Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

MYL1

Organism
Oryctolagus cuniculus (Rabbit)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Enzyme and pathway databases

SABIO-RKP02602.

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:MYL1
OrganismiOryctolagus cuniculus (Rabbit)
Taxonomic identifieri9986 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresLagomorphaLeporidaeOryctolagus
Proteomesi
  • UP000001811 Componenti: Unplaced

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemoved
Chaini2 – 192191Myosin light chain 1/3, skeletal muscle isoformPRO_0000198683Add
BLAST
Isoform MLC3 (identifier: P02602-2)
Initiator methionineiRemoved1 Publication

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N,N,N-trimethylalanine1 Publication
Modified residuei69 – 691PhosphothreonineBy similarity
Modified residuei71 – 711PhosphoserineBy similarity
Modified residuei85 – 851PhosphothreonineBy similarity
Modified residuei97 – 971PhosphoserineBy similarity
Isoform MLC3 (identifier: P02602-2)
Modified residuei2 – 21N-acetylserine1 Publication

Post-translational modificationi

Isoform MLC3 is acetylated at position 2.

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

PRIDEiP02602.

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

IntActiP02602. 1 interaction.
MINTiMINT-6491589.
STRINGi9986.ENSOCUP00000012188.

Structurei

3D structure databases

ProteinModelPortaliP02602.
SMRiP02602. Positions 45-191.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini48 – 8336EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini125 – 16036EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini160 – 19233EF-hand 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0030. Eukaryota.
COG5126. LUCA.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP02602.
KOiK05738.
TreeFamiTF351553.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MLC1 (identifier: P02602-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKKDVKKP AAAAAPAPAP APAPAPAPAK PKEEKIDLSA IKIEFSKEQQ
60 70 80 90 100
DEFKEAFLLY DRTGDSKITL SQVGDVLRAL GTNPTNAEVK KVLGNPSNEE
110 120 130 140 150
MNAKKIEFEQ FLPMLQAISN NKDQGTYEDF VEGLRVFDKE GNGTVMGAEL
160 170 180 190
RHVLATLGEK MKEEEVEALM AGQEDSNGCI NYEAFVKHIM SI
Length:192
Mass (Da):20,949
Last modified:January 23, 2007 - v3
Checksum:iA2F57A179F2158D6
GO
Isoform MLC3 (identifier: P02602-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAPKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQD → MSFSADQIA

Show »
Length:150
Mass (Da):16,658
Checksum:iE469C31EBE2D1D0F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti6 – 61D → N AA sequence (PubMed:4838672).Curated
Sequence conflicti19 – 191A → KA AA sequence (PubMed:4838672).Curated
Sequence conflicti30 – 301Missing AA sequence (PubMed:4838672).Curated
Sequence conflicti98 – 1003NEE → DEQ AA sequence (PubMed:4838672).Curated
Sequence conflicti142 – 1454NGTV → DTVG AA sequence (PubMed:4838672).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MAPKK…KEQQD → MSFSADQIA in isoform MLC3. 1 PublicationVSP_038688Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X54041 mRNA. Translation: CAA37974.1.
X54044 mRNA. Translation: CAA37977.1.
PIRiS12693. MORBL2.
S15061. MORBLA.
RefSeqiNP_001095183.1. NM_001101713.1. [P02602-1]
XP_008257145.1. XM_008258923.1. [P02602-2]
UniGeneiOcu.247.

Genome annotation databases

GeneIDi100009400.
KEGGiocu:100009400.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X54041 mRNA. Translation: CAA37974.1.
X54044 mRNA. Translation: CAA37977.1.
PIRiS12693. MORBL2.
S15061. MORBLA.
RefSeqiNP_001095183.1. NM_001101713.1. [P02602-1]
XP_008257145.1. XM_008258923.1. [P02602-2]
UniGeneiOcu.247.

3D structure databases

ProteinModelPortaliP02602.
SMRiP02602. Positions 45-191.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP02602. 1 interaction.
MINTiMINT-6491589.
STRINGi9986.ENSOCUP00000012188.

Proteomic databases

PRIDEiP02602.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi100009400.
KEGGiocu:100009400.

Organism-specific databases

CTDi4632.

Phylogenomic databases

eggNOGiKOG0030. Eukaryota.
COG5126. LUCA.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP02602.
KOiK05738.
TreeFamiTF351553.

Enzyme and pathway databases

SABIO-RKP02602.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMYL1_RABIT
AccessioniPrimary (citable) accession number: P02602
Secondary accession number(s): P02603
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 110 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.