Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P01732

- CD8A_HUMAN

UniProt

P01732 - CD8A_HUMAN

Protein

T-cell surface glycoprotein CD8 alpha chain

Gene

CD8A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 167 (01 Oct 2014)
      Sequence version 1 (21 Jul 1986)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.

    GO - Molecular functioni

    1. coreceptor activity Source: UniProtKB
    2. MHC class I protein binding Source: UniProtKB
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. antigen processing and presentation Source: UniProtKB
    2. cytotoxic T cell differentiation Source: Ensembl
    3. defense response to virus Source: Ensembl
    4. immune response Source: UniProtKB
    5. positive regulation of calcium-mediated signaling Source: Ensembl
    6. regulation of immune response Source: Reactome
    7. T cell activation Source: UniProtKB
    8. T cell mediated immunity Source: Ensembl
    9. transmembrane receptor protein tyrosine kinase signaling pathway Source: UniProtKB

    Keywords - Biological processi

    Adaptive immunity, Immunity

    Enzyme and pathway databases

    ReactomeiREACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    T-cell surface glycoprotein CD8 alpha chain
    Alternative name(s):
    T-lymphocyte differentiation antigen T8/Leu-2
    CD_antigen: CD8a
    Gene namesi
    Name:CD8A
    Synonyms:MAL
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:1706. CD8A.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: MGI
    2. extracellular region Source: UniProtKB-SubCell
    3. integral component of plasma membrane Source: UniProtKB
    4. plasma membrane Source: Reactome
    5. T cell receptor complex Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    CD8 deficiency, familial (CD8 deficiency) [MIM:608957]: An immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti111 – 1111G → S in CD8 deficiency; prevents CD8 expression. 1 Publication
    VAR_021020

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi111 – 1111G → R: Prevents CD8 expression. 1 Publication

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi608957. phenotype.
    Orphaneti169085. Susceptibility to respiratory infections associated with CD8alpha chain mutation.
    PharmGKBiPA26244.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Add
    BLAST
    Chaini22 – 235214T-cell surface glycoprotein CD8 alpha chainPRO_0000014638Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi43 ↔ 115

    Post-translational modificationi

    All of the five most C-terminal cysteines form inter-chain disulfide bonds in dimers and higher multimers, while the four N-terminal cysteines do not.By similarity

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiP01732.
    PRIDEiP01732.

    PTM databases

    PhosphoSiteiP01732.

    Expressioni

    Gene expression databases

    ArrayExpressiP01732.
    BgeeiP01732.
    CleanExiHS_CD8A.
    HS_MAL.
    GenevestigatoriP01732.

    Organism-specific databases

    HPAiCAB000012.
    HPA037756.

    Interactioni

    Subunit structurei

    In general heterodimer of an alpha and a beta chain linked by two disulfide bonds. Can also form homodimers. Shown to be expressed as heterodimer on thymocytes and as homodimer on peripheral blood T-lymphocytes. Interacts with the MHC class I HLA-A/B2M dimer. Interacts with LCK in a zinc-dependent manner.3 Publications

    Protein-protein interaction databases

    BioGridi107363. 14 interactions.
    IntActiP01732. 4 interactions.
    STRINGi9606.ENSP00000283635.

    Structurei

    Secondary structure

    1
    235
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi24 – 274
    Beta strandi39 – 457
    Beta strandi54 – 6411
    Beta strandi68 – 7710
    Turni86 – 883
    Beta strandi89 – 946
    Beta strandi97 – 1048
    Helixi107 – 1093
    Beta strandi111 – 1199
    Beta strandi122 – 1254
    Beta strandi129 – 1313

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1AKJX-ray2.65D/E22-141[»]
    1CD8X-ray2.60A22-135[»]
    1Q69NMR-A209-227[»]
    2HP4X-ray2.10A/B22-135[»]
    3QZWX-ray2.80G/H/I/J22-135[»]
    ProteinModelPortaliP01732.
    SMRiP01732. Positions 22-135.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP01732.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini22 – 182161ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini204 – 23532CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei183 – 20321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini22 – 135114Ig-like V-typeAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG46810.
    HOGENOMiHOG000004794.
    HOVERGENiHBG008488.
    InParanoidiP01732.
    KOiK06458.
    OrthoDBiEOG7N37F3.
    PhylomeDBiP01732.
    TreeFamiTF336070.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR015468. CD8_asu.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013106. Ig_V-set.
    IPR003596. Ig_V-set_subgr.
    [Graphical view]
    PANTHERiPTHR10441. PTHR10441. 1 hit.
    PfamiPF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00406. IGv. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P01732-1) [UniParc]FASTAAdd to Basket

