P01266 (THYG_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 141.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Thyroglobulin Short name=Tg | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2768 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). |
| Subunit structure | Homodimer. |
| Subcellular location | |
| Tissue specificity | Thyroid gland specific. |
| Post-translational modification | Sulfated tyrosines are desulfated during iodination. |
| Involvement in disease | Defects in TG are the cause of thyroid dyshormonogenesis 3 (TDH3) [MIM:274700]. A disorder due to thyroid dyshormonogenesis, causing large goiters of elastic and soft consistency in the majority of patients. Although the degree of thyroid dysfunction varies considerably among patients with defective thyroglobulin synthesis, patients usually have a relatively high serum free triiodothyronine (T3) concentration with disproportionately low free tetraiodothyronine (T4) level. The maintenance of relatively high free T3 levels prevents profound tissue hypothyroidism except in brain and pituitary, which are dependent on T4 supply, resulting in neurologic and intellectual defects in some cases. Ref.20 Ref.22 Ref.23 Ref.24 Ref.25 Variations in TG are associated with susceptibility to autoimmune thyroid disease type 3 (AITD3) [MIM:608175]. AITDs including Graves disease (GD) and Hashimoto thyroiditis (HT), are among the most common human autoimmune diseases. They are complex diseases, which are caused by an interaction between susceptibility genes and nongenetic factors, such as infection. Ref.21 |
| Sequence similarities | Belongs to the type-B carboxylesterase/lipase family. Contains 11 thyroglobulin type-1 domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Thyroid hormones biosynthesis |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Congenital hypothyroidism Disease mutation |
| Domain | Repeat Signal |
| Molecular function | Hormone Thyroid hormone |
| PTM | Disulfide bond Glycoprotein Iodination Sulfation |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | hormone biosynthetic process Inferred from electronic annotation. Source: UniProtKB-KW signal transductionNon-traceable author statement. Source: ProtInc thyroid gland developmentInferred from expression pattern. Source: UniProtKB thyroid hormone generationInferred from Biological aspect of Ancestor. Source: RefGenome |
| Cellular component | extracellular space Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Molecular function | hormone activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P01266-1) Also known as: Major; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P01266-2) Also known as: Minor; The sequence of this isoform differs from the canonical sequence as follows: 1510-1567: CVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLM → L |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | |||||||||
| Chain | 20 – 2768 | 2749 | Thyroglobulin | PRO_0000008636 | |||||||
Regions | |||||||||||
| Domain | 31 – 92 | 62 | Thyroglobulin type-1 1 | ||||||||
| Domain | 93 – 160 | 68 | Thyroglobulin type-1 2 | ||||||||
| Domain | 161 – 297 | 137 | Thyroglobulin type-1 3 | ||||||||
| Domain | 298 – 358 | 61 | Thyroglobulin type-1 4 | ||||||||
| Domain | 605 – 658 | 54 | Thyroglobulin type-1 5 | ||||||||
| Domain | 659 – 726 | 68 | Thyroglobulin type-1 6 | ||||||||
| Domain | 727 – 921 | 195 | Thyroglobulin type-1 7 | ||||||||
| Domain | 922 – 1073 | 152 | Thyroglobulin type-1 8 | ||||||||
