P02458 (CO2A1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 167.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Collagen alpha-1(II) chain Alternative name(s): Alpha-1 type II collagen Cleaved into the following 2 chains: | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1487 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Type II collagen is specific for cartilaginous tissues. It is essential for the normal embryonic development of the skeleton, for linear growth and for the ability of cartilage to resist compressive forces. |
| Subunit structure | Homotrimers of alpha 1(II) chains. |
| Subcellular location | Secreted › extracellular space › extracellular matrix By similarity. |
| Tissue specificity | Isoform 2 is highly expressed in juvenile chondrocyte and low in fetal chondrocyte. Ref.11 |
| Domain | The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function By similarity. |
| Post-translational modification | Probably 3-hydroxylated on prolines by LEPREL1 By similarity. Proline residues at the third position of the tripeptide repeating unit (G-X-P) are hydroxylated in some or all of the chains. Proline residues at the second position of the tripeptide repeating unit (G-P-X) are hydroxylated in some of the chains. The N-telopeptide is covalently linked to the helical COL2 region of alpha 1(IX), alpha 2(IX) and alpha 3(IX) chain. The C-telopeptide is covalently linked to an another site in the helical region of alpha 3(IX) COL2. |
| Involvement in disease | Spondyloepiphyseal dysplasia congenital type (SEDC) [MIM:183900]: Disorder characterized by disproportionate short stature and pleiotropic involvement of the skeletal and ocular systems. Spondyloepimetaphyseal dysplasia, Strudwick type (SEMDSTWK) [MIM:184250]: A bone disease characterized by disproportionate short stature from birth, with a very short trunk and shortened limbs, and skeletal abnormalities including lordosis, scoliosis, flattened vertebrae, pectus carinatum, coxa vara, clubfoot, and abnormal epiphyses or metaphyses. A distinctive radiographic feature is irregular sclerotic changes, described as dappled in the metaphyses of the long bones. Achondrogenesis 2 (ACG2) [MIM:200610]: A disease characterized by the absence of ossification in the vertebral column, sacrum and pubic bones. Legg-Calve-Perthes disease (LCPD) [MIM:150600]: Characterized by loss of circulation to the femoral head, resulting in avascular necrosis in a growing child. Clinical pictures of the disease vary, depending on the phase of disease progression through ischemia, revascularization, fracture and collapse, and repair and remodeling of the bone. Kniest dysplasia (KD) [MIM:156550]: Moderately severe chondrodysplasia phenotype that results from mutations in the COL2A1 gene. Characteristics of the disorder include a short trunk and extremities, mid-face hypoplasia, cleft palate, myopia, retinal detachment, and hearing loss. Primary avascular necrosis of femoral head (ANFH) [MIM:608805]: Causes disability that often requires surgical intervention. Most cases are sporadic, but families in which there is an autosomal dominant inheritance of the disease have been identified. It has been estimated that 300,000 to 600,000 people in the United States have ANFH. Approximately 15,000 new cases of this common and disabling disorder are reported annually. The age at the onset is earlier than that for osteoarthritis. The diagnosis is typically made when patients are between the ages of 30 and 60 years. The clinical manifestations, such as pain on exertion, a limping gait, and a discrepancy in leg length, cause considerable disability. Moreover, nearly 10 percent of the 500,000 total-hip arthroplasties performed each year in the United States involve patients with ANFH. As a result, this disease creates a substantial socioeconomic cost as well as a burden for patients and their families. Osteoarthritis with mild chondrodysplasia (OACD) [MIM:604864]: Osteoarthritis is a common disease that produces joint pain and stiffness together with radiologic evidence of progressive degeneration of joint cartilage. Platyspondylic lethal skeletal dysplasia Torrance type (PLSD-T) [MIM:151210]: Platyspondylic lethal skeletal dysplasias (PLSDs) are a heterogeneous group of chondrodysplasias characterized by severe platyspondyly and limb shortening. PLSD-T is characterized by varying platyspondyly, short ribs with anterior cupping, hypoplasia of the lower ilia with broad ischial and pubic bones, and shortening of the tubular bones with splayed and cupped metaphyses. Histology of the growth plate typically shows focal hypercellularity with slightly enlarged chondrocytes in the resting cartilage and relatively well-preserved columnar formation and ossification at the chondro-osseous junction. PLSD-T is generally a perinatally lethal disease, but a few long-term survivors have been reported. Multiple epiphyseal dysplasia with myopia and conductive deafness (EDMMD) [MIM:132450]: A generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDMMD is an autosomal dominant disorder characterized by epiphyseal dysplasia associated with progressive myopia, retinal thinning, crenated cataracts, conductive deafness. Spondyloperipheral dysplasia (SPD) [MIM:271700]: SPD patients manifest short stature, midface hypoplasia, sensorineural hearing loss, spondyloepiphyseal dysplasia, platyspondyly and brachydactyly. Stickler syndrome 1 (STL1) [MIM:108300]: An autosomal dominant form of Stickler syndrome, an inherited disorder that associates ocular signs with more or less complete forms of Pierre Robin sequence, bone disorders and sensorineural deafness. Ocular disorders may include juvenile cataract, myopia, strabismus, vitreoretinal or chorioretinal degeneration, retinal detachment, and chronic uveitis. Robin sequence includes an opening in the roof of the mouth (a cleft palate), a large tongue (macroglossia), and a small lower jaw (micrognathia). Bones are affected by slight platyspondylisis and large, often defective epiphyses. Juvenile joint laxity is followed by early signs of arthrosis. The degree of hearing loss varies among affected individuals and may become more severe over time. Syndrome expressivity is variable. Stickler syndrome 1 non-syndromic ocular (STL1O) [MIM:609508]: An autosomal dominant form of Stickler syndrome characterized by the ocular signs typically seen in Stickler syndrome type 1 such as cataract, myopia, retinal detachment. Systemic features of premature osteoarthritis, cleft palate, hearing impairment, and craniofacial abnormalities are either absent or very mild. Rhegmatogenous retinal detachment autosomal dominant (DRRD) [MIM:609508]: A eye disease that most frequently results from a break or tear in the retina that allows fluid from the vitreous humor to enter the potential space beneath the retina. It is often associated with pathologic myopia and in most cases leads to visual impairment or blindness if untreated. Czech dysplasia (CZECHD) [MIM:609162]: A skeletal dysplasia characterized by early-onset, progressive pseudorheumatoid arthritis, platyspondyly, and short third and fourth toes. |