    Also known as: membrane, mCD8alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALPVTALLL PLALLLHAAR PSQFRVSPLD RTWNLGETVE LKCQVLLSNP    50
    TSGCSWLFQP RGAAASPTFL LYLSQNKPKA AEGLDTQRFS GKRLGDTFVL 100
    TLSDFRRENE GYYFCSALSN SIMYFSHFVP VFLPAKPTTT PAPRPPTPAP 150
    TIASQPLSLR PEACRPAAGG AVHTRGLDFA CDIYIWAPLA GTCGVLLLSL 200
    VITLYCNHRN RRRVCKCPRP VVKSGDKPSL SARYV 235
    Length:235
    Mass (Da):25,729
    Last modified:July 21, 1986 - v1
    Checksum:iFCCA29BAA73726BB
    GO
    Isoform 2 (identifier: P01732-2) [UniParc]FASTAAdd to Basket

    Also known as: secreted, sCD8alpha

    The sequence of this isoform differs from the canonical sequence as follows:
         172-209: VHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHR → G

    Show »
    Length:198
    Mass (Da):21,585
    Checksum:iBC89FA59F150598F
    GO
    Isoform 3 (identifier: P01732-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRNQAPGRPKGATFPPRRPTGSRAPPLAPELRAKQRPGERVM

    Note: No experimental confirmation available.

    Show »
    Length:276
    Mass (Da):30,214
    Checksum:i0D75B1136A240ED4
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti111 – 1111G → S in CD8 deficiency; prevents CD8 expression. 1 Publication
    VAR_021020

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MRNQAPGRPKGATFPPRRPT GSRAPPLAPELRAKQRPGER VM in isoform 3. 1 PublicationVSP_054438
    Alternative sequencei172 – 20938VHTRG…YCNHR → G in isoform 2. CuratedVSP_012653Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M26315, M26313, M26314 Genomic DNA. Translation: AAA79217.1.
    M26315, M26313, M26314 Genomic DNA. Translation: AAA79218.1.
    M12824 mRNA. Translation: AAA61133.1.
    M12828 mRNA. Translation: AAB04637.1.
    M27161 Genomic DNA. Translation: AAA59674.1.
    AK300089 mRNA. Translation: BAG61892.1.
    AC064848 Genomic DNA. Translation: AAX88864.1.
    AC112696 Genomic DNA. No translation available.
    CH471053 Genomic DNA. Translation: EAW99438.1.
    CH471053 Genomic DNA. Translation: EAW99439.1.
    CH471053 Genomic DNA. Translation: EAW99440.1.
    CCDSiCCDS1992.1. [P01732-1]
    CCDS1993.1. [P01732-2]
    PIRiA30604. RWHUT8.
    RefSeqiNP_001139345.1. NM_001145873.1. [P01732-1]
    NP_001759.3. NM_001768.6. [P01732-1]
    NP_741969.1. NM_171827.3. [P01732-2]
    UniGeneiHs.85258.

    Genome annotation databases

    EnsembliENST00000283635; ENSP00000283635; ENSG00000153563. [P01732-1]
    ENST00000352580; ENSP00000321631; ENSG00000153563. [P01732-2]
    ENST00000409511; ENSP00000386559; ENSG00000153563. [P01732-1]
    GeneIDi925.
    KEGGihsa:925.
    UCSCiuc002srt.3. human. [P01732-1]
    uc002sru.3. human. [P01732-2]

    Polymorphism databases

    DMDMi116035.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    CD8Abase

    CD8A mutation db

    Wikipedia

    CD8 entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M26315 , M26313 , M26314 Genomic DNA. Translation: AAA79217.1 .
    M26315 , M26313 , M26314 Genomic DNA. Translation: AAA79218.1 .
    M12824 mRNA. Translation: AAA61133.1 .
    M12828 mRNA. Translation: AAB04637.1 .
    M27161 Genomic DNA. Translation: AAA59674.1 .
    AK300089 mRNA. Translation: BAG61892.1 .
    AC064848 Genomic DNA. Translation: AAX88864.1 .
    AC112696 Genomic DNA. No translation available.
    CH471053 Genomic DNA. Translation: EAW99438.1 .
    CH471053 Genomic DNA. Translation: EAW99439.1 .
    CH471053 Genomic DNA. Translation: EAW99440.1 .
    CCDSi CCDS1992.1. [P01732-1 ]
    CCDS1993.1. [P01732-2 ]
    PIRi A30604. RWHUT8.
    RefSeqi NP_001139345.1. NM_001145873.1. [P01732-1 ]
    NP_001759.3. NM_001768.6. [P01732-1 ]
    NP_741969.1. NM_171827.3. [P01732-2 ]
    UniGenei Hs.85258.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1AKJ X-ray 2.65 D/E 22-141 [» ]
    1CD8 X-ray 2.60 A 22-135 [» ]
    1Q69 NMR - A 209-227 [» ]
    2HP4 X-ray 2.10 A/B 22-135 [» ]
    3QZW X-ray 2.80 G/H/I/J 22-135 [» ]
    ProteinModelPortali P01732.
    SMRi P01732. Positions 22-135.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107363. 14 interactions.
    IntActi P01732. 4 interactions.
    STRINGi 9606.ENSP00000283635.

    PTM databases

    PhosphoSitei P01732.