| Domain | 1074 – 1145 | 72 | Thyroglobulin type-1 9 | ||||||||
| Domain | 1146 – 1210 | 65 | Thyroglobulin type-1 10 | ||||||||
| Repeat | 1456 – 1469 | 14 | Type II | ||||||||
| Repeat | 1470 – 1486 | 17 | Type II | ||||||||
| Repeat | 1487 – 1503 | 17 | Type II | ||||||||
| Domain | 1511 – 1565 | 55 | Thyroglobulin type-1 11 | ||||||||
| Repeat | 1603 – 1723 | 121 | Type IIIA | ||||||||
| Repeat | 1724 – 1892 | 169 | Type IIIB | ||||||||
| Repeat | 1893 – 1995 | 103 | Type IIIA | ||||||||
| Repeat | 1996 – 2129 | 134 | Type IIIB | ||||||||
| Repeat | 2130 – 2187 | 58 | Type IIIA | ||||||||
Sites | |||||||||||
| Site | 110 | 1 | Not glycosylated | ||||||||
| Site | 496 | 1 | Not glycosylated | ||||||||
| Site | 1869 | 1 | Not glycosylated | ||||||||
| Site | 2122 | 1 | Not glycosylated | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 24 | 1 | Sulfotyrosine; alternate By similarity | ||||||||
| Modified residue | 24 | 1 | Thyroxine; alternate | ||||||||
| Modified residue | 1310 | 1 | Thyroxine | ||||||||
| Modified residue | 2573 | 1 | Thyroxine | ||||||||
| Modified residue | 2587 | 1 | Thyroxine | ||||||||
| Modified residue | 2766 | 1 | Triiodothyronine | ||||||||
| Glycosylation | 76 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 198 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 484 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 529 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 748 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 816 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 947 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 1220 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 1348 | 1 | N-linked (GlcNAc...) Probable | ||||||||
| Glycosylation | 1349 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 1365 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 1716 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 1774 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 2013 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 2250 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 2295 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 2582 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 2749 | 1 | O-linked (Xyl...) (chondroitin sulfate) Ref.18 | ||||||||
| Disulfide bond | 34 ↔ 52 | By similarity | |||||||||
| Disulfide bond | 63 ↔ 70 | By similarity | |||||||||
| Disulfide bond | 72 ↔ 92 | By similarity | |||||||||
| Disulfide bond | 96 ↔ 120 | By similarity | |||||||||
| Disulfide bond | 131 ↔ 138 | By similarity | |||||||||
| Disulfide bond | 140 ↔ 160 | By similarity | |||||||||
| Disulfide bond | 164 ↔ 183 | By similarity | |||||||||
| Disulfide bond | 194 ↔ 235 | By similarity | |||||||||
| Disulfide bond | 301 ↔ 319 | By similarity | |||||||||
| Disulfide bond | 330 ↔ 336 | By similarity | |||||||||
| Disulfide bond | 338 ↔ 358 | By similarity | |||||||||
| Disulfide bond | 608 ↔ 620 | By similarity | |||||||||
| Disulfide bond | 631 ↔ 636 | By similarity | |||||||||
| Disulfide bond | 638 ↔ 658 | By similarity | |||||||||
| Disulfide bond | 662 ↔ 687 | By similarity | |||||||||
| Disulfide bond | 698 ↔ 703 | By similarity | |||||||||
| Disulfide bond | 705 ↔ 726 | By similarity | |||||||||
| Disulfide bond | 730 ↔ 763 | By similarity | |||||||||
| Disulfide bond | 774 ↔ 898 | By similarity | |||||||||
| Disulfide bond | 900 ↔ 921 | By similarity | |||||||||
| Disulfide bond | 1042 ↔ 1049 | By similarity | |||||||||