| Sequence similarities | Belongs to the fibrillar collagen family. Contains 1 fibrillar collagen NC1 domain. Contains 1 VWFC domain. |
| Sequence caution | The sequence AAH07252.1 differs from that shown. Reason: Frameshift at position 1198. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: P02458-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P02458-1) The sequence of this isoform differs from the canonical sequence as follows: 29-98: QEAGSCVQDGQRYNDKDVWKPEPCRICVCDTGTVLCDDIICEDVKDCLSPEIPFGECCPICPTDLATASG → R | ||||||
| Isoform 3 (identifier: P02458-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1219: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||||||||||
| Propeptide | 26 – 181 | 156 | N-terminal propeptide | PRO_0000005729 | |||||||||||||
| Chain | 182 – 1241 | 1060 | Collagen alpha-1(II) chain | PRO_0000005730 | |||||||||||||
| Chain | 1242 – 1487 | 246 | Chondrocalcin | PRO_0000005731 | |||||||||||||
Regions | |||||||||||||||||
| Domain | 32 – 90 | 59 | VWFC | ||||||||||||||
| Domain | 1253 – 1487 | 235 | Fibrillar collagen NC1 | ||||||||||||||
| Region | 201 – 1214 | 1014 | Triple-helical region | ||||||||||||||
| Region | 1215 – 1241 | 27 | Nonhelical region (C-terminal) | ||||||||||||||
Sites | |||||||||||||||||
| Metal binding | 1301 | 1 | Calcium By similarity | ||||||||||||||
| Metal binding | 1303 | 1 | Calcium By similarity | ||||||||||||||
| Metal binding | 1304 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||||||||||
| Metal binding | 1306 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||||||||||
| Metal binding | 1309 | 1 | Calcium By similarity | ||||||||||||||
| Site | 181 – 182 | 2 | Cleavage; by procollagen N-endopeptidase By similarity | ||||||||||||||
| Site | 1241 – 1242 | 2 | Cleavage; by procollagen C-endopeptidase By similarity | ||||||||||||||
Amino acid modifications | |||||||||||||||||
| Modified residue | 190 | 1 | 5-hydroxylysine By similarity | ||||||||||||||
| Modified residue | 287 | 1 | 5-hydroxylysine By similarity | ||||||||||||||
| Modified residue | 299 | 1 | 5-hydroxylysine By similarity | ||||||||||||||
| Modified residue | 308 | 1 | 5-hydroxylysine By similarity | ||||||||||||||
| Modified residue | 374 | 1 | 5-hydroxylysine By similarity | ||||||||||||||
| Modified residue | 608 | 1 | 5-hydroxylysine By similarity | ||||||||||||||
| Modified residue | 620 | 1 | 5-hydroxylysine By similarity | ||||||||||||||
| Modified residue | 670 | 1 | 3-hydroxyproline By similarity | ||||||||||||||
| Modified residue | 907 | 1 | 3-hydroxyproline By similarity | ||||||||||||||
| Modified residue | 1130 | 1 | 5-hydroxylysine By similarity | ||||||||||||||
| Modified residue | 1144 | 1 | 3-hydroxyproline By similarity | ||||||||||||||
| Modified residue | 1186 | 1 | 3-hydroxyproline By similarity | ||||||||||||||
| Modified residue | 1201 | 1 | 3-hydroxyproline By similarity | ||||||||||||||
| Modified residue | 1207 | 1 | 3-hydroxyproline By similarity | ||||||||||||||
| Modified residue | 1213 | 1 | 3-hydroxyproline By similarity | ||||||||||||||
| Glycosylation | 190 | 1 | O-linked (Gal...) By similarity | ||||||||||||||
| Glycosylation | 287 | 1 | O-linked (Gal...) By similarity | ||||||||||||||
| Glycosylation | 299 | 1 | O-linked (Gal...) By similarity | ||||||||||||||
| Glycosylation | 308 | 1 | O-linked (Gal...) By similarity | ||||||||||||||
| Glycosylation | 374 | 1 | O-linked (Gal...) By similarity | ||||||||||||||
| Glycosylation | 608 | 1 | O-linked (Gal...) By similarity | ||||||||||||||
| Glycosylation | 620 | 1 | O-linked (Gal...) By similarity | ||||||||||||||
| Glycosylation | 1130 | 1 | O-linked (Gal...) By similarity | ||||||||||||||
| Glycosylation | 1388 | 1 | N-linked (GlcNAc...) | ||||||||||||||
| Disulfide bond | 1283 ↔ 1315 | By similarity | |||||||||||||||
| Disulfide bond | 1289 | Interchain (with C-1306) By similarity | |||||||||||||||
| Disulfide bond | 1306 | Interchain (with C-1289) By similarity | |||||||||||||||
| Disulfide bond | 1323 ↔ 1485 | By similarity | |||||||||||||||
| Disulfide bond | 1393 ↔ 1438 | By similarity | |||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 1 – 1219 | 1219 | Missing in isoform 3. | VSP_022365 | |||||||||||||
| Alternative sequence | 29 – 98 | 70 | QEAGS…ATASG → R in isoform 1. | VSP_022366 | |||||||||||||
| Natural variant | 9 | 1 | T → S. Ref.1 Ref.2 Ref.6 Ref.7 Ref.8 Ref.72 Corresponds to variant rs3803183 [ dbSNP | Ensembl ]. | VAR_017638 | |||||||||||||
| Natural variant | 57 | 1 | C → Y in STL1O. Ref.73 | VAR_063891 | |||||||||||||
| Natural variant | 142 | 1 | E → D. Ref.72 Corresponds to variant rs34392760 [ dbSNP | Ensembl ]. | VAR_033782 | |||||||||||||
| Natural variant | 158 | 1 | P → L. Ref.1 Corresponds to variant rs1050861 [ dbSNP | Ensembl ]. | VAR_019836 | |||||||||||||
| Natural variant | 240 | 1 | G → D in STL1. Ref.75 | VAR_063892 | |||||||||||||
| Natural variant | 267 | 1 | G → D in STL1O. Ref.37 | VAR_001738 | |||||||||||||
| Natural variant | 270 | 1 | G → R in STL1. Ref.75 | VAR_063893 | |||||||||||||
| Natural variant | 275 | 1 | R → C in CZECHD. Ref.41 Ref.48 Ref.71 Ref.74 | VAR_001739 | |||||||||||||
| Natural variant | 282 | 1 | G → D in STL1. Ref.75 | VAR_063894 | |||||||||||||
| Natural variant | 302 – 308 | 7 | Missing in STL1. | VAR_001740 | |||||||||||||
| Natural variant | 303 | 1 | G → D in KD; abnormal allele expressed in the cartilage. Ref.45 | VAR_001741 | |||||||||||||
| Natural variant | 318 | 1 | G → R in DRRD. Ref.66 | VAR_023925 | |||||||||||||
| Natural variant | 354 | 1 | G → R in spondylometaphyseal dysplasia; congenital type. Ref.40 | VAR_001742 | |||||||||||||
| Natural variant | 375 | 1 | G → R in SEDC. | VAR_001743 | |||||||||||||
