as: Alpha-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Predominant physiological form. Isoform Alpha-B is produced by alternative initiation at Met-27 of isoform Alpha. Both isoforms exhibit similar subcellular location and nuclear translocation after ligand activation. Isoform Alpha-B appears to be more susceptible to degradation, at least when expressed in mammalian cells, but more effective in transcriptional activation and not in transrepression. | ||||||
| Isoform Beta (identifier: P04150-2) Also known as: Beta-A; The sequence of this isoform differs from the canonical sequence as follows: 728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI | ||||||
| Note: Localized largely in the nucleus. No hormone-binding activity. Widely expressed at low level. Localized largely in the nucleus. | ||||||
| Isoform Alpha-2 (identifier: P04150-3) Also known as: Gamma; The sequence of this isoform differs from the canonical sequence as follows: 451-451: G → GR | ||||||
| Note: Due to a partial intron retention. Lower transcriptional activity. Expressed at low level. | ||||||
| Isoform Beta-2 (identifier: P04150-6) The sequence of this isoform differs from the canonical sequence as follows: 451-451: G → GR 728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI | ||||||
| Note: Due to a partial intron retention. | ||||||
| Isoform GR-A alpha (identifier: P04150-5) The sequence of this isoform differs from the canonical sequence as follows: 491-674: Missing. | ||||||
| Note: Lacks exons 5, 6 and 7. Found in glucocorticoid-resistant myeloma patients. | ||||||
| Isoform GR-A beta (identifier: P04150-7) The sequence of this isoform differs from the canonical sequence as follows: 491-674: Missing. 728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI | ||||||
| Note: Lacks exons 5, 6 and 7. | ||||||
| Isoform GR-P (identifier: P04150-4) The sequence of this isoform is not available. | ||||||
| Note: Encoded by exons 2-7 plus several basepairs from the subsequent intron region. Lacks the ligand binding domain. Accounts for up to 10-20% of mRNAs. | ||||||
| Isoform Alpha-B (identifier: P04150-8) Also known as: Beta-B; The sequence of this isoform differs from the canonical sequence as follows: 1-26: Missing. | ||||||
| Note: Produced by alternative initiation at Met-27 of isoform Alpha. Both isoforms exhibit similar subcellular location and nuclear translocation after ligand activation. Isoform Alpha-B appears to be more susceptible to degradation, at least when expressed in mammalian cells, but more effective in transcriptional activation and not in transrepression. | ||||||
| Isoform Beta-B (identifier: P04150-9) The sequence of this isoform differs from the canonical sequence as follows: 1-26: Missing. 728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI | ||||||
| Note: Produced by alternative initiation at Met-27 of isoform Beta. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 777 | 777 | Glucocorticoid receptor | PRO_0000019937 | ||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 421 – 486 | 66 | Nuclear receptor | |||||||||||||||||||||||||||||||||||||||
| Zinc finger | 421 – 441 | 21 | NR C4-type | |||||||||||||||||||||||||||||||||||||||
| Zinc finger | 457 – 481 | 25 | NR C4-type | |||||||||||||||||||||||||||||||||||||||
| Region | 1 – 420 | 420 | Modulating | |||||||||||||||||||||||||||||||||||||||
| Region | 487 – 527 | 41 | Hinge | |||||||||||||||||||||||||||||||||||||||
| Region | 528 – 777 | 250 | Steroid-binding | |||||||||||||||||||||||||||||||||||||||
