Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Immunoglobulin heavy constant mu

Gene

Ighm

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

IgM antibodies play an important role in primary defense mechanisms. They have been shown to be involved in early recognition of external invaders like bacteria and viruses, cellular waste and modified self, as well as in recognition and elimination of precancerous and cancerous lesions (By similarity).By similarity

GO - Molecular functioni

  • antigen binding Source: MGI
  • identical protein binding Source: IntAct
  • immunoglobulin receptor binding Source: AgBase
  • transmembrane signaling receptor activity Source: MGI

GO - Biological processi

  • activation of MAPK activity Source: MGI
  • antigen processing and presentation Source: MGI
  • B cell affinity maturation Source: MGI
  • B cell receptor signaling pathway Source: MGI
  • complement activation, classical pathway Source: GO_Central
  • defense response to Gram-negative bacterium Source: MGI
  • early endosome to late endosome transport Source: MGI
  • humoral immune response mediated by circulating immunoglobulin Source: MGI
  • immunoglobulin mediated immune response Source: MGI
  • innate immune response Source: GO_Central
  • phagocytosis, engulfment Source: GO_Central
  • phagocytosis, recognition Source: GO_Central
  • positive regulation of B cell activation Source: MGI
  • positive regulation of B cell proliferation Source: MGI
  • positive regulation of endocytosis Source: MGI
  • positive regulation of immune response Source: MGI
  • positive regulation of MAPK cascade Source: MGI
  • positive regulation of peptidyl-tyrosine phosphorylation Source: MGI
  • regulation of cell morphogenesis Source: MGI
  • regulation of immunoglobulin production Source: MGI

Names & Taxonomyi

Protein namesi
Recommended name:
Immunoglobulin heavy constant mu
Cleaved into the following chain:
Mu' chain1 Publication
Alternative name(s):
55 kDa mu' chain1 Publication
Gene namesi
Name:Ighm
Synonyms:Igh-6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:96448 Ighm

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi96N → A: Abolishes formation of 55 kDa cleavage product. 1 Publication1
Mutagenesisi215C → S: Impairs dimerization. 1 Publication1
Mutagenesisi292C → S: Impairs dimerization. 1 Publication1
Mutagenesisi453C → S: Impairs dimerization and oligomerization. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000153623‹1 – 454Immunoglobulin heavy constant muAdd BLAST›454
ChainiPRO_000044395197 – 454Mu' chain1 PublicationAdd BLAST358

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi13Interchain (with light chain)1 Publication
Disulfide bondi27 ↔ 88PROSITE-ProRule annotation2 Publications
Glycosylationi45N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi135 ↔ 198PROSITE-ProRule annotation1 Publication
Glycosylationi210N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi215Interchain (with heavy chain)PROSITE-ProRule annotation1 Publication
Glycosylationi242N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi245 ↔ 304PROSITE-ProRule annotation1 Publication
Glycosylationi257N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi280N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi292Interchain (with heavy chain)1 Publication
Disulfide bondi352 ↔ 414PROSITE-ProRule annotation1 Publication
Glycosylationi441N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi453Interchain (with heavy chain)1 Publication

Post-translational modificationi

Cleaved by a non-enzymatic process after Asn-96, yielding a glycosylated protein of 55 kDa. The process is induced by other proteins, and requires neutral or alkaline pH.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei96 – 97Cleavage1 Publication2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiP01872
MaxQBiP01872
PeptideAtlasiP01872
PRIDEiP01872

PTM databases

CarbonylDBiP01872
iPTMnetiP01872
PhosphoSitePlusiP01872

Expressioni

Tissue specificityi

Mu' chain is expressed in bone marrow.1 Publication

Gene expression databases

CleanExiMM_IGH-6

Interactioni

Subunit structurei

Immunoglobulin (Ig) molecules consist of two chains, one heavy chain (which can be alpha, delta, epsilon, gamma or mu) and one light chain (which can be kappa or lambda) each consisting of a variable and a constant region. An IgM molecule contains thus a mu heavy chain combined with either a kappa or a lambda light chains (By similarity).By similarity

Binary interactionsi

Show more details

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • immunoglobulin receptor binding Source: AgBase

