Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin light chain 1/3, skeletal muscle isoform

Gene

Myl1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory light chain of myosin. Does not bind calcium.

GO - Molecular functioni

GO - Biological processi

  • cardiac muscle contraction Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Enzyme and pathway databases

ReactomeiR-RNO-390522. Striated Muscle Contraction.

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin light chain 1/3, skeletal muscle isoform
Short name:
MLC1/MLC3
Short name:
MLC1F/MLC3F
Alternative name(s):
Myosin light chain alkali 1/2
Short name:
Myosin light chain A1/A2
Gene namesi
Name:Myl1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 9

Organism-specific databases

RGDi1598796. Myl1.

Subcellular locationi

GO - Cellular componenti

  • contractile fiber Source: RGD
  • myofibril Source: Ensembl
  • myosin complex Source: UniProtKB-KW
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 189188Myosin light chain 1/3, skeletal muscle isoformPRO_0000198684Add
BLAST
Isoform MLC3 (identifier: P02600-2)
Initiator methionineiRemovedCombined sourcesBy similarity

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N,N,N-trimethylalanineBy similarity
Modified residuei66 – 661PhosphothreonineCombined sources
Modified residuei68 – 681PhosphoserineCombined sources
Modified residuei82 – 821PhosphothreonineCombined sources
Modified residuei94 – 941PhosphoserineCombined sources
Isoform MLC3 (identifier: P02600-2)
Modified residuei2 – 21N-acetylalanine By similarityCombined sourcesBy similarity
Modified residuei2 – 21PhosphoserineCombined sourcesBy similarity

Post-translational modificationi

Isoform MLC3 is acetylated at position 2.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

PaxDbiP02600.
PRIDEiP02600.

PTM databases

iPTMnetiP02600.

Miscellaneous databases

PMAP-CutDBP02600.

Expressioni

Gene expression databases

GenevisibleiP02600. RN.

Interactioni

Subunit structurei

Myosin is a hexamer of 2 heavy chains and 4 light chains.

Protein-protein interaction databases

BioGridi248582. 2 interactions.
IntActiP02600. 2 interactions.
STRINGi10116.ENSRNOP00000017838.

Structurei

3D structure databases

ProteinModelPortaliP02600.
SMRiP02600. Positions 42-188.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 8036EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini122 – 15736EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini157 – 18933EF-hand 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0030. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00590000082921.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP02600.
KOiK05738.
OMAiTNAEINK.
OrthoDBiEOG7HQN9N.
PhylomeDBiP02600.
TreeFamiTF351553.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MLC1 (identifier: P02600-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKKDVKKP AAAAPAPAPA PAPAPAKPKE EKIDLSAIKI EFSKEQQEEF
60 70 80 90 100
KEAFLLFDRT GECKITLSQV GDVLRALGTN PTNAEVKKVL GNPSNEEMNA
110 120 130 140 150
KKIEFEQFLP MMQAISNNKD QGGYEDFVEG LRVFDKEGNG TVMGAELRHV
160 170 180
LATLGEKMKE EEVEALLAGQ EDSNGCINYE AFVKHIMSV
Length:189
Mass (Da):20,680
Last modified:January 23, 2007 - v2
Checksum:iC8FC83CA793220B4
GO
Isoform MLC3 (identifier: P02600-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQE → MSFSADQIA

Show »
Length:150
Mass (Da):16,614
Checksum:i5822D9047F0738D1
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti26 – 261A → APA in AAA98533 (PubMed:6092382).Curated
Sequence conflicti153 – 1531T → I in AAA41622 (PubMed:3018505).Curated
Sequence conflicti153 – 1531T → I in AAA41623 (PubMed:3018505).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4848MAPKK…KEQQE → MSFSADQIA in isoform MLC3. CuratedVSP_038689Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00088
, K02423, K02426, L00085, L00086, L00087 Genomic DNA. Translation: AAA98533.1.
L00088
, K02424, K02425, L00085, L00086, L00087 Genomic DNA. Translation: AAA98534.1.
M12021
, M12017, M12018, M12019, M12020 Genomic DNA. Translation: AAA41622.1.
M12021
, M12018, M12019, M12020 Genomic DNA. Translation: AAA41623.1.
PIRiA03034. MORTA1.
I57590.
I77418. MORTA2.
RefSeqiNP_001071124.1. NM_001077656.1. [P02600-1]
NP_064489.1. NM_020104.2. [P02600-2]
UniGeneiRn.84920.