| Compositional bias | 399 – 418 | 20 | Glu/Pro/Ser/Thr-rich (PEST region) | |||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 8 | 1 | Phosphothreonine Ref.32 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 45 | 1 | Phosphoserine Ref.32 Ref.35 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 113 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 134 | 1 | Phosphoserine Ref.33 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 141 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 203 | 1 | Phosphoserine Ref.26 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 211 | 1 | Phosphoserine Ref.26 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 226 | 1 | Phosphoserine Ref.33 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 234 | 1 | Phosphoserine Ref.33 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 267 | 1 | Phosphoserine Ref.33 | |||||||||||||||||||||||||||||||||||||||
| Cross-link | 277 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||||||||||||||||||||||||||||||||||||||
| Cross-link | 293 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||||||||||||||||||||||||||||||||||||||
| Cross-link | 419 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Probable | ||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 26 | 26 | Missing in isoform Alpha-B and isoform Beta-B. | VSP_018773 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 451 | 1 | G → GR in isoform Alpha-2 and isoform Beta-2. | VSP_007363 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 491 – 674 | 184 | Missing in isoform GR-A alpha and isoform GR-A beta. | VSP_013340 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 728 – 777 | 50 | VVENL…LFHQK → NVMWLKPESTSHTLI in isoform Beta, isoform Beta-B, isoform Beta-2 and isoform GR-A beta. | VSP_003703 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 23 | 1 | R → K: dbSNP rs6190. Ref.6 Ref.43 Ref.44 Ref.46 Ref.50 Ref.53 Ref.54 | VAR_014140 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 29 | 1 | F → L | VAR_015628 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 65 | 1 | F → V: dbSNP rs6192. Ref.6 Ref.44 | VAR_014622 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 112 | 1 | L → F | VAR_015629 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 233 | 1 | D → N | VAR_015630 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 363 | 1 | N → S May increase sensitivity to exogenously administered glucocorticoids; may contribute to central obesity in men and show lack of association with other risk factors for coronary heart disease and diabetes mellitus. dbSNP rs6195. Ref.43 Ref.44 Ref.46 Ref.40 Ref.48 | VAR_004675 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 421 | 1 | C → Y in a glucocorticoid resistant leukemia cell line. Ref.39 | VAR_015631 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 477 | 1 | R → H in glucocorticoid resistance. Ref.47 | VAR_013472 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 559 | 1 | I → N in glucocorticoid resistance; interferes with translocation to the nucleus and thereby strongly reduces transcription activation. Is equally impaired in nuclear export. Acts as dominant negative mutant. Ref.49 | VAR_015632 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 571 | 1 | V → A in pseudohermaphroditism; female with hypokalemia due to glucocorticoid resistance; 6-fold reduction in binding affinity compared with the wild-type receptor. Ref.51 | VAR_025014 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 641 | 1 | D → V in glucocorticoid resistance. Ref.38 | VAR_004676 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 679 | 1 | G → S in glucocorticoid resistance; has 50% binding affinity. Ref.47 | VAR_013473 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 729 | 1 | V → I in glucocorticoid resistance. Ref.41 | VAR_004677 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 747 | 1 | I → M in glucocorticoid resistance; alters interaction with NCOA2 and strongly reduces transcription activation; acts as dominant negative mutant. Ref.52 | VAR_015633 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 753 | 1 | L → F in two glucocorticoid resistant leukemia cell lines lacking the normal allele. Ref.39 Ref.42 | VAR_004678 | ||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1 | 1 | M → T: Abolishes expression of A-type isoforms. Ref.24 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 27 | 1 | M → T: Abolishes expression of B-type isoforms. Ref.24 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 191 | 1 | F → D: Reduces transactivation by the ADA complex. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 193 | 1 | I → D: Reduces transactivation by the ADA complex. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 194 | 1 | L → A: Strongly reduces transactivation by the ADA complex; when associated with V-224 and F-225. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 197 | 1 | L → E: Reduces transactivation by the ADA complex. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 213 | 1 | W → A: Strongly reduces transactivation by the ADA complex. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 224 | 1 | L → V: Strongly reduces transactivation by the ADA complex; when associated with A-194 and F-225. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 225 | 1 | L → F: Strongly reduces transactivation by the ADA complex; when associated with A-194 and V-224. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 235 | 1 | F → L: Strongly reduces transactivation by the ADA complex; when associated with V-236. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 236 | 1 | L → V: Strongly reduces transactivation by the ADA complex; when associated with L-235. Ref.15 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 277 | 1 | K → R: Strongly reduces sumoylation. Almost complete loss of sumoylation; when associated with R-293. Ref.25 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 293 | 1 | K → R: Strongly reduces sumoylation. Almost complete loss of sumoylation; when associated with R-277. Ref.25 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 585 | 1 | R → A: Reduces activation mediated by ligand binding domain; when associated with A-590. Ref.36 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 590 | 1 | D → A: Reduces activation mediated by ligand binding domain; when associated with A-585. Ref.36 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 602 | 1 | F → S: Increases solubility. No effect on transactivation by dexamethasone. Ref.36 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 625 | 1 | P → A: Decreases transactivation by dexamethasone by 95%. Ref.36 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 628 | 1 | I → A: Decreases dimerization and transactivation by dexamethasone; when associated with S-602. Ref.36 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 703 | 1 | K → R: Slightly reduces sumoylation. Ref.25 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 399 | 1 | R → G in BAD97314. Ref.4 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 754 | 1 | A → T in BAD97314. Ref.4 | |||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 525 – 527 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 532 – 539 | 8 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 556 – 578 | 23 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 584 – 586 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 589 – 616 | 28 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 619 – 624 | 6 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 627 – 629 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 633 – 635 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 639 – 655 | 17 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 660 – 671 | 12 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 673 – 676 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 683 – 704 | 22 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 709 – 732 | 24 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 735 – 739 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 740 – 746 | 7 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 749 – 757 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 769 – 771 | 3 | ||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Primary structure and expression of a functional human glucocorticoid receptor cDNA." Hollenberg S.M., Weinberger C., Ong E.S., Cerelli G., Oro A., Lebo R., Thompson E.B., Rosenfeld M.G., Evans R.M. Nature 318:635-641(1985) [PubMed: 2867473] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA). Tissue: Fibroblast. |
