Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P01732

- CD8A_HUMAN

UniProt

P01732 - CD8A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

T-cell surface glycoprotein CD8 alpha chain

Gene

CD8A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.

GO - Molecular functioni

  1. coreceptor activity Source: UniProtKB
  2. MHC class I protein binding Source: UniProtKB

GO - Biological processi

  1. antigen processing and presentation Source: UniProtKB
  2. cytotoxic T cell differentiation Source: Ensembl
  3. defense response to virus Source: Ensembl
  4. immune response Source: UniProtKB
  5. positive regulation of calcium-mediated signaling Source: Ensembl
  6. regulation of immune response Source: Reactome
  7. T cell activation Source: UniProtKB
  8. T cell mediated immunity Source: Ensembl
  9. transmembrane receptor protein tyrosine kinase signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Adaptive immunity, Immunity

Enzyme and pathway databases

ReactomeiREACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell surface glycoprotein CD8 alpha chain
Alternative name(s):
T-lymphocyte differentiation antigen T8/Leu-2
CD_antigen: CD8a
Gene namesi
Name:CD8A
Synonyms:MAL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:1706. CD8A.

Subcellular locationi

GO - Cellular componenti

  1. external side of plasma membrane Source: MGI
  2. extracellular region Source: UniProtKB-KW
  3. integral component of plasma membrane Source: UniProtKB
  4. plasma membrane Source: Reactome
  5. T cell receptor complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

CD8 deficiency, familial (CD8 deficiency) [MIM:608957]: An immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti111 – 1111G → S in CD8 deficiency; prevents CD8 expression. 1 Publication
VAR_021020

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi111 – 1111G → R: Prevents CD8 expression. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi608957. phenotype.
Orphaneti169085. Susceptibility to respiratory infections associated with CD8alpha chain mutation.
PharmGKBiPA26244.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Add
BLAST
Chaini22 – 235214T-cell surface glycoprotein CD8 alpha chainPRO_0000014638Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi43 ↔ 115

Post-translational modificationi

All of the five most C-terminal cysteines form inter-chain disulfide bonds in dimers and higher multimers, while the four N-terminal cysteines do not.By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiP01732.
PRIDEiP01732.

PTM databases

PhosphoSiteiP01732.

Expressioni

Gene expression databases

BgeeiP01732.
CleanExiHS_CD8A.
HS_MAL.
ExpressionAtlasiP01732. baseline and differential.
GenevestigatoriP01732.

Organism-specific databases

HPAiCAB000012.
HPA037756.

Interactioni

Subunit structurei

In general heterodimer of an alpha and a beta chain linked by two disulfide bonds. Can also form homodimers. Shown to be expressed as heterodimer on thymocytes and as homodimer on peripheral blood T-lymphocytes. Interacts with the MHC class I HLA-A/B2M dimer. Interacts with LCK in a zinc-dependent manner.3 Publications

Protein-protein interaction databases

BioGridi107363. 14 interactions.
IntActiP01732. 4 interactions.
STRINGi9606.ENSP00000283635.

Structurei

Secondary structure

1
235
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi24 – 274
Beta strandi39 – 457
Beta strandi54 – 6411
Beta strandi68 – 7710
Turni86 – 883
Beta strandi89 – 946
Beta strandi97 – 1048
Helixi107 – 1093
Beta strandi111 – 1199
Beta strandi122 – 1254
Beta strandi129 – 1313

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1AKJX-ray2.65D/E22-141[»]
1CD8X-ray2.60A22-135[»]
1Q69NMR-A209-227[»]
2HP4X-ray2.10A/B22-135[»]
3QZWX-ray2.80G/H/I/J22-135[»]
ProteinModelPortaliP01732.
SMRiP01732. Positions 22-135.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP01732.

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 182161ExtracellularSequence AnalysisAdd
BLAST
Topological domaini204 – 23532CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei183 – 20321HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 135114Ig-like V-typeAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG46810.
GeneTreeiENSGT00510000048935.
HOGENOMiHOG000004794.
HOVERGENiHBG008488.
InParanoidiP01732.
KOiK06458.
OrthoDBiEOG7N37F3.
PhylomeDBiP01732.
TreeFamiTF336070.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR015468. CD8_asu.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
[Graphical view]
PANTHERiPTHR10441. PTHR10441. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00406. IGv. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P01732-1) [UniParc]FASTAAdd to Basket

