P01344 (IGF2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 175.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Insulin-like growth factor II Short name=IGF-II Alternative name(s): Somatomedin-A Cleaved into the following 3 chains: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 180 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development. Ref.28 Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3. Ref.28 |
| Subcellular location | |
| Post-translational modification | O-glycosylated with core 1 or possibly core 8 glycans. Thr-96 is a minor glycosylation site compared to Thr-99. Ref.27 Ref.31 Ref.32 |
| Polymorphism | Genetic variations in IGF2 are associated with body mass index (BMI). The BMI is a statistical measurement which compares a person's weight and height. |
| Involvement in disease | Silver-Russell syndrome (SRS) [MIM:180860]: A clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations. The phenotypic expression changes during childhood and adolescence, with the facial features and asymmetry usually becoming more subtle with age. |
| Sequence similarities | Belongs to the insulin family. |
| Mass spectrometry | Molecular mass is 7469.4 Da from positions 25 - 91. Determined by MALDI. Ref.25 Ref.26 Molecular mass is 7398.3 Da from positions 26 - 91. Determined by MALDI. Ref.25 Ref.26 |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P01344-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P01344-2) The sequence of this isoform differs from the canonical sequence as follows: 53-53: S → RLPG | ||||||
| Isoform 3 (identifier: P01344-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVSPDPQIIVVAPETELASMQVQRTEDGVTIIQIFWVGRKGELLRRTPVSSAMQTPM 110-180: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||
Molecule processing | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Ref.21 Ref.23 | |||||||||||||||||||
| Chain | 25 – 91 | 67 | Insulin-like growth factor II | PRO_0000015717 | ||||||||||||||||||
| Chain | 26 – 91 | 66 | Insulin-like growth factor II Ala-25 Del | PRO_0000015718 | ||||||||||||||||||
| Propeptide | 92 – 180 | 89 | E peptide | PRO_0000015719 | ||||||||||||||||||
| Peptide | 93 – 126 | 34 | Preptin | PRO_0000370376 | ||||||||||||||||||
Regions | ||||||||||||||||||||||
| Region | 25 – 52 | 28 | B | |||||||||||||||||||
| Region | 53 – 64 | 12 | C | |||||||||||||||||||
| Region | 65 – 85 | 21 | A | |||||||||||||||||||
| Region | 86 – 91 | 6 | D | |||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||
| Glycosylation | 96 | 1 | O-linked (GalNAc...) Ref.31 Ref.32 | |||||||||||||||||||
| Glycosylation | 99 | 1 | O-linked (GalNAc...) Ref.27 Ref.31 | |||||||||||||||||||
| Glycosylation | 163 | 1 | O-linked (GalNAc...) Ref.30 Ref.31 | |||||||||||||||||||
| Disulfide bond | 33 ↔ 71 | Ref.22 Ref.35 | ||||||||||||||||||||
| Disulfide bond | 45 ↔ 84 | Ref.22 Ref.35 | ||||||||||||||||||||
| Disulfide bond | 70 ↔ 75 | Ref.22 Ref.35 | ||||||||||||||||||||
Natural variations | ||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MVSPDPQIIVVAPETELASM QVQRTEDGVTIIQIFWVGRK GELLRRTPVSSAMQTPM in isoform 3. | VSP_045624 | ||||||||||||||||||
| Alternative sequence | 53 | 1 | S → RLPG in isoform 2. | VSP_002708 | ||||||||||||||||||
| Alternative sequence | 110 – 180 | 71 | Missing in isoform 3. | VSP_045625 | ||||||||||||||||||
| Natural variant | 120 | 1 | K → N. Corresponds to variant rs14367 [ dbSNP | Ensembl ]. | VAR_011959 | ||||||||||||||||||
| Natural variant | 173 | 1 | P → Q. Corresponds to variant rs1050342 [ dbSNP | Ensembl ]. | VAR_011960 | ||||||||||||||||||
| Natural variant | 180 | 1 | K → N. Corresponds to variant rs12993 [ dbSNP | Ensembl ]. | VAR_011961 | ||||||||||||||||||
Experimental info | ||||||||||||||||||||||
| Sequence conflict | 3 | 1 | I → M in AAA52544. Ref.6 | |||||||||||||||||||
| Sequence conflict | 107 – 110 | 4 | RYPV → EIPL in CAA27249. Ref.1 | |||||||||||||||||||
| Sequence conflict | 147 | 1 | E → ELE in AAA60088. Ref.5 | |||||||||||||||||||
Secondary structure | ||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||
| Helix | 34 – 44 | 11 | ||||||||||||||||||||
| Turn | 45 – 48 | 4 | ||||||||||||||||||||
| Beta strand | 50 – 52 | 3 | ||||||||||||||||||||
| Helix | 55 – 58 | 4 | ||||||||||||||||||||
| Helix | 61 – 72 | 12 | ||||||||||||||||||||
| Helix | 77 – 82 | 6 | ||||||||||||||||||||