| [2] | "The genomic structure of the human glucocorticoid receptor." Encio I.J., Detera-Wadleigh S.D. J. Biol. Chem. 266:7182-7188(1991) [PubMed: 1707881] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS ALPHA AND BETA). |
| [3] | "Alternative splicing within the DNA binding domain creates a novel isoform of the human glucocorticoid receptor." Munroe D.G., Pang J., Taylor G.R., Lau C., Plante R.K., Zhou L. Submitted (SEP-1993) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA-2). Tissue: Osteosarcoma. |
| [4] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Kidney. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Uterine endothelium. |
| [6] | NIEHS SNPs program Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-23 AND VAL-65. |
| [7] | NHLBI resequencing and genotyping service (RS&G) Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [8] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed: 15372022] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Placenta. |
| [11] | "Purification of a human glucocorticoid receptor gene promoter-binding protein. Production of polyclonal antibodies against the purified factor." Leclerc S., Xie B.X., Roy R., Govindan M.V. J. Biol. Chem. 266:8711-8719(1991) [PubMed: 2026589] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-394. |
| [12] | "Human glucocorticoid receptor gene promotor-homologous down regulation." Govindan M.V., Pothier F., Leclerc S., Palaniswami R., Xie B. J. Steroid Biochem. Mol. Biol. 40:317-323(1991) [PubMed: 1958537] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-394. |
| [13] | "Domain structure of human glucocorticoid receptor and its relationship to the v-erb-A oncogene product." Weinberger C., Hollenberg S.M., Rosenfeld M.G., Evans R.M. Nature 318:670-672(1985) [PubMed: 3841189] [Abstract] Cited for: DOMAINS. |
| [14] | "Alternatively spliced glucocorticoid receptor messenger RNAs in glucocorticoid-resistant human multiple myeloma cells." Moalli P.A., Pillay S., Krett N.L., Rosen S.T. Cancer Res. 53:3877-3879(1993) [PubMed: 8358712] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS GP-P; GP-A ALPHA AND GP-A BETA). |
| [15] | "Role of the Ada adaptor complex in gene activation by the glucocorticoid receptor." Henriksson A., Almloef T., Ford J., McEwan I.J., Gustafsson J.-A., Wright A.P.H. Mol. Cell. Biol. 17:3065-3073(1997) [PubMed: 9154805] [Abstract] Cited for: INTERACTION WITH TADA2L AND THE ADA COMPLEX, MUTAGENESIS OF PHE-191; ILE-193; LEU-194; LEU-197; TRP-213; LEU-224; LEU-225; PHE-235 AND LEU-236. |
| [16] | "Chromatin remodelling by the glucocorticoid receptor requires the BRG1 complex." Fryer C.J., Archer T.K. Nature 393:88-91(1998) [PubMed: 9590696] [Abstract] Cited for: INTERACTION WITH THE SMARCA4 COMPLEX; NCOA1; NCOA2 AND THE CREBBP/EP300 COMPLEX. |
| [17] | "A nuclear action of the eukaryotic cochaperone RAP46 in downregulation of glucocorticoid receptor activity." Schneikert J., Huebner S., Martin E., Cato A.B.C. J. Cell Biol. 146:929-940(1999) [PubMed: 10477749] [Abstract] Cited for: INTERACTION WITH BAG1. |
| [18] | "Insertion of an amino acid in the DNA-binding domain of the glucocorticoid receptor as a result of alternative splicing." Rivers C., Levy A., Hancock J., Lightman S., Norman M. J. Clin. Endocrinol. Metab. 84:4283-4286(1999) [PubMed: 10566686] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS ALPHA-2 AND BETA-2). |
| [19] | "Steroidogenic enzyme gene expression in the human heart." Kayes-Wandover K.M., White P.C. J. Clin. Endocrinol. Metab. 85:2519-2525(2000) [PubMed: 10902803] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [20] | "A new family of nuclear receptor coregulators that integrates nuclear receptor signaling through CBP." Mahajan M.A., Samuels H.H. Mol. Cell. Biol. 20:5048-5063(2000) [PubMed: 10866662] [Abstract] Cited for: INTERACTION WITH NCOA6. |