| Natural variant | 447 | 1 | G → S in SEDC. Ref.46 | VAR_001744 | |||||||||||||
| Natural variant | 453 | 1 | G → A in STL1. Ref.75 | VAR_063895 | |||||||||||||
| Natural variant | 453 | 1 | G → D in ACG2. Ref.57 | VAR_017639 | |||||||||||||
| Natural variant | 453 | 1 | G → V in ACG2. Ref.57 | VAR_017640 | |||||||||||||
| Natural variant | 492 | 1 | G → V in SEMDSTWK. Ref.50 | VAR_001745 | |||||||||||||
| Natural variant | 501 | 1 | G → R in STL1. Ref.75 | VAR_063896 | |||||||||||||
| Natural variant | 504 | 1 | G → C in SEMDSTWK. Ref.50 | VAR_001746 | |||||||||||||
| Natural variant | 510 | 1 | G → D in ACG2. | VAR_001747 | |||||||||||||
| Natural variant | 513 | 1 | G → S in ACG2. Ref.58 | VAR_024819 | |||||||||||||
| Natural variant | 516 | 1 | G → D in ACGA2. Ref.61 | VAR_023926 | |||||||||||||
| Natural variant | 547 | 1 | D → V in ACG2. Ref.69 | VAR_063897 | |||||||||||||
| Natural variant | 565 | 1 | R → C in STL1. Ref.55 | VAR_023927 | |||||||||||||
| Natural variant | 638 | 1 | T → I. Ref.72 Corresponds to variant rs41263847 [ dbSNP | Ensembl ]. | VAR_033783 | |||||||||||||
| Natural variant | 667 | 1 | L → F in DRRD. Ref.55 Ref.66 | VAR_023928 | |||||||||||||
| Natural variant | 717 | 1 | G → S in ANFH. Ref.67 | VAR_023929 | |||||||||||||
| Natural variant | 717 | 1 | G → V in ACG2. Ref.58 | VAR_024820 | |||||||||||||
| Natural variant | 719 | 1 | R → C in OACD; also in mild spondyloepiphyseal dysplasia and precocious osteoarthritis. Ref.34 Ref.35 Ref.39 Ref.48 Ref.54 | VAR_001748 | |||||||||||||
| Natural variant | 771 | 1 | G → A in ACG2. Ref.58 | VAR_024821 | |||||||||||||
| Natural variant | 771 | 1 | G → D in ACG2. Ref.57 | VAR_017641 | |||||||||||||
| Natural variant | 774 | 1 | G → S in SEDC and hypochondrogenesis; lethal. Ref.36 | VAR_001749 | |||||||||||||
| Natural variant | 780 | 1 | G → R in ACG2. Ref.57 | VAR_017642 | |||||||||||||
| Natural variant | 795 | 1 | G → R in ACG2. Ref.57 | VAR_017643 | |||||||||||||
| Natural variant | 804 | 1 | G → A in hypochondrogenesis. | VAR_001751 | |||||||||||||
| Natural variant | 855 | 1 | G → S in SEDC. | VAR_023930 | |||||||||||||
| Natural variant | 891 | 1 | G → R in ACG2 and SEDC. Ref.47 Ref.48 | VAR_001752 | |||||||||||||
| Natural variant | 894 | 1 | G → E in ACG2. Ref.57 | VAR_017644 | |||||||||||||
| Natural variant | 897 | 1 | G → V in SEMDSTWK. Ref.38 | VAR_023931 | |||||||||||||
| Natural variant | 904 | 1 | R → C in EDMMD and STL1. Ref.53 Ref.75 | VAR_017645 | |||||||||||||
| Natural variant | 909 | 1 | G → C in SEMDSTWK. Ref.38 Ref.50 | VAR_001753 | |||||||||||||
| Natural variant | 948 | 1 | G → D in ACG2. Ref.57 | VAR_017646 | |||||||||||||
| Natural variant | 969 | 1 | G → S in ACG2. Ref.49 | VAR_001754 | |||||||||||||
| Natural variant | 981 | 1 | G → S in ACG2. Ref.57 | VAR_017647 | |||||||||||||
| Natural variant | 989 | 1 | R → C in SEDC. Ref.42 | VAR_001755 | |||||||||||||
| Natural variant | 992 | 1 | R → G in SEMDSTWK. Ref.65 | VAR_023932 | |||||||||||||
| Natural variant | 1005 | 1 | G → S in hypochondrogenesis. | VAR_001756 | |||||||||||||
| Natural variant | 1017 – 1022 | 6 | Missing in hypochondrogenesis. | VAR_017648 | |||||||||||||
| Natural variant | 1017 | 1 | G → V in ACG2. | VAR_001757 | |||||||||||||
| Natural variant | 1051 | 1 | A → T. Ref.72 Corresponds to variant rs41272041 [ dbSNP | Ensembl ]. | VAR_033784 | |||||||||||||
| Natural variant | 1053 | 1 | G → E in hypochondrogenesis; lethal. Ref.20 | VAR_001758 | |||||||||||||
| Natural variant | 1065 | 1 | G → V in ACG2. Ref.57 | VAR_017649 | |||||||||||||
| Natural variant | 1110 | 1 | G → C in ACG2. Ref.58 | VAR_001759 | |||||||||||||
| Natural variant | 1113 | 1 | G → C in hypochondrogenesis. Ref.51 | VAR_001760 | |||||||||||||
| Natural variant | 1119 | 1 | G → R in ACG2. Ref.57 | VAR_017650 | |||||||||||||
| Natural variant | 1143 | 1 | G → S in ACG2. Ref.33 Ref.58 | VAR_001761 | |||||||||||||
| Natural variant | 1158 | 1 | G → A in STL1. Ref.75 | VAR_063898 | |||||||||||||
| Natural variant | 1164 – 1199 | 36 | Missing in SEDC. | VAR_001762 | |||||||||||||
| Natural variant | 1170 | 1 | G → S in ANFH and in LCPD. Ref.67 Ref.70 | VAR_023933 | |||||||||||||
| Natural variant | 1173 | 1 | G → R in SEDC. Ref.56 | VAR_017651 | |||||||||||||
| Natural variant | 1176 | 1 | G → S in SEDC. Ref.48 | VAR_001763 | |||||||||||||
| Natural variant | 1176 | 1 | G → V Mutation found in a patient with features of multiple epiphyseal dysplasia; features overlap with SEDC. Ref.76 | VAR_066836 | |||||||||||||
| Natural variant | 1179 | 1 | G → R Mutation found in a patient with features of multiple epiphyseal dysplasia; features overlap with SEDC. Ref.76 | VAR_066837 | |||||||||||||
| Natural variant | 1184 | 1 | I → IGPSGKDGANGIPGPI in SEDC. | VAR_019837 | |||||||||||||
| Natural variant | 1188 | 1 | G → R in ACG2. Ref.48 | VAR_001764 | |||||||||||||
| Natural variant | 1197 | 1 | G → S in SEDC. Ref.43 | VAR_001765 | |||||||||||||
| Natural variant | 1207 – 1212 | 6 | Missing in KD. | VAR_001766 | |||||||||||||
| Natural variant | 1305 | 1 | G → D in vitreoretinopathy; with phalangeal epiphyseal dysplasia. Ref.60 | VAR_023934 | |||||||||||||
| Natural variant | 1331 | 1 | V → I. Ref.57 Ref.72 Corresponds to variant rs12721427 [ dbSNP | Ensembl ]. | VAR_017652 | |||||||||||||
| Natural variant | 1390 | 1 | T → N in PLSD-T; phenotype previously considered as achondrogenesis-hypochondrogenesis type 2. Ref.58 Ref.64 | VAR_024822 | |||||||||||||
| Natural variant | 1391 | 1 | Y → C in PLSD-T. Ref.63 | VAR_023935 | |||||||||||||
| Natural variant | 1405 | 1 | G → S. Ref.72 Corresponds to variant rs2070739 [ dbSNP | Ensembl ]. | VAR_033785 | |||||||||||||
| Natural variant | 1439 | 1 | T → M in SEDC. Ref.59 | VAR_017105 | |||||||||||||
| Natural variant | 1448 | 1 | T → P in PLSD-T. Ref.64 | VAR_024823 | |||||||||||||
| Natural variant | 1469 | 1 | D → H in PLSD-T. Ref.64 | VAR_024824 | |||||||||||||
| Natural variant | 1484 | 1 | Missing in PLSD-T. Ref.64 | VAR_024825 | |||||||||||||
| Natural variant | 1485 | 1 | C → G in PLSD-T. Ref.64 | VAR_024826 | |||||||||||||
Experimental info | |||||||||||||||||
| Sequence conflict | 441 | 1 | G → D in CAA34488. Ref.1 | ||||||||||||||
| Sequence conflict | 457 | 1 | E → K in CAA34488. Ref.1 | ||||||||||||||
| Sequence conflict | 481 | 1 | A → P in AAB60370. Ref.15 | ||||||||||||||
| Sequence conflict | 641 | 1 | A → E in CAA34488. Ref.1 | ||||||||||||||
