Reviewed,
UniProtKB/Swiss-Prot P01732 (CD8A_HUMAN)
Last modified
June 16, 2009.
Version 113.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: T-cell surface glycoprotein CD8 alpha chain Alternative name(s): T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen=CD8a | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 235 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. |
| Subunit structure | In general heterodimer of an alpha and a beta chain linked by two disulfide bonds. Can also form homodimers. Shown to be expressed as heterdimer on thymocytes and as homodimer on peripheral blood T-lymphocytes. Interacts with the MHC class I HLA-A/B2M dimer. Interacts with LCK in a zinc-dependent manner. Ref.7 |
| Subcellular location | Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Secreted. |
| Post-translational modification | All of the five most carboxyl-terminal cysteines form inter-chain disulfide bonds in dimers and higher multimers, while the four N-terminal cysteines do not By similarity. |
| Involvement in disease | Defects in CD8A are a cause of familial CD8 deficiency (CD8 deficiency) [MIM:608957]. Familial CD8 deficiency is a novel autosomal recessive immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections. |
| Sequence similarities | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P01732-1) Also known as: membrane; mCD8alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P01732-2) Also known as: secreted; sCD8alpha; The sequence of this isoform differs from the canonical sequence as follows: 172-209: VHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHR → G |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | ||||||||||||||||||||||||||||
| Chain | 22 – 235 | 214 | T-cell surface glycoprotein CD8 alpha chain | PRO_0000014638 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Topological domain | 22 – 182 | 161 | Extracellular Potential | |||||||||||||||||||||||||||
| Transmembrane | 183 – 203 | 21 | Potential | |||||||||||||||||||||||||||
| Topological domain | 204 – 235 | 32 | Cytoplasmic Potential | |||||||||||||||||||||||||||
| Domain | 22 – 135 | 114 | Ig-like V-type | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Disulfide bond | 43 ↔ 115 | |||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 172 – 209 | 38 | VHTRG…YCNHR → G in isoform 2. | VSP_012653 | ||||||||||||||||||||||||||
| Natural variant | 111 | 1 | G → S in CD8 deficiency; prevents CD8 expression. | VAR_021020 | ||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||
| Mutagenesis | 111 | 1 | G → R: Prevents CD8 expression. Ref.11 | |||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Beta strand | 24 – 27 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 39 – 45 | 7 | ||||||||||||||||||||||||||||
| Beta strand | 54 – 64 | 11 | ||||||||||||||||||||||||||||
| Beta strand | 68 – 77 | 10 | ||||||||||||||||||||||||||||
| Turn | 86 – 88 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 89 – 94 | 6 | ||||||||||||||||||||||||||||
| Beta strand | 97 – 104 | 8 | ||||||||||||||||||||||||||||
| Helix | 107 – 109 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 111 – 119 | 9 | ||||||||||||||||||||||||||||
| Beta strand | 122 – 125 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 129 – 131 | 3 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes." Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R. Cell 40:237-246(1985) [PubMed: 3871356] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Structure of Leu-2/T8 as deduced from the sequence of a cDNA clone." Parnes J.R., Sizer K.C., Sukhatme V.P., Hunkapiller T. Behring Inst. Mitt. 77:48-55(1985) [PubMed: 3936473] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). |
| [3] | "The T cell differentiation antigen Leu-2/T8 is homologous to immunoglobulin and T cell receptor variable regions." Sukhatme V.P., Sizer K.C., Vollmer A.C., Hunkapiller T., Parnes J.R. Cell 40:591-597(1985) [PubMed: 3918796] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Structure and expression of the gene encoding CD8 alpha chain (Leu-2/T8)." Nakayama K., Tokito S., Okumura K., Nakauchi H. Immunogenetics 30:393-397(1989) [PubMed: 2509342] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Alternatively spliced mRNA encodes a secreted form of human CD8 alpha. Characterization of the human CD8 alpha gene." Norment A.M., Lonberg N., Lacy E., Littman D.R. J. Immunol. 142:3312-3319(1989) [PubMed: 2496167] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), ALTERNATIVE SPLICING. |