| [21] | "Regulation of expanded polyglutamine protein aggregation and nuclear localization by the glucocorticoid receptor." Diamond M.I., Robinson M.R., Yamamoto K.R. Proc. Natl. Acad. Sci. U.S.A. 97:657-661(2000) [PubMed: 10639135] [Abstract] Cited for: EFFECT ON EXPANDED POLYGLUTAMINE PROTEIN. |
| [22] | "Proteasome-mediated glucocorticoid receptor degradation restricts transcriptional signaling by glucocorticoids." Wallace A.D., Cidlowski J.A. J. Biol. Chem. 276:42714-42721(2001) [PubMed: 11555652] [Abstract] Cited for: GLUCOCORTICOID-MEDIATED DOWN-REGULATION. |
| [23] | "High constitutive glucocorticoid receptor beta in human neutrophils enables them to reduce their spontaneous rate of cell death in response to corticosteroids." Strickland I., Kisich K., Hauk P.J., Vottero A., Chrousos G.P., Klemm D.J., Leung D.Y.M. J. Exp. Med. 193:585-593(2001) [PubMed: 11238589] [Abstract] Cited for: REDUCTION OF CELL DEATH IN RESPONSE TO CORTICOSTEROIDS. |
| [24] | "Molecular identification and characterization of A and B forms of the glucocorticoid receptor." Yudt M.R., Cidlowski J.A. Mol. Endocrinol. 15:1093-1103(2001) [PubMed: 11435610] [Abstract] Cited for: ALTERNATIVE INITIATION, MUTAGENESIS OF MET-1 AND MET-27. |
| [25] | "Small ubiquitin-related modifier-1 (SUMO-1) modification of the glucocorticoid receptor." Tian S., Poukka H., Palvimo J.J., Jaenne O.A. Biochem. J. 367:907-911(2002) [PubMed: 12144530] [Abstract] Cited for: SUMOYLATION, MUTAGENESIS OF LYS-277; LYS-293 AND LYS-703. |
| [26] | "Deciphering the phosphorylation 'code' of the glucocorticoid receptor in vivo." Wang Z., Frederick J., Garabedian M.J. J. Biol. Chem. 277:26573-26580(2002) [PubMed: 12000743] [Abstract] Cited for: PHOSPHORYLATION AT SER-203 AND SER-211. |
| [27] | "Estrogen receptor-interacting protein that modulates its nongenomic activity-crosstalk with Src/Erk phosphorylation cascade." Wong C.-W., McNally C., Nickbarg E., Komm B.S., Cheskis B.J. Proc. Natl. Acad. Sci. U.S.A. 99:14783-14788(2002) [PubMed: 12415108] [Abstract] Cited for: INTERACTION WITH PELP1. |
| [28] | "The origin and functions of multiple human glucocorticoid receptor isoforms." Lu N.Z., Cidlowski J.A. Ann. N. Y. Acad. Sci. 1024:102-123(2004) [PubMed: 15265776] [Abstract] Cited for: REVIEW ON ALTERNATIVE SPLICING, ALTERNATIVE INITIATION, POST-TRANSLATIONAL MODIFICATIONS. |
| [29] | "Distinct LIM domains of Hic-5/ARA55 are required for nuclear matrix targeting and glucocorticoid receptor binding and coactivation." Guerrero-Santoro J., Yang L., Stallcup M.R., DeFranco D.B. J. Cell. Biochem. 92:810-819(2004) [PubMed: 15211577] [Abstract] Cited for: INTERACTION WITH TGFB1I1. |
| [30] | "HEXIM1 forms a transcriptionally abortive complex with glucocorticoid receptor without involving 7SK RNA and positive transcription elongation factor b." Shimizu N., Ouchida R., Yoshikawa N., Hisada T., Watanabe H., Okamoto K., Kusuhara M., Handa H., Morimoto C., Tanaka H. Proc. Natl. Acad. Sci. U.S.A. 102:8555-8560(2005) [PubMed: 15941832] [Abstract] Cited for: INTERACTION WITH HEXIM1. |
| [31] | "GCUNC-45 is a novel regulator for the progesterone receptor/hsp90 chaperoning pathway." Chadli A., Graham J.D., Abel M.G., Jackson T.A., Gordon D.F., Wood W.M., Felts S.J., Horwitz K.B., Toft D. Mol. Cell. Biol. 26:1722-1730(2006) [PubMed: 16478993] [Abstract] Cited for: INTERACTION WITH UNC45A. |
| [32] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-8 AND SER-45, MASS SPECTROMETRY. |
| [33] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-134; SER-226; SER-234 AND SER-267, MASS SPECTROMETRY. |
| [34] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [35] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45, MASS SPECTROMETRY. |