| Sequence conflict | 641 | 1 | A → E in CAA32030. Ref.16 | ||||||||||||||
| Sequence conflict | 677 | 1 | G → A in CAA32030. Ref.16 | ||||||||||||||
| Sequence conflict | 784 | 1 | G → A in CAA32030. Ref.16 | ||||||||||||||
| Sequence conflict | 832 – 835 | 4 | PAGF → TSGI in CAA34488. Ref.1 | ||||||||||||||
| Sequence conflict | 1006 | 1 | K → Q in CAA34488. Ref.1 | ||||||||||||||
| Sequence conflict | 1006 | 1 | K → Q in CAA32030. Ref.16 | ||||||||||||||
| Sequence conflict | 1037 | 1 | E → Q in CAA34683. Ref.6 | ||||||||||||||
| Sequence conflict | 1057 | 1 | D → N in AAD15287. Ref.17 | ||||||||||||||
| Sequence conflict | 1057 | 1 | D → N in CAA26223. Ref.17 | ||||||||||||||
| Sequence conflict | 1057 | 1 | D → N in AAA51997. Ref.19 | ||||||||||||||
| Sequence conflict | 1069 | 1 | A → T in CAA34683. Ref.6 | ||||||||||||||
| Sequence conflict | 1069 | 1 | A → T in AAD15287. Ref.17 | ||||||||||||||
| Sequence conflict | 1069 | 1 | A → T in CAA26223. Ref.17 | ||||||||||||||
| Sequence conflict | 1069 | 1 | A → T in AAA51997. Ref.19 | ||||||||||||||
| Sequence conflict | 1243 | 1 | Q → E in CAA29604. Ref.24 | ||||||||||||||
| Sequence conflict | 1247 | 1 | G → N in CAA29604. Ref.24 | ||||||||||||||
| Sequence conflict | 1271 | 1 | S → T in AAA52038. Ref.21 | ||||||||||||||
| Sequence conflict | 1274 | 1 | G → A in AAA52038. Ref.21 | ||||||||||||||
| Sequence conflict | 1333 | 1 | K → R in M12048. Ref.28 | ||||||||||||||
| Sequence conflict | 1350 | 1 | G → A in M12048. Ref.28 | ||||||||||||||
| Sequence conflict | 1372 | 1 | N → D in CAA26223. Ref.17 | ||||||||||||||
| Sequence conflict | 1383 | 1 | T → A in CAA26223. Ref.17 | ||||||||||||||
| Sequence conflict | 1400 | 1 | L → M in CAA26223. Ref.17 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Beta strand | 34 – 38 | 5 | |||||||||||||||
| Beta strand | 51 – 58 | 8 | |||||||||||||||
| Beta strand | 61 – 66 | 6 | |||||||||||||||
| Beta strand | 91 – 94 | 4 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nucleotide sequence of the full length cDNA encoding for human type II procollagen." Su M.W., Lee B., Ramirez F., Machado M.A., Horton W.A. Nucleic Acids Res. 17:9473-9473(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS SER-9 AND LEU-158. |
| [2] | "Conservation of the sizes of 53 introns and over 100 intronic sequences for the binding of common transcription factors in the human and mouse genes for type II procollagen (COL2A1)." Ala-Kokko L., Kvist A.-P., Metsaranta M., Kivirikko K.I., de Crombrugghe B., Prockop D.J., Vuorio E. Biochem. J. 308:923-929(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), VARIANT SER-9. Tissue: Blood. |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [4] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1109-1487 (ISOFORMS 1/2). Tissue: Embryonic stem cell and Muscle. |
| [6] | "Structure of cDNA clones coding for human type II procollagen. The alpha 1(II) chain is more similar to the alpha 1(I) chain than two other alpha chains of fibrillar collagens." Baldwin C.T., Reginato A.M., Smith C., Jimenez S.A., Prockop D.J. Biochem. J. 262:521-528(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1229 (ISOFORM 1), VARIANT SER-9. |
| [7] | "Organization of the exons coding for pro alpha 1(II) collagen N-propeptide confirms a distinct evolutionary history of this domain of the fibrillar collagen genes." Su M.W., Benson-Chanda V., Vissing H., Ramirez F. Genomics 4:438-441(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-236 (ISOFORM 1), VARIANT SER-9. |
| [8] | "The human type II procollagen gene: identification of an additional protein-coding domain and location of potential regulatory sequences in the promoter and first intron." Ryan M.C., Sieraski M., Sandell L.J. Genomics 8:41-48(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-103 (ISOFORM 2), VARIANT SER-9. |
| [9] | "Promoter region of the human pro-alpha 1(II)-collagen gene." Nunez A.M., Kohno K., Martin G.R., Yamada Y. Gene 44:11-16(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28 (ISOFORMS 1/2). |
| [10] | "Structural analysis of the regulatory elements of the type-II procollagen gene. Conservation of promoter and first intron sequences between human and mouse." Vikkula M., Metsaranta M., Syvaenen A.-C., Ala-Kokko L., Vuorio E., Peltonen L. Biochem. J. 285:287-294(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28 (ISOFORMS 1/2). |
| [11] | "Differential expression of a cysteine-rich domain in the amino-terminal propeptide of type II (cartilage) procollagen by alternative splicing of mRNA." Ryan M.C., Sandell L.J. J. Biol. Chem. 265:10334-10339(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 27-103 (ISOFORM 2), TISSUE SPECIFICITY. |
| [12] | "Genomic organization of the human procollagen alpha 1(II) collagen gene." Huang M.C., Seyer J.M., Thompson J.P., Spinella D.G., Cheah K.S., Kang A.H. Eur. J. Biochem. 195:593-600(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 99-341 (ISOFORMS 1/2). Tissue: Fetal sternum. |
| [13] | "Collagen type IX from human cartilage: a structural profile of intermolecular cross-linking sites." Diab M., Wu J.J., Eyre D.R. Biochem. J. 314:327-332(1996) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 188-195 AND 1224-1236. |
| [14] | "Immunohistochemical and biochemical analyses of 20,000-25,000-year-old fossil cartilage." Franc S., Marzin E., Boutillon M.-M., Lafont R., Lechene de la Porte P., Herbage D. Eur. J. Biochem. 234:125-131(1995) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 243-261; 575-590 AND 756-779. |
| [15] | "An RNA-splicing mutation (G+5IVS20) in the type II collagen gene (COL2A1) in a family with spondyloepiphyseal dysplasia congenita." Tiller G.E., Weis M.A., Polumbo P.A., Gruber H.E., Rimoin D.L., Cohn D.H., Eyre D.R. Am. J. Hum. Genet. 56:388-395(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 440-509 (ISOFORMS 1/2). |
| [16] | Ramirez F. Submitted (DEC-1988) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 501-1214 (ISOFORMS 1/2). |
| [17] | "Isolation and partial characterization of the entire human pro alpha 1(II) collagen gene." Sangiorgi F.O., Benson-Chanda V., de Wet W.J., Sobel M.E., Tsipouras P., Ramirez F. Nucleic Acids Res. 13:2207-2225(1985) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 541-578; 784-803; 1056-1109 AND 1200-1487 (ISOFORMS 1/2). |
| [18] | "Structural analyses of the polymorphic area in type II collagen gene." Vikkula M., Peltonen L. FEBS Lett. 250:171-174(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 630-785 (ISOFORMS 1/2). |
