P03987 (IGHG3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
September 21, 2011.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ig gamma-3 chain C region |
| Organism | Mus musculus (Mouse) |
| Taxonomic identifier | 10090 [NCBI] |
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 398 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Isoform 1: Cell membrane; Single-pass membrane protein By similarity. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Immunoglobulin C region Immunoglobulin domain Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | antigen binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P03987-1) Also known as: Membrane bound; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P03987-2) Also known as: Secreted; The sequence of this isoform differs from the canonical sequence as follows: 328-398: ELELNETCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFKVKWIFSSVVQVKQTAIPDYRNMIGQGA → GK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | ‹1 – 398 | ›398 | Ig gamma-3 chain C region | PRO_0000153590 | |||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||
| Transmembrane | 350 – 370 | 21 | Helical; Potential | ||||||||||||||||||||||||
| Topological domain | 371 – 398 | 28 | Cytoplasmic Potential | ||||||||||||||||||||||||
| Region | 1 – 97 | 97 | CH1 | ||||||||||||||||||||||||
| Region | 98 – 113 | 16 | Hinge | ||||||||||||||||||||||||
| Region | 114 – 223 | 110 | CH2 | ||||||||||||||||||||||||
| Region | 224 – 327 | 104 | CH3 | ||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||
| Glycosylation | 179 | 1 | N-linked (GlcNAc...) Ref.3 | ||||||||||||||||||||||||
| Glycosylation | 322 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||
| Glycosylation | 332 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||
| Alternative sequence | 328 – 398 | 71 | ELELN…IGQGA → GK in isoform 2. | VSP_034613 | |||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||
| Sequence conflict | 329 | 1 | L → M in CAA24767. Ref.2 | ||||||||||||||||||||||||
| Sequence conflict | 333 | 1 | E → G in CAA24767. Ref.2 | ||||||||||||||||||||||||
| Non-terminal residue | 1 | 1 | |||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||
| Beta strand | 3 – 8 | 6 | |||||||||||||||||||||||||
| Beta strand | 21 – 24 | 4 | |||||||||||||||||||||||||
| Beta strand | 26 – 29 | 4 | |||||||||||||||||||||||||
| Beta strand | 31 – 34 | 4 | |||||||||||||||||||||||||
| Beta strand | 37 – 40 | 4 | |||||||||||||||||||||||||
| Beta strand | 61 – 70 | 10 | |||||||||||||||||||||||||
| Turn | 71 – 76 | 6 | |||||||||||||||||||||||||
| Beta strand | 79 – 85 | 7 | |||||||||||||||||||||||||
| Helix | 86 – 88 | 3 | |||||||||||||||||||||||||
| Beta strand | 90 – 96 | 7 | |||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural analysis of the murine IgG3 constant region gene." Wels J.A., Word C.J., Rimm D., Der-Balan G.P., Martinez H.M., Tucker P.W., Blattner F.R. EMBO J. 3:2041-2046(1984) [PubMed: 6092053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: BALB/c. |
| [2] | "The structure of the mouse immunoglobulin in gamma 3 membrane gene segment." Komaromy M., Clayton L., Rogers J., Robertson S., Kettman J., Wall R. Nucleic Acids Res. 11:6775-6785(1983) [PubMed: 6314258] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 329-398. |
| [3] | "Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides." Bernhard O.K., Kapp E.A., Simpson R.J. J. Proteome Res. 6:987-995(2007) [PubMed: 17330941] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-179, MASS SPECTROMETRY. Strain: C57BL/6. Tissue: Plasma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | J00451 Genomic DNA. Translation: AAB59655.1. V01526 Genomic DNA. Translation: CAA24767.1. Sequence problems. | ||||||||||||||||||
| IPI | IPI00117022. IPI00807983. | ||||||||||||||||||
| PIR | G3MSM. A02156. G3MSC. B02156. | ||||||||||||||||||
| UniGene | Mm.342177. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P03987. | ||||||||||||||||||
| SMR | P03987. Positions 1-325. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | P03987. | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| IMGT | Search... Search... | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P03987. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| GeneTree | ENSGT00530000063726. | ||||||||||||||||||
| HOGENOM | HBG505540. | ||||||||||||||||||
| HOVERGEN | HBG005814. | ||||||||||||||||||
| InParanoid | P03987. | ||||||||||||||||||
| OrthoDB | EOG4RXZ0H. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P03987. | ||||||||||||||||||
| Bgee | P03987. | ||||||||||||||||||
| Genevestigator | P03987. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR003006. Ig/MHC_CS. IPR003597. Ig_C1-set. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 3 hits. | ||||||||||||||||||
| Pfam | PF07654. C1-set. 3 hits. [Graphical view] | ||||||||||||||||||
| SMART | SM00407. IGc1. 2 hits. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50835. IG_LIKE. 3 hits. PS00290. IG_MHC. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Entry information
| Entry name | IGHG3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P03987 Secondary accession number(s): P22436 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with