| [36] | "Crystal structure of the glucocorticoid receptor ligand binding domain reveals a novel mode of receptor dimerization and coactivator recognition." Bledsoe R.K., Montana V.G., Stanley T.B., Delves C.J., Apolito C.J., McKee D.D., Consler T.G., Parks D.J., Stewart E.L., Willson T.M., Lambert M.H., Moore J.T., Pearce K.H., Xu H.E. Cell 110:93-105(2002) [PubMed: 12151000] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 521-777 OF MUTANT SER-602 IN COMPLEX WITH NCOA2; DEXAMETHASONE AND RU-486, MUTAGENESIS OF ARG-585; ASP-590; PHE-602; PRO-625 AND ILE-628. |
| [37] | "The three-dimensional structures of antagonistic and agonistic forms of the glucocorticoid receptor ligand-binding domain: RU-486 induces a transconformation that leads to active antagonism." Kauppi B., Jakob C., Faernegaardh M., Yang J., Ahola H., Alarcon M., Calles K., Engstrom O., Harlan J., Muchmore S., Ramqvist A.-K., Thorell S., Oehman L., Greer J., Gustafsson J.-A., Carlstedt-Duke J., Carlquist M. J. Biol. Chem. 278:22748-22754(2003) [PubMed: 12686538] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 500-777 OF MUTANT SER-602 IN COMPLEX WITH COACTIVATOR PEPTIDE; DEXAMETHASONE AND WITH RU-486. |
| [38] | "Point mutation causing a single amino acid substitution in the hormone binding domain of the glucocorticoid receptor in familial glucocorticoid resistance." Hurley D.M., Accili D., Stratakis C.A., Karl M., Vamvakopoulos N., Rorer E., Constantine K., Taylor S.I., Chrousos G.P. J. Clin. Invest. 87:680-686(1991) [PubMed: 1704018] [Abstract] Cited for: CHARACTERIZATION OF VARIANT GLUCOCORTICOID RESISTANCE VAL-641. |
| [39] | "Cloning and expression of mutant glucocorticoid receptors from glucocorticoid-sensitive and -resistant human leukemic cells." Powers J.H., Hillmann A.G., Tang D.C., Harmon J.M. Cancer Res. 53:4059-4065(1993) [PubMed: 8358735] [Abstract] Cited for: VARIANTS TYR-421 AND PHE-753. |
| [40] | "Familial glucocorticoid resistance caused by a splice site deletion in the human glucocorticoid receptor gene." Karl M., Lamberts S.W.J., Detera-Wadleigh S.D., Encio I.J., Stratakis C.A., Hurley D.M., Accili D., Chrousos G.P. J. Clin. Endocrinol. Metab. 76:683-689(1993) [PubMed: 8445027] [Abstract] Cited for: VARIANT SER-363. |
| [41] | "A mutation of the glucocorticoid receptor in primary cortisol resistance." Malchoff D.M., Brufsky A., Reardon G., McDermott P., Javier E.C., Bergh C.H., Rowe D., Malchoff C.D. J. Clin. Invest. 91:1918-1925(1993) [PubMed: 7683692] [Abstract] Cited for: VARIANT GLUCOCORTICOID RESISTANCE ILE-729. |
| [42] | "Identification of the activation-labile gene: a single point mutation in the human glucocorticoid receptor presents as two distinct receptor phenotypes." Ashraf J., Thompson E.B. Mol. Endocrinol. 7:631-642(1993) [PubMed: 8316249] [Abstract] Cited for: VARIANT PHE-753. |
| [43] | "Lack of association between five polymorphisms in the human glucocorticoid receptor gene and glucocorticoid resistance." Koper J.W., Stolk R.P., de Lange P., Huizenga N.A.T.M., Molijn G.-J., Pols H.A.P., Grobbee D.E., Karl M., de Jong F.H., Brinkmann A.O., Lamberts S.W.J. Hum. Genet. 99:663-668(1997) [PubMed: 9150737] [Abstract] Cited for: VARIANTS LYS-23 AND SER-363. |
| [44] | "Characterization of single-nucleotide polymorphisms in coding regions of human genes." Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 22:231-238(1999) [PubMed: 10391209] [Abstract] Cited for: VARIANTS LYS-23; VAL-65 AND SER-363. |
| [45] | Erratum Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 23:373-373(1999) |
| [46] | "Five missense variants in the amino-terminal domain of the glucocorticoid receptor: no association with puerperal psychosis or schizophrenia." Feng J., Zheng J., Bennett W.P., Heston L.L., Jones I.R., Craddock N., Sommer S.S. Am. J. Med. Genet. 96:412-417(2000) [PubMed: 10898924] [Abstract] Cited for: VARIANTS LYS-23; LEU-29; PHE-112; ASN-233 AND SER-363. |