| Beta strand | 86 – 88 | 3 | ||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Insulin-like growth factor II precursor gene organization in relation to insulin gene family." Dull T.J., Gray A., Hayflick J.S., Ullrich A. Nature 310:777-781(1984) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Sequence of a cDNA clone encoding human preproinsulin-like growth factor II." Bell G.I., Merryweather J.P., Sanchez-Pescador R., Stempien M.M., Priestley L., Scott J., Rall L.B. Nature 310:775-777(1984) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Isolation of an insulin-like growth factor II cDNA with a unique 5' untranslated region from human placenta." Shen S.-J., Daimon M., Wang C.-Y., Jansen M., Ilan J. Proc. Natl. Acad. Sci. U.S.A. 85:1947-1951(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Organization of the human genes for insulin-like growth factors I and II." de Pagter-Holthuizen P., van Schaik F.M.A., Verduijn G.M., van Ommen G.J.B., Bouma B.N., Jansen M., Sussenbach J.S. FEBS Lett. 195:179-184(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [5] | "Tissue-specific expression of insulin-like growth factor II mRNAs with distinct 5' untranslated regions." Irminger J.C., Rosen K.M., Humbel R.E., Villa-Komaroff L. Proc. Natl. Acad. Sci. U.S.A. 84:6330-6334(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "Human insulin-like growth factor I and II messenger RNA: isolation of complementary DNA and analysis of expression." Rall L.B., Scott J., Bell G.I. Methods Enzymol. 146:239-248(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [7] | "Nucleotide sequences of cDNAs encoding precursors of human insulin-like growth factor II (IGF-II) and an IGF-II variant." Jansen M., van Schaik F.M.A., van Tol H., van den Brande J.L., Sussenbach J.S. FEBS Lett. 179:243-246(1985) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [8] | "Isolation of a cDNA for a growth factor of vascular endothelial cells from human lung cancer cells: its identity with insulin-like growth factor II." Hagiwara K., Kobayashi T., Tobita M., Kikyo N., Yazaki Y., Okabe T. Jpn. J. Cancer Res. 86:202-207(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [9] | "Imprinting of IGF2 P0 transcript and novel alternatively spliced INS-IGF2 isoforms show differences between mouse and human." Monk D., Sanches R., Arnaud P., Apostolidou S., Hills F.A., Abu-Amero S., Murrell A., Friess H., Reik W., Stanier P., Constancia M., Moore G.E. Hum. Mol. Genet. 15:1259-1269(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [10] | "Down-regulation of achaete-scute complex homolog 1 (ASCL1) in neuroblastoma cells induces up-regulation of insulin-like growth factor 2 (IGF2)." Li J., Neumann I., Volkmer I., Staege M.S. Mol. Biol. Rep. 38:1515-1521(2011) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING. |
| [11] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [12] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [13] | SeattleSNPs variation discovery resource Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [14] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [15] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [16] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [17] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle. |
| [18] | "Differential expression of the human insulin-like growth factor II gene. Characterization of the IGF-II mRNAs and an mRNA encoding a putative IGF-II-associated protein." de Pagter-Holthuizen P., van der Kammen R.A., Jansen M., van Schaik F.M.A., Sussenbach J.S. Biochim. Biophys. Acta 950:282-295(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 103-180. |
| [19] | "A new 5'-non-coding region for human placental insulin-like growth factor II mRNA expression." le Bouc Y., Noguiez P., Sondermeijer P., Dreyer D., Girard F., Binoux M. FEBS Lett. 222:181-185(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-161 (ISOFORM 2). |
| [20] | "Tissue-specific and developmentally regulated transcription of the insulin-like growth factor 2 gene." Gray A., Tam A.W., Dull T.J., Hayflick J.S., Pintar J., Cavenee W.K., Koufos A., Ullrich A. DNA 6:283-295(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-52. Tissue: Liver. |
| [21] | "Primary structure of human insulin-like growth factor II." Rinderknecht E., Humbel R.E. FEBS Lett. 89:283-286(1978) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-91. |
| [22] | "Structure and activity dependence of recombinant human insulin-like growth factor II on disulfide bond pairing." Smith M.C., Cook J.A., Furman T.C., Occolowitz J.L. J. Biol. Chem. 264:9314-9321(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, DISULFIDE BONDS. |
| [23] | "Purification and characterization of insulin-like growth factor II (IGF II) and an IGF II variant from human placenta." De Ceuninck F., Willeput J., Corvol M. J. Chromatogr. B 666:203-214(1995) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-68. |