| [6] | "A secreted form of the human lymphocyte cell surface molecule CD8 arises from alternative splicing." Giblin P., Ledbetter J.A., Kavathas P. Proc. Natl. Acad. Sci. U.S.A. 86:998-1002(1989) [PubMed: 2536941] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 168-235 (ISOFORMS 1 AND 2). |
| [7] | "The T8 antigen is a multimeric complex of two distinct subunits on human thymocytes but consists of homomultimeric forms on peripheral blood T lymphocytes." Snow P.M., Terhorst C. J. Biol. Chem. 258:14675-14681(1983) [PubMed: 6605969] [Abstract] Cited for: SUBUNIT. |
| [8] | "Crystal structure of a soluble form of the human T cell coreceptor CD8 at 2.6-A resolution." Leahy D.J., Axel R., Hendrickson W.A. Cell 68:1145-1162(1992) [PubMed: 1547508] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 22-135. |
| [9] | "Crystal structure of the complex between human CD8alpha(alpha) and HLA-A2." Gao G.F., Tormo J., Gerth U.C., Wyer J.R., McMichael A.J., Stuart D.I., Bell J.I., Jones E.Y., Jakobsen B.K. Nature 387:630-634(1997) [PubMed: 9177355] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 22-141 IN COMPLEX WITH HLA-A/B2M DIMER. |
| [10] | "A zinc clasp structure tethers Lck to T cell coreceptors CD4 and CD8." Kim P.W., Sun Z.Y., Blacklow S.C., Wagner G., Eck M.J. Science 301:1725-1728(2003) [PubMed: 14500983] [Abstract] Cited for: STRUCTURE BY NMR OF 209-227 IN COMPLEX WITH LCK. |
| [11] | "Familial CD8 deficiency due to a mutation in the CD8 alpha gene." de la Calle-Martin O., Hernandez M., Ordi J., Casamitjana N., Arostegui J.I., Caragol I., Ferrando M., Labrador M., Rodriguez-Sanchez J.L., Espanol T. J. Clin. Invest. 108:117-123(2001) [PubMed: 11435463] [Abstract] Cited for: VARIANT CD8 DEFICIENCY SER-111, MUTAGENESIS OF GLY-111. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M26315, M26313, M26314 Genomic DNA. Translation: AAA79217.1. M26315, M26313, M26314 Genomic DNA. Translation: AAA79218.1. M12824 mRNA. Translation: AAA61133.1. M12828 mRNA. Translation: AAB04637.1. M27161 Genomic DNA. Translation: AAA59674.1. | |||||||||||||||||||||||||||||||
| IPI | IPI00016781. IPI00438278. | ||||||||||||||||||||||||||||||
| PIR | RWHUT8. A30604. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001139345.1. NP_001759.3. | ||||||||||||||||||||||||||||||
| UniGene | Hs.85258 | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENSG00000153563. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||
| GeneID | 925. | ||||||||||||||||||||||||||||||
| KEGG | hsa:925. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| GeneCards | GC02M086865. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0002241. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:1706. CD8A. | ||||||||||||||||||||||||||||||
| HPA | CAB000012. | ||||||||||||||||||||||||||||||
| MIM | 186910. gene. 608957. phenotype. | ||||||||||||||||||||||||||||||
| PharmGKB | PA26244. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| HOGENOM | P01732. | ||||||||||||||||||||||||||||||
| HOVERGEN | P01732. | ||||||||||||||||||||||||||||||
| OMA | P01732. KCPRPVV. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | cd8tcrdownstreampathway. Downstream signaling in naive CD8+ T cells. il12_2pathway. IL12-mediated signaling events. cd8tcrpathway. TCR signaling in naive CD8+ T cells. | ||||||||||||||||||||||||||||||
| Reactome | REACT_6900. Signaling in Immune system. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P01732. | ||||||||||||||||||||||||||||||
| Bgee | P01732. | ||||||||||||||||||||||||||||||
| CleanEx | HS_CD8A. HS_MAL. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000153563. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR015468. CD8_asu. IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR013106. Ig_V-set. IPR003596. Ig_V-set_sub. [Graphical view] | ||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. | ||||||||||||||||||||||||||||||
| PANTHER | PTHR10441. CD8_alpha. 1 hit. | ||||||||||||||||||||||||||||||
| Pfam | PF07686. V-set. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SMART | SM00406. IGv. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||
| NextBio | 3826. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | CD8A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P01732 Secondary accession number(s): Q13970 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