Also known as: membrane, mCD8alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALPVTALLL PLALLLHAAR PSQFRVSPLD RTWNLGETVE LKCQVLLSNP
60 70 80 90 100
TSGCSWLFQP RGAAASPTFL LYLSQNKPKA AEGLDTQRFS GKRLGDTFVL
110 120 130 140 150
TLSDFRRENE GYYFCSALSN SIMYFSHFVP VFLPAKPTTT PAPRPPTPAP
160 170 180 190 200
TIASQPLSLR PEACRPAAGG AVHTRGLDFA CDIYIWAPLA GTCGVLLLSL
210 220 230
VITLYCNHRN RRRVCKCPRP VVKSGDKPSL SARYV
Length:235
Mass (Da):25,729
Last modified:July 21, 1986 - v1
Checksum:iFCCA29BAA73726BB
GO
Isoform 2 (identifier: P01732-2) [UniParc]FASTAAdd to Basket

Also known as: secreted, sCD8alpha

The sequence of this isoform differs from the canonical sequence as follows:
     172-209: VHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHR → G

Show »
Length:198
Mass (Da):21,585
Checksum:iBC89FA59F150598F
GO
Isoform 3 (identifier: P01732-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRNQAPGRPKGATFPPRRPTGSRAPPLAPELRAKQRPGERVM

Note: No experimental confirmation available.

Show »
Length:276
Mass (Da):30,214
Checksum:i0D75B1136A240ED4
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti111 – 1111G → S in CD8 deficiency; prevents CD8 expression. 1 Publication
VAR_021020

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MRNQAPGRPKGATFPPRRPT GSRAPPLAPELRAKQRPGER VM in isoform 3. 1 PublicationVSP_054438
Alternative sequencei172 – 20938VHTRG…YCNHR → G in isoform 2. CuratedVSP_012653Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M26315, M26313, M26314 Genomic DNA. Translation: AAA79217.1.
M26315, M26313, M26314 Genomic DNA. Translation: AAA79218.1.
M12824 mRNA. Translation: AAA61133.1.
M12828 mRNA. Translation: AAB04637.1.
M27161 Genomic DNA. Translation: AAA59674.1.
AK300089 mRNA. Translation: BAG61892.1.
AC064848 Genomic DNA. Translation: AAX88864.1.
AC112696 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99438.1.
CH471053 Genomic DNA. Translation: EAW99439.1.
CH471053 Genomic DNA. Translation: EAW99440.1.
CCDSiCCDS1992.1. [P01732-1]
CCDS1993.1. [P01732-2]
PIRiA30604. RWHUT8.
RefSeqiNP_001139345.1. NM_001145873.1. [P01732-1]
NP_001759.3. NM_001768.6. [P01732-1]
NP_741969.1. NM_171827.3. [P01732-2]
UniGeneiHs.85258.

Genome annotation databases

EnsembliENST00000283635; ENSP00000283635; ENSG00000153563. [P01732-1]
ENST00000352580; ENSP00000321631; ENSG00000153563. [P01732-2]
ENST00000409511; ENSP00000386559; ENSG00000153563. [P01732-1]
GeneIDi925.
KEGGihsa:925.
UCSCiuc002srt.3. human. [P01732-1]
uc002sru.3. human. [P01732-2]

Polymorphism databases

DMDMi116035.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

CD8Abase

CD8A mutation db

Wikipedia

CD8 entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M26315 , M26313 , M26314 Genomic DNA. Translation: AAA79217.1 .
M26315 , M26313 , M26314 Genomic DNA. Translation: AAA79218.1 .
M12824 mRNA. Translation: AAA61133.1 .
M12828 mRNA. Translation: AAB04637.1 .
M27161 Genomic DNA. Translation: AAA59674.1 .
AK300089 mRNA. Translation: BAG61892.1 .
AC064848 Genomic DNA. Translation: AAX88864.1 .
AC112696 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99438.1 .
CH471053 Genomic DNA. Translation: EAW99439.1 .
CH471053 Genomic DNA. Translation: EAW99440.1 .
CCDSi CCDS1992.1. [P01732-1 ]
CCDS1993.1. [P01732-2 ]
PIRi A30604. RWHUT8.
RefSeqi NP_001139345.1. NM_001145873.1. [P01732-1 ]
NP_001759.3. NM_001768.6. [P01732-1 ]
NP_741969.1. NM_171827.3. [P01732-2 ]
UniGenei Hs.85258.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1AKJ X-ray 2.65 D/E 22-141 [» ]
1CD8 X-ray 2.60 A 22-135 [» ]
1Q69 NMR - A 209-227 [» ]
2HP4 X-ray 2.10 A/B 22-135 [» ]
3QZW X-ray 2.80 G/H/I/J 22-135 [» ]
ProteinModelPortali P01732.
SMRi P01732. Positions 22-135.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107363. 14 interactions.
IntActi P01732. 4 interactions.
STRINGi 9606.ENSP00000283635.

PTM databases

PhosphoSitei P01732.

Polymorphism databases

DMDMi 116035.

Proteomic databases

PaxDbi P01732.
PRIDEi P01732.