| [47] | "Characterization of two novel mutations in the glucocorticoid receptor gene in patients with primary cortisol resistance." Ruiz M., Lind U., Gaafvels M., Eggertsen G., Carlstedt-Duke J., Nilsson L., Holtmann M., Stierna P., Wikstroem A.-C., Werner S. Clin. Endocrinol. (Oxf.) 55:363-371(2001) [PubMed: 11589680] [Abstract] Cited for: VARIANTS GLUCOCORTICOID RESISTANCE HIS-477 AND SER-679. |
| [48] | "The N363S polymorphism of the glucocorticoid receptor: potential contribution to central obesity in men and lack of association with other risk factors for coronary heart disease and diabetes mellitus." Dobson M.G., Redfern C.P.F., Unwin N., Weaver J.U. J. Clin. Endocrinol. Metab. 86:2270-2274(2001) [PubMed: 11344238] [Abstract] Cited for: VARIANT SER-363. |
| [49] | "Pathologic human GR mutant has a transdominant negative effect on the wild-type GR by inhibiting its translocation into the nucleus: importance of the ligand-binding domain for intracellular GR trafficking." Kino T., Stauber R.H., Resau J.H., Pavlakis G.N., Chrousos G.P. J. Clin. Endocrinol. Metab. 86:5600-5608(2001) [PubMed: 11701741] [Abstract] Cited for: CHARACTERIZATION OF VARIANT GLUCOCORTICOID RESISTANCE ASN-559. |
| [50] | "A polymorphism in the glucocorticoid receptor gene, which decreases sensitivity to glucocorticoids in vivo, is associated with low insulin and cholesterol levels." van Rossum E.F.C., Koper J.W., Huizenga N.A.T.M., Uitterlinden A.G., Janssen J.A.M.J.L., Brinkmann A.O., Grobbee D.E., de Jong F.H., van Duyn C.M., Pols H.A.P., Lamberts S.W.J. Diabetes 51:3128-3134(2002) [PubMed: 12351458] [Abstract] Cited for: VARIANT LYS-23. |
| [51] | "Female pseudohermaphroditism caused by a novel homozygous missense mutation of the GR gene." Mendonca B.B., Leite M.V., de Castro M., Kino T., Elias L.L.K., Bachega T.A.S., Arnhold I.J.P., Chrousos G.P., Latronico A.C. J. Clin. Endocrinol. Metab. 87:1805-1809(2002) [PubMed: 11932321] [Abstract] Cited for: VARIANT PSEUDOHERMAPHRODITISM ALA-571. |
| [52] | "A novel, C-terminal dominant negative mutation of the GR causes familial glucocorticoid resistance through abnormal interactions with p160 steroid receptor coactivators." Vottero A., Kino T., Combe H., Lecomte P., Chrousos G.P. J. Clin. Endocrinol. Metab. 87:2658-2667(2002) [PubMed: 12050230] [Abstract] Cited for: VARIANT GLUCOCORTICOID RESISTANCE MET-747, ALTERED INTERACTION WITH THE COACTIVATOR NCOA2. |
| [53] | "Association of the ER22/23EK polymorphism in the glucocorticoid receptor gene with survival and C-reactive protein levels in elderly men." van Rossum E.F.C., Feelders R.A., van den Beld A.W., Uitterlinden A.G., Janssen J.A.M.J.L., Ester W., Brinkmann A.O., Grobbee D.E., de Jong F.H., Pols H.A.P., Koper J.W., Lamberts S.W.J. Am. J. Med. 117:158-162(2004) [PubMed: 15276593] [Abstract] Cited for: VARIANT LYS-23. |
| [54] | "The ER22/23EK polymorphism in the glucocorticoid receptor gene is associated with a beneficial body composition and muscle strength in young adults." van Rossum E.F.C., Voorhoeve P.G., te Velde S.J., Koper J.W., Delemarre-van de Waal H.A., Kemper H.C.G., Lamberts S.W.J. J. Clin. Endocrinol. Metab. 89:4004-4009(2004) [PubMed: 15292341] [Abstract] Cited for: VARIANT LYS-23. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X03225 mRNA. Translation: CAA26976.1. X03348 mRNA. Translation: CAA27054.1. U80946 U78512 Genomic DNA. Translation: AAB64353.1. U80947 U78512 Genomic DNA. Translation: AAB64354.1. U01351 mRNA. Translation: AAA16603.1. AK223594 mRNA. Translation: BAD97314.1. BX640610 mRNA. Translation: CAE45716.1. AY436590 Genomic DNA. Translation: AAQ97180.1. EU332858 Genomic DNA. Translation: ABY87547.1. AC005601 Genomic DNA. Translation: AAC34207.1. AC004782 Genomic DNA. No translation available. AC091925 Genomic DNA. No translation available. CH471062 Genomic DNA. Translation: EAW61872.1. BC015610 mRNA. Translation: AAH15610.1. M69104 Genomic DNA. Translation: AAA88049.1. M73816 Genomic DNA. Translation: AAA53151.1. S68378 Genomic DNA. Translation: AAB20466.