Protein-protein interaction databases

IntActiP01872, 5 interactors

Structurei

Secondary structure

1454
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi112 – 117Combined sources6
Beta strandi124 – 128Combined sources5
Beta strandi130 – 143Combined sources14
Beta strandi146 – 151Combined sources6
Beta strandi158 – 162Combined sources5
Beta strandi177 – 186Combined sources10
Helixi187 – 191Combined sources5
Beta strandi196 – 202Combined sources7
Beta strandi205 – 211Combined sources7
Beta strandi224 – 228Combined sources5
Helixi232 – 238Combined sources7
Beta strandi239 – 248Combined sources10
Beta strandi257 – 262Combined sources6
Beta strandi280 – 283Combined sources4
Beta strandi285 – 291Combined sources7
Helixi293 – 297Combined sources5
Beta strandi302 – 307Combined sources6
Beta strandi309 – 313Combined sources5
Beta strandi315 – 319Combined sources5
Beta strandi331 – 335Combined sources5
Helixi339 – 342Combined sources4
Beta strandi345 – 360Combined sources16
Beta strandi363 – 368Combined sources6
Helixi375 – 377Combined sources3
Beta strandi393 – 402Combined sources10
Helixi403 – 407Combined sources5
Beta strandi412 – 417Combined sources6
Beta strandi424 – 431Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4BA8NMR-A222-321[»]
4JVUX-ray1.30A/B103-217[»]
4JVWX-ray2.00A/B/C/D324-436[»]
ProteinModelPortaliP01872
SMRiP01872
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni‹1 – 104CH1Add BLAST›104
Regioni105 – 216CH2Add BLAST112
Regioni217 – 323CH3Add BLAST107
Regioni324 – 454Important for oligomerizationAdd BLAST131
Regioni324 – 435CH4Add BLAST112

Keywords - Domaini

Immunoglobulin C region, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG005814

Family and domain databases

Gene3Di2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003006 Ig/MHC_CS
IPR003597 Ig_C1-set
PfamiView protein in Pfam
PF07654 C1-set, 4 hits
SMARTiView protein in SMART
SM00407 IGc1, 4 hits
SUPFAMiSSF48726 SSF48726, 4 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 4 hits
PS00290 IG_MHC, 3 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P01872-1) [UniParc]FASTAAdd to basket
Also known as: Secreted

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
SQSFPNVFPL VSCESPLSDK NLVAMGCLAR DFLPSTISFT WNYQNNTEVI
60 70 80 90 100
QGIRTFPTLR TGGKYLATSQ VLLSPKSILE GSDEYLVCKI HYGGKNRDLH
110 120 130 140 150
VPIPAVAEMN PNVNVFVPPR DGFSGPAPRK SKLICEATNF TPKPITVSWL
160 170 180 190 200
KDGKLVESGF TTDPVTIENK GSTPQTYKVI STLTISEIDW LNLNVYTCRV
210 220 230 240 250
DHRGLTFLKN VSSTCAASPS TDILTFTIPP SFADIFLSKS ANLTCLVSNL
260 270 280 290 300
ATYETLNISW ASQSGEPLET KIKIMESHPN GTFSAKGVAS VCVEDWNNRK
310 320 330 340 350
EFVCTVTHRD LPSPQKKFIS KPNEVHKHPP AVYLLPPARE QLNLRESATV
360 370 380 390 400
TCLVKGFSPA DISVQWLQRG QLLPQEKYVT SAPMPEPGAP GFYFTHSILT
410 420 430 440 450
VTEEEWNSGE TYTCVVGHEA LPHLVTERTV DKSTGKPTLY NVSLIMSDTG

GTCY
Length:454
Mass (Da):49,972
Last modified:February 1, 2005 - v2
Checksum:iEBCCA6E8569AEEC5
GO
Isoform 2 (identifier: P01872-2) [UniParc]FASTAAdd to basket
Also known as: Membrane-bound

The sequence of this isoform differs from the canonical sequence as follows:
     435-454: GKPTLYNVSLIMSDTGGTCY → EGEVNAEEEGFENLWTTASTFIVLFLLSLFYSTTVTLFKVK

Show »
Length:475
Mass (Da):52,527
Checksum:iF2163AD4517E1485
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Non-terminal residuei11

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti77S → N in MOPC 104E. 1
Natural varianti100H → Q in MOPC 104E. 1
Natural varianti225T → N in TEPC183 and MOPC 104E. 1
Natural varianti257N → S in TEPC183. 1
Natural varianti257N → T in MOPC 104E. 1
Natural varianti367L → K in TEPC183 and MOPC 104E; requires 2 nucleotide substitutions. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053388435 – 454GKPTL…GGTCY → EGEVNAEEEGFENLWTTAST FIVLFLLSLFYSTTVTLFKV K in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
V00821 mRNA Translation: CAA24202.1
V00827 mRNA No translation available.
J00443, J00444 Genomic DNA Translation: AAB59650.1
J00443, J00444 Genomic DNA Translation: AAB59651.1
PIRiA02166 MHMS
A02167 MHMSM
UniGeneiMm.304472
Mm.313488
Mm.342177
Mm.428442
Mm.435580
Mm.436922
Mm.439101

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiIGHM_MOUSE
AccessioniPrimary (citable) accession number: P01872
Secondary accession number(s): P01873
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: February 1, 2005
Last modified: April 25, 2018
This is version 145 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health