| [19] | "Identification and characterization of the human type II collagen gene (COL2A1)." Cheah K.S.E., Stoker N.G., Griffin J.R., Grosveld F.G., Solomon E. Proc. Natl. Acad. Sci. U.S.A. 82:2555-2559(1985) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1032-1487 (ISOFORMS 1/2). |
| [20] | "An amino acid substitution (Gly853-->Glu) in the collagen alpha 1(II) chain produces hypochondrogenesis." Bogaert R., Tiller G.E., Wies M.A., Gruber H.E., Rimoin D.L., Cohn D.H., Eyre D.R. J. Biol. Chem. 267:22522-22526(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1038-1055 (ISOFORMS 1/2), VARIANT HYPOCHONDROGENESIS GLU-1053. |
| [21] | "Low basal transcription of genes for tissue-specific collagens by fibroblasts and lymphoblastoid cells. Application to the characterization of a glycine 997 to serine substitution in alpha 1(II) collagen chains of a patient with spondyloepiphyseal dysplasia." Chan D., Cole W.G. J. Biol. Chem. 266:12487-12494(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1082-1288 (ISOFORMS 1/2). |
| [22] | "Identification of the molecular defect in a family with spondyloepiphyseal dysplasia." Lee B., Vissing H., Ramirez F., Rogers D., Rimoin D.L. Science 244:978-980(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1146-1199 (ISOFORMS 1/2), VARIANT SEDC 1164-GLY--TYR-1399 DEL. |
| [23] | "Tandem duplication within a type II collagen gene (COL2A1) exon in an individual with spondyloepiphyseal dysplasia." Tiller G.E., Rimoin D.L., Murray L.W., Cohn D.H. Proc. Natl. Acad. Sci. U.S.A. 87:3889-3893(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 1164-1199 (ISOFORMS 1/2), VARIANT SEDC GLY-PRO-SER-GLY-LYS-ASP-GLY-ALA-ASN-GLY-ILE-PRO-GLY-PRO-ILE-1184 INS. |
| [24] | "Determination of the single polyadenylation site of the human pro alpha 1(II) collagen gene." Elima K., Vuorio T., Vuorio E. Nucleic Acids Res. 15:9499-9504(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1175-1487 (ISOFORMS 1/2). |
| [25] | "Construction and identification of a cDNA clone for human type II procollagen mRNA." Elima K., Maekelae J.K., Vuorio T., Kauppinen S., Knowles J., Vuorio E. Biochem. J. 229:183-188(1985) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1189-1467 (ISOFORMS 1/2). |
| [26] | "Chondrocalcin is identical with the C-propeptide of type II procollagen." Van der Rest M., Rosenberg L.C., Olsen B.R., Poole A.R. Biochem. J. 237:923-925(1986) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 1242-1265; 1295-1305 AND 1395-1408. |
| [27] | "Isolation and characterization of genomic clones corresponding to the human type II procollagen gene." Strom C.M., Upholt W.B. Nucleic Acids Res. 12:1025-1038(1984) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1245-1295 (ISOFORMS 1/2/3). |
| [28] | "Isolation and partial characterization of genomic clones coding for a human pro-alpha 1 (II) collagen chain and demonstration of restriction fragment length polymorphism at the 3' end of the gene." Nunez A.M., Francomano C., Young M.F., Martin G.R., Yamada Y. Biochemistry 24:6343-6348(1985) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1296-1358 (ISOFORMS 1/2/3). |
| [29] | "X-ray crystal structure of HLA-DR4 (DRA*0101, DRB1*0401) complexed with a peptide from human collagen II." Dessen A., Lawrence C.M., Cupo S., Zaller D.M., Wiley D.C. Immunity 7:473-481(1997) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 1238-1247. |
| [30] | "Solution structure and dynamics of a prototypical chordin-like cysteine-rich repeat (von Willebrand Factor type C module) from collagen IIA." O'Leary J.M., Hamilton J.M., Deane C.M., Valeyev N.V., Sandell L.J., Downing A.K. J. Biol. Chem. 279:53857-53866(2004) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 25-162 (ISOFORM 2), DISULFIDE BONDS. |
| [31] | "Mutations in collagen genes: causes of rare and some common diseases in humans." Kuivaniemi H., Tromp G., Prockop D.J. FASEB J. 5:2052-2060(1991) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [32] | "Mutations in fibrillar collagens (types I, II, III, and XI), fibril-associated collagen (type IX), and network-forming collagen (type X) cause a spectrum of diseases of bone, cartilage, and blood vessels." Kuivaniemi H., Tromp G., Prockop D.J. Hum. Mutat. 9:300-315(1997) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [33] | "Glycine to serine substitution in the triple helical domain of pro-alpha 1 (II) collagen results in a lethal perinatal form of short-limbed dwarfism." Vissing H., D'Alessio M., Lee B., Ramirez F., Godfrey M., Hollister D.W. J. Biol. Chem. 264:18265-18267(1989) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ACG2 SER-1143. |
| [34] | "Single base mutation in the type II procollagen gene (COL2A1) as a cause of primary osteoarthritis associated with a mild chondrodysplasia." Ala-Kokko L., Baldwin C.T., Moskowitz R.W., Prockop D.J. Proc. Natl. Acad. Sci. U.S.A. 87:6565-6568(1990) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT OACD CYS-719. |
| [35] | "Cartilage expression of a type II collagen mutation in an inherited form of osteoarthritis associated with a mild chondrodysplasia." Eyre D.R., Weis M.A., Moskowitz R.W. J. Clin. Invest. 87:357-361(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT OACD CYS-719. |
| [36] | "Characterization of a type II collagen gene (COL2A1) mutation identified in cultured chondrocytes from human hypochondrogenesis." Horton W.A., Machado M.A., Ellard J., Campbell D., Bartley J., Ramirez F., Vitale E., Lee B. Proc. Natl. Acad. Sci. U.S.A. 89:4583-4587(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HYPOCHONDROGENESIS SER-774. |
| [37] | "Mutation in type II procollagen (COL2A1) that substitutes aspartate for glycine alpha 1-67 and that causes cataracts and retinal detachment: evidence for molecular heterogeneity in the Wagner syndrome and the Stickler syndrome (arthro-ophthalmopathy)." Koerkkoe J., Ritvaniemi P., Haataja L., Kaeaeriaeinen H., Kivirikko K.I., Prockop D.J., Ala-Kokko L. Am. J. Hum. Genet. 53:55-61(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT STL1O ASP-267. |
| [38] | "A dominant mutation in the type II collagen gene (COL2A1) produces spondyloepimetaphyseal dysplasia (SEMD), Strudwick type." Tiller G.E., Weis M.A., Lachman R.S., Cohn D.H., Rimoin D.L., Eyre D.R. Am. J. Hum. Genet. 53:A209-A209(1993) Cited for: VARIANTS SEMDSTWK VAL-897 AND CYS-909. |