    Polymorphism databases

    DMDMi 116035.

    Proteomic databases

    PaxDbi P01732.
    PRIDEi P01732.

    Protocols and materials databases

    DNASUi 925.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000283635 ; ENSP00000283635 ; ENSG00000153563 . [P01732-1 ]
    ENST00000352580 ; ENSP00000321631 ; ENSG00000153563 . [P01732-2 ]
    ENST00000409511 ; ENSP00000386559 ; ENSG00000153563 . [P01732-1 ]
    GeneIDi 925.
    KEGGi hsa:925.
    UCSCi uc002srt.3. human. [P01732-1 ]
    uc002sru.3. human. [P01732-2 ]

    Organism-specific databases

    CTDi 925.
    GeneCardsi GC02M086923.
    HGNCi HGNC:1706. CD8A.
    HPAi CAB000012.
    HPA037756.
    MIMi 186910. gene.
    608957. phenotype.
    neXtProti NX_P01732.
    Orphaneti 169085. Susceptibility to respiratory infections associated with CD8alpha chain mutation.
    PharmGKBi PA26244.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG46810.
    HOGENOMi HOG000004794.
    HOVERGENi HBG008488.
    InParanoidi P01732.
    KOi K06458.
    OrthoDBi EOG7N37F3.
    PhylomeDBi P01732.
    TreeFami TF336070.

    Enzyme and pathway databases

    Reactomei REACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

    Miscellaneous databases

    EvolutionaryTracei P01732.
    GeneWikii CD8A.
    GenomeRNAii 925.
    NextBioi 35474861.
    PROi P01732.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P01732.
    Bgeei P01732.
    CleanExi HS_CD8A.
    HS_MAL.
    Genevestigatori P01732.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR015468. CD8_asu.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013106. Ig_V-set.
    IPR003596. Ig_V-set_subgr.
    [Graphical view ]
    PANTHERi PTHR10441. PTHR10441. 1 hit.
    Pfami PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00406. IGv. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes."
      Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R.
      Cell 40:237-246(1985) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Structure of Leu-2/T8 as deduced from the sequence of a cDNA clone."
      Parnes J.R., Sizer K.C., Sukhatme V.P., Hunkapiller T.
      Behring Inst. Mitt. 77:48-55(1985) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
    3. "The T cell differentiation antigen Leu-2/T8 is homologous to immunoglobulin and T cell receptor variable regions."
      Sukhatme V.P., Sizer K.C., Vollmer A.C., Hunkapiller T., Parnes J.R.
      Cell 40:591-597(1985) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Structure and expression of the gene encoding CD8 alpha chain (Leu-2/T8)."
      Nakayama K., Tokito S., Okumura K., Nakauchi H.
      Immunogenetics 30:393-397(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. "Alternatively spliced mRNA encodes a secreted form of human CD8 alpha. Characterization of the human CD8 alpha gene."
      Norment A.M., Lonberg N., Lacy E., Littman D.R.
      J. Immunol. 142:3312-3319(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), ALTERNATIVE SPLICING.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Pericardium.
    7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "A secreted form of the human lymphocyte cell surface molecule CD8 arises from alternative splicing."
      Giblin P., Ledbetter J.A., Kavathas P.
      Proc. Natl. Acad. Sci. U.S.A. 86:998-1002(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE OF 168-235 (ISOFORMS 1 AND 2).
    10. "The T8 antigen is a multimeric complex of two distinct subunits on human thymocytes but consists of homomultimeric forms on peripheral blood T lymphocytes."
      Snow P.M., Terhorst C.
      J. Biol. Chem. 258:14675-14681(1983) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBUNIT.
    11. "Crystal structure of a soluble form of the human T cell coreceptor CD8 at 2.6-A resolution."
      Leahy D.J., Axel R., Hendrickson W.A.
      Cell 68:1145-1162(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 22-135.
    12. "Crystal structure of the complex between human CD8alpha(alpha) and HLA-A2."
      Gao G.F., Tormo J., Gerth U.C., Wyer J.R., McMichael A.J., Stuart D.I., Bell J.I., Jones E.Y., Jakobsen B.K.
      Nature 387:630-634(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 22-141 IN COMPLEX WITH HLA-A/B2M DIMER.
    13. "A zinc clasp structure tethers Lck to T cell coreceptors CD4 and CD8."
      Kim P.W., Sun Z.Y., Blacklow S.C., Wagner G., Eck M.J.
      Science 301:1725-1728(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 209-227 IN COMPLEX WITH LCK.
    14. Cited for: VARIANT CD8 DEFICIENCY SER-111, MUTAGENESIS OF GLY-111.

    Entry informationi

    Entry nameiCD8A_HUMAN
    AccessioniPrimary (citable) accession number: P01732
    Secondary accession number(s): B4DT80
    , D6W5M8, Q13970, Q4ZG17
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 21, 1986
    Last sequence update: July 21, 1986
    Last modified: October 1, 2014
    This is version 167 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3