Genome annotation databases

EnsembliENSRNOT00000017838; ENSRNOP00000017838; ENSRNOG00000013262. [P02600-1]
ENSRNOT00000018097; ENSRNOP00000018097; ENSRNOG00000013262. [P02600-2]
GeneIDi56781.
KEGGirno:56781.
UCSCiRGD:1598796. rat. [P02600-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00088
, K02423, K02426, L00085, L00086, L00087 Genomic DNA. Translation: AAA98533.1.
L00088
, K02424, K02425, L00085, L00086, L00087 Genomic DNA. Translation: AAA98534.1.
M12021
, M12017, M12018, M12019, M12020 Genomic DNA. Translation: AAA41622.1.
M12021
, M12018, M12019, M12020 Genomic DNA. Translation: AAA41623.1.
PIRiA03034. MORTA1.
I57590.
I77418. MORTA2.
RefSeqiNP_001071124.1. NM_001077656.1. [P02600-1]
NP_064489.1. NM_020104.2. [P02600-2]
UniGeneiRn.84920.

3D structure databases

ProteinModelPortaliP02600.
SMRiP02600. Positions 42-188.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi248582. 2 interactions.
IntActiP02600. 2 interactions.
STRINGi10116.ENSRNOP00000017838.

PTM databases

iPTMnetiP02600.

Proteomic databases

PaxDbiP02600.
PRIDEiP02600.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000017838; ENSRNOP00000017838; ENSRNOG00000013262. [P02600-1]
ENSRNOT00000018097; ENSRNOP00000018097; ENSRNOG00000013262. [P02600-2]
GeneIDi56781.
KEGGirno:56781.
UCSCiRGD:1598796. rat. [P02600-1]

Organism-specific databases

CTDi4632.
RGDi1598796. Myl1.

Phylogenomic databases

eggNOGiKOG0030. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00590000082921.
HOGENOMiHOG000233018.
HOVERGENiHBG012180.
InParanoidiP02600.
KOiK05738.
OMAiTNAEINK.
OrthoDBiEOG7HQN9N.
PhylomeDBiP02600.
TreeFamiTF351553.

Enzyme and pathway databases

ReactomeiR-RNO-390522. Striated Muscle Contraction.

Miscellaneous databases

PMAP-CutDBP02600.
PROiP02600.

Gene expression databases

GenevisibleiP02600. RN.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Fast skeletal muscle myosin light chains 1 and 3 are produced from a single gene by a combined process of differential RNA transcription and splicing."
    Periasamy M., Strehler E.E., Garfinkel L.I., Gubits R.M., Ruiz-Opazo N., Nadal-Ginard B.
    J. Biol. Chem. 259:13595-13604(1984) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
  2. "Myosin light-chain 1 and 3 gene has two structurally distinct and differentially regulated promoters evolving at different rates."
    Strehler E.E., Periasamy M., Strehler-Page M.-A., Nadal-Ginard B.
    Mol. Cell. Biol. 5:3168-3182(1985) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. Lubec G., Afjehi-Sadat L.
    Submitted (DEC-2006) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 119-131, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: Sprague-Dawley.
    Tissue: Spinal cord.
  4. "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."
    Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.
    Nat. Commun. 3:876-876(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-66; SER-68; THR-82 AND SER-94, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2 (ISOFORM MLC3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMYL1_RAT
AccessioniPrimary (citable) accession number: P02600
Secondary accession number(s): P02601
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: January 23, 2007
Last modified: June 8, 2016
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.