| [39] | "Human cartilage from late stage familial osteoarthritis transcribes type II collagen mRNA encoding a cysteine in position 519." Holderbaum D., Malemud C.J., Moskowitz R.W., Haqqi T.M. Biochem. Biophys. Res. Commun. 192:1169-1174(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT OACD CYS-719. |
| [40] | "A mutation in the amino-terminal end of the triple helix of type II collagen causing severe osteochondrodysplasia." Vikkula M., Ritvaniemi P., Vuorio A.F., Kaitila I., Ala-Kokko L., Peltonen L. Genomics 16:282-285(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPONDYLOMETAPHYSEAL DYSPLASIA ARG-354. |
| [41] | "Spondyloepiphyseal dysplasia and precocious osteoarthritis in a family with an Arg75-->Cys mutation in the procollagen type II gene (COL2A1)." Williams C.J., Considine E.L., Knowlton R.G., Reginato A., Neumann G., Harrison D., Buxton P., Jimenez S.A., Prockop D.J. Hum. Genet. 92:499-505(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CZECHD CYS-275. |
| [42] | "Characterization of an arginine 789 to cysteine substitution in alpha 1 (II) collagen chains of a patient with spondyloepiphyseal dysplasia." Chan D., Taylor T.K.F., Cole W.G. J. Biol. Chem. 268:15238-15245(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SEDC CYS-989. |
| [43] | "The clinical features of spondyloepiphyseal dysplasia congenita resulting from the substitution of glycine 997 by serine in the alpha 1(II) chain of type II collagen." Cole W.G., Hall R.K., Rogers J.G. J. Med. Genet. 30:27-35(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SEDC SER-1197. |
| [44] | "Expression, in cartilage, of a 7-amino-acid deletion in type II collagen from two unrelated individuals with Kniest dysplasia." Bogaert R., Wilkin D.J., Wilcox W.R., Lachman R.S., Rimoin D.L., Cohn D.H., Eyre D.R. Am. J. Hum. Genet. 55:1128-1136(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT STL1 302-ALA--LYS-308 DEL. |
| [45] | "A single amino acid substitution (G103D) in the type II collagen triple helix produces Kniest dysplasia." Wilkin D.J., Bogaert R., Lachman R.S., Rimoin D.L., Eyres D.R., Cohn D.H. Hum. Mol. Genet. 3:1999-2003(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT KD ASP-303. |
| [46] | "A single base mutation in the type II procollagen gene (COL2A1) that converts glycine alpha 1-247 to serine in a family with late-onset spondyloepiphyseal dysplasia." Ritvaniemi P., Sokolov B.P., Williams C.J., Considine W., Yurgenev L., Meerson E.M., Ala-Kokko L., Prockop D.J. Hum. Mutat. 3:261-267(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SEDC SER-447. |
| [47] | "A radiographic, morphologic, biochemical and molecular analysis of a case of achondrogenesis type II resulting from substitution for a glycine residue (Gly691-->Arg) in the type II collagen trimer." Mortier G.R., Wilkin D.J., Wilcox W.R., Rimoin D.L., Lachman R.S., Eyre D.R., Cohn D.H. Hum. Mol. Genet. 4:285-288(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ACG2 ARG-891. |
| [48] | "Three new point mutations in type II procollagen (COL2A1) and identification of a fourth family with the COL2A1 Arg519-->Cys base substitution using conformation sensitive gel electrophoresis." Williams C.J., Rock M., Considine E.L., McCarron S., Gow P., Ladda R., McLain D., Michels V.M., Murphy W., Prockop D.J., Ganguly A. Hum. Mol. Genet. 4:309-312(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CZECHD CYS-275, VARIANT SEDC SER-1176, VARIANT OACD CYS-719, VARIANT HYPOCHONDROGENESIS ARG-891, VARIANT ACG2 ARG-1188. |
| [49] | "A COL2A1 mutation in achondrogenesis type II results in the replacement of type II collagen by type I and III collagens in cartilage." Chan D., Cole W.G., Chow C.W., Mundlos S., Bateman J.F. J. Biol. Chem. 270:1747-1753(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ACG2 SER-969. |
| [50] | "Dominant mutations in the type II collagen gene, COL2A1, produce spondyloepimetaphyseal dysplasia, Strudwick type." Tiller G.E., Polumbo P.A., Weis M.A., Bogaert R., Lachman R.S., Cohn D.H., Rimoin D.L., Eyre D.R. Nat. Genet. 11:87-89(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SEMDSTWK VAL-492; CYS-504 AND CYS-909. |
| [51] | "An alpha 1(II) Gly913 to Cys substitution prevents the matrix incorporation of type II collagen which is replaced with type I and III collagens in cartilage from a patient with hypochondrogenesis." Mundlos S., Chan D., McGill J., Bateman J.F. Am. J. Med. Genet. 63:129-136(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HYPOCHONDROGENESIS CYS-1113. |
| [52] | "The deletion of six amino acids at the C-terminus of the alpha 1 (II) chain causes overmodification of type II and type XI collagen: further evidence for the association between small deletions in COL2A1 and Kniest dysplasia." Winterpacht A., Superti-Furga A., Schwarze U., Stoess H., Steinmann B., Spranger J., Zabel B. J. Med. Genet. 33:649-654(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT KD 1207-PRO--GLY-1212 DEL. |
| [53] | "Stickler-like syndrome due to a dominant negative mutation in the COL2A1 gene." Ballo R., Beighton P.H., Ramesar R.S. Am. J. Med. Genet. 80:6-11(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EDMMD CYS-904. |
| [54] | "Five families with arginine 519-cysteine mutation in COL2A1: evidence for three distinct founders." Bleasel J.F., Holderbaum D., Brancolini V., Moskowitz R.W., Considine E.L., Prockop D.J., Devoto M., Williams C.J. Hum. Mutat. 12:172-176(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPONDYLOEPIPHYSEAL DYSPLASIA CYS-719. |
| [55] | "Variation in the vitreous phenotype of Stickler syndrome can be caused by different amino acid substitutions in the X position of the type II collagen Gly-X-Y triple helix." Richards A.J., Baguley D.M., Yates J.R.W., Lane C., Nicol M., Harper P.S., Scott J.D., Snead M.P. Am. J. Hum. Genet. 67:1083-1094(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT STL1 CYS-565, VARIANT DRRD PHE-667. |
| [56] | "Boy with syndactylies, macrocephaly, and severe skeletal dysplasia: not a new syndrome, but two dominant mutations (GLI3 E543X and COL2A1 G973R) in the same individual." Sobetzko D., Eich G., Kalff-Suske M., Grzeschik K.-H., Superti-Furga A. Am. J. Med. Genet. 90:239-242(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SEDC ARG-1173. |
