Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

Myl1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

GO - Biological processi

  • cardiac muscle contraction Source: RGD

Keywordsi

Molecular functionMotor protein, Muscle protein, Myosin

Enzyme and pathway databases

ReactomeiR-RNO-390522 Striated Muscle Contraction

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:Myl1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 9

Organism-specific databases

RGDi1598796 Myl1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001986842 – 189Myosin light chain 1/3, skeletal muscle isoformAdd BLAST188
Isoform MLC3 (identifier: P02600-2)
Initiator methionineiRemovedCombined sourcesBy similarity

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N,N,N-trimethylalanineBy similarity1
Modified residuei66PhosphothreonineCombined sources1
Modified residuei68PhosphoserineCombined sources1
Modified residuei82PhosphothreonineCombined sources1
Modified residuei94PhosphoserineCombined sources1
Isoform MLC3 (identifier: P02600-2)
Modified residuei2N-acetylalanine By similarityCombined sourcesBy similarity1
Modified residuei2PhosphoserineCombined sourcesBy similarity1

Post-translational modificationi

Isoform MLC3 is acetylated at position 2.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

PaxDbiP02600
PRIDEiP02600

PTM databases

iPTMnetiP02600
PhosphoSitePlusiP02600

Miscellaneous databases

PMAP-CutDBP02600

Expressioni

Gene expression databases

BgeeiENSRNOG00000013262
GenevisibleiP02600 RN

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridi248582, 2 interactors
IntActiP02600, 2 interactors
STRINGi10116.ENSRNOP00000017838

Structurei

3D structure databases

ProteinModelPortaliP02600
SMRiP02600
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 80EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini122 – 157EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini157 – 189EF-hand 3PROSITE-ProRule annotationAdd BLAST33

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0030 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00590000082921
HOGENOMiHOG000233018
HOVERGENiHBG012180
InParanoidiP02600
KOiK05738
OMAiTNAEINK
OrthoDBiEOG091G0TQL
PhylomeDBiP02600
TreeFamiTF351553

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 3 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MLC1 (identifier: P02600-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKKDVKKP AAAAPAPAPA PAPAPAKPKE EKIDLSAIKI EFSKEQQEEF
60 70 80 90 100
KEAFLLFDRT GECKITLSQV GDVLRALGTN PTNAEVKKVL GNPSNEEMNA
110 120 130 140 150
KKIEFEQFLP MMQAISNNKD QGGYEDFVEG LRVFDKEGNG TVMGAELRHV
160 170 180
LATLGEKMKE EEVEALLAGQ EDSNGCINYE AFVKHIMSV
Length:189
Mass (Da):20,680
Last modified:January 23, 2007 - v2
Checksum:iC8FC83CA793220B4
GO
Isoform MLC3 (identifier: P02600-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQE → MSFSADQIA

Show »
Length:150
Mass (Da):16,614
Checksum:i5822D9047F0738D1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti26A → APA in AAA98533 (PubMed:6092382).Curated1
Sequence conflicti153T → I in AAA41622 (PubMed:3018505).Curated1
Sequence conflicti153T → I in AAA41623 (PubMed:3018505).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0386891 – 48MAPKK…KEQQE → MSFSADQIA in isoform MLC3. CuratedAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00088
, K02423, K02426, L00085, L00086, L00087 Genomic DNA Translation: AAA98533.1
L00088
, K02424, K02425, L00085, L00086, L00087 Genomic DNA Translation: AAA98534.1
M12021
, M12017, M12018, M12019, M12020 Genomic DNA Translation: AAA41622.1
M12021
, M12018, M12019, M12020 Genomic DNA Translation: AAA41623.1
PIRiA03034 MORTA1
I57590
I77418 MORTA2
RefSeqiNP_001071124.1, NM_001077656.1 [P02600-1]
NP_064489.1, NM_020104.2 [P02600-2]
UniGeneiRn.84920

Genome annotation databases

EnsembliENSRNOT00000017838; ENSRNOP00000017838; ENSRNOG00000013262 [P02600-1]
ENSRNOT00000018097; ENSRNOP00000018097; ENSRNOG00000013262 [P02600-2]
GeneIDi56781
KEGGirno:56781
UCSCiRGD:1598796 rat [P02600-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMYL1_RAT
AccessioniPrimary (citable) accession number: P02600
Secondary accession number(s): P02601
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: January 23, 2007
Last modified: May 23, 2018
This is version 132 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health