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00022282. IPI00219946. IPI00251749. IPI00555880. IPI00604604. IPI00604725. IPI00759700. IPI00759729. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | QRHUGA. A93370. QRHUGB. B93370. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000167.1. NP_001018084.1. NP_001018085.1. NP_001018086.1. NP_001018087.1. NP_001018661.1. NP_001019265.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.122926 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P04150. Positions 420-491. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DisProt | DP00030. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-576N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P04150. 3 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000343796; ENSP00000343205; ENSG00000113580; Homo sapiens. [Genome view] ENST00000394464; ENSP00000377977; ENSG00000113580; Homo sapiens. [Genome view] ENST00000394466; ENSP00000377979; ENSG00000113580; Homo sapiens. [Genome view] ENST00000424646; ENSP00000405282; ENSG00000113580; Homo sapiens. [Genome view] ENST00000454007; ENSP00000415216; ENSG00000113580; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 2908. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2908. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003lmy.1. human. uc003lmz.1. human. uc003lna.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 2908. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC05M142639. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0005273. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:7978. NR3C1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB010435. HPA004248. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 138040. gene+phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 786. Glucocorticoid resistance. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA181. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG11959. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | LPDTKPK. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG91K1XR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | hnf3bpathway. FOXA2 and FOXA3 transcription factor networks. ar_tf_pathway. Regulation of Androgen receptor activity. smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. hdac_classii_pathway. Signaling events mediated by HDAC Class II. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_NR3C1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000113580. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001409. Glcrtcd_rcpt. IPR008946. Nucl_hormone_rcpt_ligand-bd. IPR000536. Nucl_hrmn_rcpt_lig-bd_core. IPR001723. Str_hrmn_rcpt. IPR001628. Znf_hrmn_rcpt. IPR013088. Znf_NHR/GATA. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.565.10. Nucl_hrmn_rcpt_lig_bd. 1 hit. G3DSA:3.30.50.10. Znf_NHR/GATA. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF02155. GCR. 1 hit. PF00104. Hormone_recep. 1 hit. PF00105. zf-C4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00528. GLCORTICOIDR. PR00398. STRDHORMONER. PR00047. STROIDFINGER. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00430. HOLI. 1 hit. SM00399. ZnF_C4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00031. NUCLEAR_REC_DBD_1. 1 hit. PS51030. NUCLEAR_REC_DBD_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P04150. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00288. Amcinonide. DB00443. Betamethasone. DB01222. Budesonide. DB01234. Dexamethasone. DB00663. Flumethasone Pivalate. DB00180. Flunisolide. DB00588. Fluticasone Propionate. DB00769. Hydrocortamate. DB00741. Hydrocortisone. DB00873. Loteprednol Etabonate. DB00959. Methylprednisolone. DB00834. Mifepristone. DB00764. Mometasone. DB00635. Prednisone. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 11517. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | GCR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P04150 Secondary accession number(s): B0LPG8 Q6N0A4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


