Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ig gamma-3 chain C region

Gene
N/A
Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • antigen binding Source: UniProtKB-KW
  • immunoglobulin receptor binding Source: AgBase
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ig gamma-3 chain C region
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei350 – 37021HelicalSequence analysisAdd
BLAST
Topological domaini371 – 39828CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini‹1 – 398›398Ig gamma-3 chain C regionPRO_0000153590Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi179 – 1791N-linked (GlcNAc...)1 Publication
Glycosylationi322 – 3221N-linked (GlcNAc...)Sequence analysis
Glycosylationi332 – 3321N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiP03987.
PeptideAtlasiP03987.
PRIDEiP03987.

Interactioni

GO - Molecular functioni

  • immunoglobulin receptor binding Source: AgBase

Protein-protein interaction databases

IntActiP03987. 1 interaction.
MINTiMINT-1507885.

Structurei

Secondary structure

1
398
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi6 – 105
Beta strandi20 – 3415
Beta strandi37 – 404
Turni41 – 444
Beta strandi49 – 513
Beta strandi61 – 7010
Turni71 – 766
Beta strandi79 – 857
Helixi86 – 883
Beta strandi90 – 967

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1CLZX-ray2.80H1-99[»]
2VQ1X-ray2.50B/F1-99[»]
ProteinModelPortaliP03987.
SMRiP03987. Positions 1-326.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP03987.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 9797CH1Add
BLAST
Regioni98 – 11316HingeAdd
BLAST
Regioni114 – 223110CH2Add
BLAST
Regioni224 – 327104CH3Add
BLAST

Keywords - Domaini

Immunoglobulin C region, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG005814.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR003597. Ig_C1-set.
[Graphical view]
PfamiPF07654. C1-set. 3 hits.
[Graphical view]
SMARTiSM00407. IGc1. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 3 hits.
PROSITEiPS50835. IG_LIKE. 3 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P03987-1) [UniParc]FASTAAdd to basket

Also known as: Membrane bound

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
TTTAPSVYPL VPGCSDTSGS SVTLGCLVKG YFPEPVTVKW NYGALSSGVR
60 70 80 90 100
TVSSVLQSGF YSLSSLVTVP SSTWPSQTVI CNVAHPASKT ELIKRIEPRI
110 120 130 140 150
PKPSTPPGSS CPPGNILGGP SVFIFPPKPK DALMISLTPK VTCVVVDVSE
160 170 180 190 200
DDPDVHVSWF VDNKEVHTAW TQPREAQYNS TFRVVSALPI QHQDWMRGKE
210 220 230 240 250
FKCKVNNKAL PAPIERTISK PKGRAQTPQV YTIPPPREQM SKKKVSLTCL
260 270 280 290 300
VTNFFSEAIS VEWERNGELE QDYKNTPPIL DSDGTYFLYS KLTVDTDSWL
310 320 330 340 350
QGEIFTCSVV HEALHNHHTQ KNLSRSPELE LNETCAEAQD GELDGLWTTI
360 370 380 390
TIFISLFLLS VCYSASVTLF KVKWIFSSVV QVKQTAIPDY RNMIGQGA
Length:398
Mass (Da):43,929
Last modified:August 1, 1991 - v2
Checksum:iCF7F264B50A41B95
GO
Isoform 2 (identifier: P03987-2) [UniParc]FASTAAdd to basket

Also known as: Secreted

The sequence of this isoform differs from the canonical sequence as follows:
     328-398: ELELNETCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFKVKWIFSSVVQVKQTAIPDYRNMIGQGA → GK

Show »
Length:329
Mass (Da):36,228
Checksum:iF45827174182BAD6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Non-terminal residuei1 – 11
Sequence conflicti329 – 3291L → M in CAA24767 (PubMed:6314258).Curated
Sequence conflicti333 – 3331E → G in CAA24767 (PubMed:6314258).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei328 – 39871ELELN…IGQGA → GK in isoform 2. CuratedVSP_034613Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J00451 Genomic DNA. Translation: AAB59655.1.
V01526 Genomic DNA. Translation: CAA24767.1. Sequence problems.
PIRiA02156. G3MSM.
B02156. G3MSC.
UniGeneiMm.342177.

Genome annotation databases

UCSCiuc007pgp.1. mouse. [P03987-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J00451 Genomic DNA. Translation: AAB59655.1.
V01526 Genomic DNA. Translation: CAA24767.1. Sequence problems.
PIRiA02156. G3MSM.
B02156. G3MSC.
UniGeneiMm.342177.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1CLZX-ray2.80H1-99[»]
2VQ1X-ray2.50B/F1-99[»]
ProteinModelPortaliP03987.
SMRiP03987. Positions 1-326.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP03987. 1 interaction.
MINTiMINT-1507885.

Protein family/group databases

IMGTiSearch...
Search...

Proteomic databases

MaxQBiP03987.
PeptideAtlasiP03987.
PRIDEiP03987.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

UCSCiuc007pgp.1. mouse. [P03987-1]

Phylogenomic databases

HOVERGENiHBG005814.

Miscellaneous databases

EvolutionaryTraceiP03987.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR003597. Ig_C1-set.
[Graphical view]
PfamiPF07654. C1-set. 3 hits.
[Graphical view]
SMARTiSM00407. IGc1. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 3 hits.
PROSITEiPS50835. IG_LIKE. 3 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Structural analysis of the murine IgG3 constant region gene."
    Wels J.A., Word C.J., Rimm D., Der-Balan G.P., Martinez H.M., Tucker P.W., Blattner F.R.
    EMBO J. 3:2041-2046(1984) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Strain: BALB/cJ.
  2. "The structure of the mouse immunoglobulin in gamma 3 membrane gene segment."
    Komaromy M., Clayton L., Rogers J., Robertson S., Kettman J., Wall R.
    Nucleic Acids Res. 11:6775-6785(1983) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 329-398.
  3. "Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides."
    Bernhard O.K., Kapp E.A., Simpson R.J.
    J. Proteome Res. 6:987-995(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-179.
    Strain: C57BL/6J.
    Tissue: Plasma.

Entry informationi

Entry nameiIGHG3_MOUSE
AccessioniPrimary (citable) accession number: P03987
Secondary accession number(s): P22436
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 1986
Last sequence update: August 1, 1991
Last modified: July 6, 2016
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.