| [57] | "Widely distributed mutations in the COL2A1 gene produce achondrogenesis type II/hypochondrogenesis." Koerkkoe J., Cohn D.H., Ala-Kokko L., Krakow D., Prockop D.J. Am. J. Med. Genet. 92:95-100(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ACG2 VAL-453; ASP-453; ASP-771; ARG-780; ARG-795; GLU-894; ASP-948; SER-981; VAL-1065 AND ARG-1119, VARIANT HYPOCHONDROGENESIS 1017-GLY--VAL-1022 DEL, VARIANT ILE-1331. |
| [58] | "Report of five novel and one recurrent COL2A1 mutations with analysis of genotype-phenotype correlation in patients with a lethal type II collagen disorder." Mortier G.R., Weis M., Nuytinck L., King L.M., Wilkin D.J., De Paepe A., Lachman R.S., Rimoin D.L., Eyre D.R., Cohn D.H. J. Med. Genet. 37:263-271(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ACG2 SER-513; VAL-717; ALA-771; CYS-1110 AND SER-1143, VARIANT PLSD-T ASN-1390. |
| [59] | "Double heterozygosity for pseudoachondroplasia and spondyloepiphyseal dysplasia congenita." Unger S., Koerkkoe J., Krakow D., Lachman R.S., Rimoin D.L., Cohn D.H. Am. J. Med. Genet. 104:140-146(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SEDC MET-1439. |
| [60] | "Vitreoretinopathy with phalangeal epiphyseal dysplasia, a type II collagenopathy resulting from a novel mutation in the C-propeptide region of the molecule." Richards A.J., Morgan J., Bearcroft P.W.P., Pickering E., Owen M.J., Holmans P., Williams N., Tysoe C., Pope F.M., Snead M.P., Hughes H. J. Med. Genet. 39:661-665(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT VITREORETINOPATHY ASP-1305. |
| [61] | "Recurrence of achondrogenesis type II within the same family: evidence for germline mosaicism." Faivre L., Le Merrer M., Douvier S., Laurent N., Thauvin-Robinet C., Rousseau T., Vereecke I., Sagot P., Delezoide A.-L., Coucke P., Mortier G. Am. J. Med. Genet. A 126:308-312(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ACGA2 ASP-516. |
| [62] | "Spondyloperipheral dysplasia is caused by truncating mutations in the C-propeptide of COL2A1." Zankl A., Zabel B., Hilbert K., Wildhardt G., Cuenot S., Xavier B., Ha-Vinh R., Bonafe L., Spranger J., Superti-Furga A. Am. J. Med. Genet. A 129:144-148(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SPONDYLOPERIPHERAL DYSPLASIA. |
| [63] | "Identification of COL2A1 mutations in platyspondylic skeletal dysplasia, Torrance type." Nishimura G., Nakashima E., Mabuchi A., Shimamoto K., Shimamoto T., Shimao Y., Nagai T., Yamaguchi T., Kosaki R., Ohashi H., Makita Y., Ikegawa S. J. Med. Genet. 41:75-79(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PLSD-T CYS-1391. |
| [64] | "Dominant negative mutations in the C-propeptide of COL2A1 cause platyspondylic lethal skeletal dysplasia, torrance type, and define a novel subfamily within the type 2 collagenopathies." Zankl A., Neumann L., Ignatius J., Nikkels P., Schrander-Stumpel C., Mortier G., Omran H., Wright M., Hilbert K., Bonafe L., Spranger J., Zabel B., Superti-Furga A. Am. J. Med. Genet. A 133:61-67(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PLSD-T PRO-1448; HIS-1469; VAL-1484 DEL AND GLY-1485, DISCUSSION OF VARIANT ASN-1390. |
| [65] | "Novel amino acid substitution in the Y-position of collagen type II causes spondyloepimetaphyseal dysplasia congenita." Sulko J., Czarny-Ratajczak M., Wozniak A., Latos-Bielenska A., Kozlowski K. Am. J. Med. Genet. A 137:292-297(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SEMDSTWK GLY-992. |
| [66] | "A novel mutation of COL2A1 resulting in dominantly inherited rhegmatogenous retinal detachment." Richards A.J., Meredith S., Poulson A., Bearcroft P., Crossland G., Baguley D.M., Scott J.D., Snead M.P. Invest. Ophthalmol. Vis. Sci. 46:663-668(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS DRRD ARG-318 AND PHE-667. |
| [67] | "Type II collagen gene variants and inherited osteonecrosis of the femoral head." Liu Y.-F., Chen W.-M., Lin Y.-F., Yang R.-C., Lin M.-W., Li L.-H., Chang Y.-H., Jou Y.-S., Lin P.-Y., Su J.-S., Huang S.-F., Hsiao K.-J., Fann C.S.J., Hwang H.-W., Chen Y.-T., Tsai S.-F. N. Engl. J. Med. 352:2294-2301(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ANFH SER-717 AND SER-1170. |
| [68] | "High efficiency of mutation detection in type 1 stickler syndrome using a two-stage approach: vitreoretinal assessment coupled with exon sequencing for screening COL2A1." Richards A.J., Laidlaw M., Whittaker J., Treacy B., Rai H., Bearcroft P., Baguley D.M., Poulson A., Ang A., Scott J.D., Snead M.P. Hum. Mutat. 27:696-704(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN STL1O. |
| [69] | "A familial case of achondrogenesis type II caused by a dominant COL2A1 mutation and 'patchy' expression in the mosaic father." Forzano F., Lituania M., Viassolo A., Superti-Furga V., Wildhardt G., Zabel B., Faravelli F. Am. J. Med. Genet. A 143:2815-2820(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ACG2 VAL-547. |
| [70] | "A recurrent mutation in type II collagen gene causes Legg-Calve-Perthes disease in a Japanese family." Miyamoto Y., Matsuda T., Kitoh H., Haga N., Ohashi H., Nishimura G., Ikegawa S. Hum. Genet. 121:625-629(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LCPD SER-1170. |
| [71] | "Czech dysplasia: report of a large family and further delineation of the phenotype." Tzschach A., Tinschert S., Kaminsky E., Lusga E., Mundlos S., Graul-Neumann L.M. Am. J. Med. Genet. A 146:1859-1864(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CZECHD CYS-275. |
| [72] | "Natural variation in four human collagen genes across an ethnically diverse population." Chan T.F., Poon A., Basu A., Addleman N.R., Chen J., Phong A., Byers P.H., Klein T.E., Kwok P.Y. Genomics 91:307-314(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SER-9; ASP-142; ILE-638; THR-1051; ILE-1331 AND SER-1405. |
| [73] | "Missense and nonsense mutations in the alternatively-spliced exon 2 of COL2A1 cause the ocular variant of Stickler syndrome." McAlinden A., Majava M., Bishop P.N., Perveen R., Black G.C.M., Pierpont M.E., Ala-Kokko L., Maennikkoe M. Hum. Mutat. 29:83-90(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT STL1O TYR-57. |
| [74] | "Czech dysplasia occurring in a Japanese family." Matsui Y., Michigami T., Tachikawa K., Yamazaki M., Kawabata H., Nishimura G. Am. J. Med. Genet. A 149:2285-2289(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CZECHD CYS-275. |
| [75] | "Stickler syndrome and the vitreous phenotype: mutations in COL2A1 and COL11A1." Richards A.J., McNinch A., Martin H., Oakhill K., Rai H., Waller S., Treacy B., Whittaker J., Meredith S., Poulson A., Snead M.P. Hum. Mutat. 31:E1461-E1471(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS STL1 ASP-240; ARG-270; ASP-282; ALA-453; ARG-501; CYS-904 AND ALA-1158. |