Protocols and materials databases

DNASUi 925.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000283635 ; ENSP00000283635 ; ENSG00000153563 . [P01732-1 ]
ENST00000352580 ; ENSP00000321631 ; ENSG00000153563 . [P01732-2 ]
ENST00000409511 ; ENSP00000386559 ; ENSG00000153563 . [P01732-1 ]
GeneIDi 925.
KEGGi hsa:925.
UCSCi uc002srt.3. human. [P01732-1 ]
uc002sru.3. human. [P01732-2 ]

Organism-specific databases

CTDi 925.
GeneCardsi GC02M086923.
HGNCi HGNC:1706. CD8A.
HPAi CAB000012.
HPA037756.
MIMi 186910. gene.
608957. phenotype.
neXtProti NX_P01732.
Orphaneti 169085. Susceptibility to respiratory infections associated with CD8alpha chain mutation.
PharmGKBi PA26244.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG46810.
GeneTreei ENSGT00510000048935.
HOGENOMi HOG000004794.
HOVERGENi HBG008488.
InParanoidi P01732.
KOi K06458.
OrthoDBi EOG7N37F3.
PhylomeDBi P01732.
TreeFami TF336070.

Enzyme and pathway databases

Reactomei REACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Miscellaneous databases

EvolutionaryTracei P01732.
GeneWikii CD8A.
GenomeRNAii 925.
NextBioi 35474861.
PROi P01732.
SOURCEi Search...

Gene expression databases

Bgeei P01732.
CleanExi HS_CD8A.
HS_MAL.
ExpressionAtlasi P01732. baseline and differential.
Genevestigatori P01732.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
InterProi IPR015468. CD8_asu.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
[Graphical view ]
PANTHERi PTHR10441. PTHR10441. 1 hit.
Pfami PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00406. IGv. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes."
    Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R.
    Cell 40:237-246(1985) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Structure of Leu-2/T8 as deduced from the sequence of a cDNA clone."
    Parnes J.R., Sizer K.C., Sukhatme V.P., Hunkapiller T.
    Behring Inst. Mitt. 77:48-55(1985) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
  3. "The T cell differentiation antigen Leu-2/T8 is homologous to immunoglobulin and T cell receptor variable regions."
    Sukhatme V.P., Sizer K.C., Vollmer A.C., Hunkapiller T., Parnes J.R.
    Cell 40:591-597(1985) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Structure and expression of the gene encoding CD8 alpha chain (Leu-2/T8)."
    Nakayama K., Tokito S., Okumura K., Nakauchi H.
    Immunogenetics 30:393-397(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "Alternatively spliced mRNA encodes a secreted form of human CD8 alpha. Characterization of the human CD8 alpha gene."
    Norment A.M., Lonberg N., Lacy E., Littman D.R.
    J. Immunol. 142:3312-3319(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), ALTERNATIVE SPLICING.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Pericardium.
  7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "A secreted form of the human lymphocyte cell surface molecule CD8 arises from alternative splicing."
    Giblin P., Ledbetter J.A., Kavathas P.
    Proc. Natl. Acad. Sci. U.S.A. 86:998-1002(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE OF 168-235 (ISOFORMS 1 AND 2).
  10. "The T8 antigen is a multimeric complex of two distinct subunits on human thymocytes but consists of homomultimeric forms on peripheral blood T lymphocytes."
    Snow P.M., Terhorst C.
    J. Biol. Chem. 258:14675-14681(1983) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT.
  11. "Crystal structure of a soluble form of the human T cell coreceptor CD8 at 2.6-A resolution."
    Leahy D.J., Axel R., Hendrickson W.A.
    Cell 68:1145-1162(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 22-135.
  12. "Crystal structure of the complex between human CD8alpha(alpha) and HLA-A2."
    Gao G.F., Tormo J., Gerth U.C., Wyer J.R., McMichael A.J., Stuart D.I., Bell J.I., Jones E.Y., Jakobsen B.K.
    Nature 387:630-634(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 22-141 IN COMPLEX WITH HLA-A/B2M DIMER.
  13. "A zinc clasp structure tethers Lck to T cell coreceptors CD4 and CD8."
    Kim P.W., Sun Z.Y., Blacklow S.C., Wagner G., Eck M.J.
    Science 301:1725-1728(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 209-227 IN COMPLEX WITH LCK.
  14. Cited for: VARIANT CD8 DEFICIENCY SER-111, MUTAGENESIS OF GLY-111.

Entry informationi

Entry nameiCD8A_HUMAN
AccessioniPrimary (citable) accession number: P01732
Secondary accession number(s): B4DT80
, D6W5M8, Q13970, Q4ZG17
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: July 21, 1986
Last modified: October 29, 2014
This is version 168 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3