| [24] | "Positive associations between single nucleotide polymorphisms in the IGF2 gene region and body mass index in adult males." Gaunt T.R., Cooper J.A., Miller G.J., Day I.N.M., O'Dell S.D. Hum. Mol. Genet. 10:1491-1501(2001) [PubMed] [Europe PMC] [Abstract] Cited for: POLYMORPHISM, ASSOCIATION WITH WITH BODY MASS INDEX. |
| [25] | "Detection of bound and free IGF-1 and IGF-2 in human plasma via biomolecular interaction analysis mass spectrometry." Nedelkov D., Nelson R.W., Kiernan U.A., Niederkofler E.E., Tubbs K.A. FEBS Lett. 536:130-134(2003) [PubMed] [Europe PMC] [Abstract] Cited for: MASS SPECTROMETRY, PROTEOLYTIC PROCESSING. |
| [26] | "Quantitative mass spectrometric immunoassay of insulin like growth factor 1." Nelson R.W., Nedelkov D., Tubbs K.A., Kiernan U.A. J. Proteome Res. 3:851-855(2004) [PubMed] [Europe PMC] [Abstract] Cited for: MASS SPECTROMETRY, PROTEOLYTIC PROCESSING. |
| [27] | "The identification of O-glycosylated precursors of insulin-like growth factor II." Hudgins W.R., Hampton B., Burgess W.H., Perdue J.F. J. Biol. Chem. 267:8153-8160(1992) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT THR-99. |
| [28] | "Preptin, another peptide product of the pancreatic beta-cell, is osteogenic in vitro and in vivo." Cornish J., Callon K.E., Bava U., Watson M., Xu X., Lin J.M., Chan V.A., Grey A.B., Naot D., Buchanan C.M., Cooper G.J., Reid I.R. Am. J. Physiol. 292:E117-E122(2007) [PubMed] [Europe PMC] [Abstract] Cited for: OSTEOGENIC FUNCTION OF PREPTIN. |
| [29] | "Epigenetic mutations of the imprinted IGF2-H19 domain in Silver-Russell syndrome (SRS): results from a large cohort of patients with SRS and SRS-like phenotypes." Bartholdi D., Krajewska-Walasek M., Ounap K., Gaspar H., Chrzanowska K.H., Ilyana H., Kayserili H., Lurie I.W., Schinzel A., Baumer A. J. Med. Genet. 46:192-197(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SRS. |
| [30] | "Enrichment of glycopeptides for glycan structure and attachment site identification." Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E., Brinkmalm G., Larson G. Nat. Methods 6:809-811(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT THR-163, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. Tissue: Cerebrospinal fluid. |
| [31] | "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD." Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT THR-96; THR-99 AND THR-163, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. |
| [32] | "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins." Halim A., Ruetschi U., Larson G., Nilsson J. J. Proteome Res. 12:573-584(2013) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT THR-96, MASS SPECTROMETRY. |
| [33] | "Tertiary structures, receptor binding, and antigenicity of insulinlike growth factors." Blundell T.L., Bedarkar S., Humbel R.E. Fed. Proc. 42:2592-2597(1983) [PubMed] [Europe PMC] [Abstract] Cited for: 3D-STRUCTURE MODELING. |
| [34] | "Solution structure of human insulin-like growth factor II; recognition sites for receptors and binding proteins." Terasawa H., Kohda D., Hatanaka H., Nagata K., Higashihashi N., Fujiwara H., Sakano K., Inagaki F. EMBO J. 13:5590-5597(1994) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR. |
| [35] | "Structure and functional analysis of the IGF-II/IGF2R interaction." Brown J., Delaine C., Zaccheo O.J., Siebold C., Gilbert R.J., van Boxel G., Denley A., Wallace J.C., Hassan A.B., Forbes B.E., Jones E.Y. EMBO J. 27:265-276(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (4.1 ANGSTROMS) OF 25-91 IN COMPLEX WITH IGF2R, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Wikipedia Insulin-like growth factor 2 entry |
| SeattleSNPs |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X03562 Genomic DNA. Translation: CAA27249.1. X00910 mRNA. Translation: CAA25426.1. J03242 mRNA. Translation: AAA52545.1. X03425 Genomic DNA. Translation: CAA27155.1. X03426 Genomic DNA. Translation: CAA27156.1. X03427 Genomic DNA. Translation: CAA27157.1. M17426 mRNA. Translation: AAA60088.1. M29645 mRNA. Translation: AAA52544.1. M17863 mRNA. Translation: AAA52443.1. Sequence problems. S77035 mRNA. Translation: AAB34155.1. DQ104203 mRNA. Translation: ABD93451.1. HM481219 mRNA. Translation: ADO21454.1. AF217977 mRNA. Translation: AAG17220.1. BT007013 mRNA. Translation: AAP35659.1. AF517226 Genomic DNA. Translation: AAM51825.1. AC132217 Genomic DNA. No translation available. AK126688 mRNA. Translation: BAG54360.1. CH471158 Genomic DNA. Translation: EAX02485.1. BC000531 mRNA. Translation: AAH00531.1. X07868 Genomic DNA. Translation: CAA30717.1. X06159 mRNA. Translation: CAA29516.1. X06160 Transcribed RNA. Translation: CAA29517.1. X06161 mRNA. Translation: CAA29518.1. M22373 Genomic DNA. Translation: AAA52536.