| [76] | "Pseudoachondroplasia and multiple epiphyseal dysplasia: A 7-year comprehensive analysis of the known disease genes identify novel and recurrent mutations and provides an accurate assessment of their relative contribution." Jackson G.C., Mittaz-Crettol L., Taylor J.A., Mortier G.R., Spranger J., Zabel B., Le Merrer M., Cormier-Daire V., Hall C.M., Offiah A., Wright M.J., Savarirayan R., Nishimura G., Ramsden S.C., Elles R., Bonafe L., Superti-Furga A., Unger S., Zankl A., Briggs M.D. Hum. Mutat. 33:144-157(2012) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS VAL-1176 AND ARG-1179. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X16468 mRNA. Translation: CAA34488.1. L10347 Genomic DNA. Translation: AAC41772.1. BT007205 mRNA. Translation: AAP35869.1. AC004801 Genomic DNA. No translation available. BC007252 mRNA. Translation: AAH07252.1. Frameshift. BC116449 mRNA. Translation: AAI16450.1. X16711 mRNA. Translation: CAA34683.1. M25730 M64345 Genomic DNA. Translation: AAA58428.2.M60299 Genomic DNA. Translation: AAA73873.1. M25698 Genomic DNA. Translation: AAA52051.1. X58709 Genomic DNA. No translation available. X57010 Genomic DNA. Translation: CAA40330.1. U15195 Genomic DNA. Translation: AAB60370.1. X13783 mRNA. Translation: CAA32030.1. M25728 Genomic DNA. Translation: AAD15287.1. X02371 X02374 Genomic DNA. Translation: CAA26223.1.X02375 Genomic DNA. Translation: CAA26224.1. X02376 Genomic DNA. Translation: CAA26225.1. X02377 Genomic DNA. Translation: CAA26226.1. X02378 Genomic DNA. Translation: CAA26227.1. X16158 Genomic DNA. Translation: CAA34278.1. X16158 Genomic DNA. Translation: CAA34279.1. X16158 Genomic DNA. Translation: CAA34280.1. X16158 Genomic DNA. Translation: CAA34281.1. X16158 Genomic DNA. Translation: CAA34282.1. X16158 Genomic DNA. Translation: CAA34283.1. X16158 Genomic DNA. Translation: CAA34284.1. J00116 Genomic DNA. Translation: AAA51997.1. L00977 Genomic DNA. No translation available. M63281 mRNA. Translation: AAA52038.1. M27468 Genomic DNA. Translation: AAA52039.1. X06268 mRNA. Translation: CAA29604.1. X00339 Genomic DNA. Translation: CAA25092.1. M12048 Genomic DNA. No translation available. | ||||||||||||||||||||||||
| IPI | IPI00186460. IPI00748487. IPI00936892. | ||||||||||||||||||||||||
| PIR | CGHU6C. A38513. | ||||||||||||||||||||||||
| RefSeq | NP_001835.3. NM_001844.4. NP_149162.2. NM_033150.2. | ||||||||||||||||||||||||
| UniGene | Hs.408182. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P02458. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | P02458. 2 interactions. | ||||||||||||||||||||||||
| MINT | MINT-6796075. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P02458. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 124056489. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | P02458. | ||||||||||||||||||||||||
| PRIDE | P02458. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 1280. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000337299; ENSP00000338213; ENSG00000139219. ENST00000380518; ENSP00000369889; ENSG00000139219. | ||||||||||||||||||||||||
| GeneID | 1280. | ||||||||||||||||||||||||
| KEGG | hsa:1280. | ||||||||||||||||||||||||
| UCSC | uc001rqt.3. human. uc001rqu.3. human. uc001rqv.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 1280. | ||||||||||||||||||||||||
| GeneCards | GC12M048266. | ||||||||||||||||||||||||
| HGNC | HGNC:2200. COL2A1. | ||||||||||||||||||||||||
| HPA | CAB002214. | ||||||||||||||||||||||||
| MIM | 108300. phenotype. 120140. gene+phenotype. 132450. phenotype. 150600. phenotype. 151210. phenotype. 156550. phenotype. 183900. phenotype. 184250. phenotype. 200610. phenotype. 271700. phenotype. 604864. phenotype. 608805. phenotype. 609162. phenotype. 609508. phenotype. | ||||||||||||||||||||||||
| neXtProt | NX_P02458. | ||||||||||||||||||||||||
| Orphanet | 93296. Achondrogenesis type 2. 209867. Autosomal dominant rhegmatogenous retinal detachment. 137678. Czech dysplasia, metatarsal type. 86820. Familial avascular necrosis of femoral head. 93297. Hypochondrogenesis. 485. Kniest dysplasia. 2380. Legg-Calve-Perthes disease. 93279. Mild spondyloepiphyseal dysplasia due to COL2A1 mutation with early-onset osteoarthritis. 166011. Multiple epiphyseal dysplasia, Beighton type. 1427. Otospondylomegaepiphyseal dysplasia. 85166. Platyspondylic dysplasia, Torrance type. 93346. Spondyloepimetaphyseal dysplasia congenita, Strudwick type. 94068. Spondyloepiphyseal dysplasia congenita. 93315. Spondylometaphyseal dysplasia, 'corner fracture' type. 1856. Spondyloperipheral dysplasia - short ulna. 90653. Stickler syndrome type 1. | ||||||||||||||||||||||||
| PharmGKB | PA26715. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG12793. | ||||||||||||||||||||||||
| HOVERGEN | HBG004933. | ||||||||||||||||||||||||
| KO | K06236. | ||||||||||||||||||||||||
| OMA | SSCRICV. | ||||||||||||||||||||||||
| OrthoDB | EOG4FTW1C. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. REACT_118779. Extracellular matrix organization. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| Bgee | P02458. | ||||||||||||||||||||||||
| Genevestigator | P02458. | ||||||||||||||||||||||||
| GermOnline | ENSG00000139219. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR008160. Collagen. IPR000885. Fib_collagen_C. IPR001007. VWF_C. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF01410. COLFI. 1 hit. PF01391. Collagen. 9 hits. PF00093. VWC. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProDom | PD002078. Fib_collagen_C. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||
| SMART | SM00038. COLFI. 1 hit. SM00214. VWC. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS51461. NC1_FIB. 1 hit. PS01208. VWFC_1. 1 hit. PS50184. VWFC_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | COL2A1. human. | ||||||||||||||||||||||||
| DrugBank | DB00048. Collagenase. | ||||||||||||||||||||||||
| EvolutionaryTrace | P02458. | ||||||||||||||||||||||||
| GenomeRNAi | 1280. | ||||||||||||||||||||||||
| NextBio | 5171. | ||||||||||||||||||||||||
| PMAP-CutDB | P02458. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | CO2A1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P02458 Secondary accession number(s): A6NGA0 Q9UE43 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