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00001611. IPI00215977. IPI00940065. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | IGHU2. B23614. I67610. S02423. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000603.1. NM_000612.4. NP_001007140.2. NM_001007139.4. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.272259. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P01344. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29508N. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-6380943. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000338297. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P01344. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 124255. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P01344. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P01344. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| DNASU | 3481. | ||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000300632; ENSP00000300632; ENSG00000167244. ENST00000337883; ENSP00000338297; ENSG00000167244. ENST00000381319; ENSP00000370720; ENSG00000167244. ENST00000381379; ENSP00000370786; ENSG00000167244. ENST00000381389; ENSP00000370796; ENSG00000167244. ENST00000381392; ENSP00000370799; ENSG00000167244. ENST00000381395; ENSP00000370802; ENSG00000167244. ENST00000381406; ENSP00000370813; ENSG00000167244. ENST00000416167; ENSP00000414497; ENSG00000167244. ENST00000418738; ENSP00000402047; ENSG00000167244. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 3481. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:3481. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001lvg.3. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 3481. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC11M002113. | ||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0128667. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:5466. IGF2. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB024999. HPA007993. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 147470. gene+phenotype. 180860. phenotype. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P01344. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 231117. Beckwith-Wiedemann syndrome due to imprinting defect of 11p15. 2128. Hemihypertrophy. 231144. Silver-Russell syndrome due to 11p15 microduplication. 231140. Silver-Russell syndrome due to imprinting defect of 11p15. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA29699. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG44017. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG006137. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K13769. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4HMJBH. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_116125. Disease. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P01344. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | P01344. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_IGF2. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P01344. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000167244. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.100.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR022334. IGF2. IPR013576. IGF2_C. IPR016179. Insulin-like. IPR022350. Insulin-like_growth_factor. IPR022353. Insulin_CS. IPR022352. Insulin_family. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF08365. IGF2_C. 1 hit. PF00049. Insulin. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR02002. INSLNLIKEGF. PR02006. INSLNLIKEGF2. PR00276. INSULINFAMLY. | ||||||||||||||||||||||||||||||||||||||||||
| ProDom | PD005188. IGF2_C. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00078. IlGF. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF56994. Insulin-like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00262. INSULIN. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | IGF2. human. | ||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P01344. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 3481. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 13686. | ||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P01344. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | IGF2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P01344 Secondary accession number(s): B3KX48 Q9UC69 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