| Disulfide bond | 1051 ↔ 1073 | By similarity | |||||||||
| Disulfide bond | 1077 ↔ 1108 | By similarity | |||||||||
| Disulfide bond | 1126 ↔ 1145 | By similarity | |||||||||
| Disulfide bond | 1149 ↔ 1169 | By similarity | |||||||||
| Disulfide bond | 1181 ↔ 1188 | By similarity | |||||||||
| Disulfide bond | 1190 ↔ 1210 | By similarity | |||||||||
| Disulfide bond | 1514 ↔ 1523 | By similarity | |||||||||
| Disulfide bond | 1543 ↔ 1565 | By similarity | |||||||||
| Disulfide bond | 2264 ↔ 2281 | Potential | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1510 – 1567 | 58 | CVTDC…SQCLM → L in isoform 2. | VSP_012655 | |||||||
| Natural variant | 135 | 1 | Q → H. Ref.20 Corresponds to variant rs2069546 [ dbSNP | Ensembl ]. | VAR_010212 | |||||||
| Natural variant | 183 | 1 | C → Y in TDH3. Ref.23 | VAR_063034 | |||||||
| Natural variant | 515 | 1 | Q → E. Ref.3 Corresponds to variant rs180222 [ dbSNP | Ensembl ]. | VAR_016190 | |||||||
| Natural variant | 604 | 1 | S → D Requires 2 nucleotide substitutions. Ref.1 Ref.4 Ref.20 Corresponds to variant rs2069547 [ dbSNP | Ensembl ]. | VAR_016852 | |||||||
| Natural variant | 653 | 1 | G → D. Ref.1 Ref.4 Ref.20 Corresponds to variant rs2069548 [ dbSNP | Ensembl ]. | VAR_016853 | |||||||
| Natural variant | 734 | 1 | S → A Polymorphism associated with AITD3. Ref.5 Ref.20 Ref.21 Corresponds to variant rs180223 [ dbSNP | Ensembl ]. | VAR_010213 | |||||||
| Natural variant | 777 | 1 | P → L. Corresponds to variant rs3739274 [ dbSNP | Ensembl ]. | VAR_049077 | |||||||
| Natural variant | 815 | 1 | G → R. Corresponds to variant rs16904774 [ dbSNP | Ensembl ]. | VAR_049078 | |||||||
| Natural variant | 830 | 1 | Q → E. Ref.20 Corresponds to variant rs2076737 [ dbSNP | Ensembl ]. | VAR_010214 | |||||||
| Natural variant | 870 | 1 | Q → H. Ref.19 Corresponds to variant rs2229843 [ dbSNP | Ensembl ]. | VAR_002365 | |||||||
| Natural variant | 985 | 1 | Missing. | VAR_016854 | |||||||
| Natural variant | 988 | 1 | R → P. Corresponds to variant rs16893332 [ dbSNP | Ensembl ]. | VAR_049079 | |||||||
| Natural variant | 1028 | 1 | M → V Polymorphism associated with AITD3. Ref.20 Ref.21 Corresponds to variant rs853326 [ dbSNP | Ensembl ]. | VAR_010215 | |||||||
| Natural variant | 1043 | 1 | H → Y. Ref.1 Ref.20 | VAR_016855 | |||||||
| Natural variant | 1059 | 1 | I → T. Ref.1 Ref.20 | VAR_016856 | |||||||
| Natural variant | 1063 | 1 | L → M. Corresponds to variant rs11992497 [ dbSNP | Ensembl ]. | VAR_049080 | |||||||
| Natural variant | 1222 | 1 | S → L. Corresponds to variant rs12549018 [ dbSNP | Ensembl ]. | VAR_049081 | |||||||
| Natural variant | 1264 | 1 | C → R in TDH3; autosomal recessive. Ref.20 Corresponds to variant rs2076738 [ dbSNP | Ensembl ]. | VAR_010216 | |||||||
| Natural variant | 1312 | 1 | D → G. Ref.1 Ref.2 Ref.7 Corresponds to variant rs2069556 [ dbSNP | Ensembl ]. | VAR_010217 | |||||||
| Natural variant | 1437 | 1 | W → R. Ref.1 Ref.20 Corresponds to variant rs2069558 [ dbSNP | Ensembl ]. | VAR_016857 | |||||||
| Natural variant | 1463 | 1 | P → H. Ref.1 Ref.20 | VAR_016858 | |||||||
| Natural variant | 1740 | 1 | T → K. Corresponds to variant rs16904791 [ dbSNP | Ensembl ]. | VAR_049082 | |||||||
| Natural variant | 1838 | 1 | D → N. Ref.20 Corresponds to variant rs2069561 [ dbSNP | Ensembl ]. | VAR_010218 | |||||||
| Natural variant | 1897 | 1 | C → Y in TDH3. Ref.22 | VAR_063035 | |||||||
| Natural variant | 1936 | 1 | A → T. Ref.1 Ref.20 Corresponds to variant rs2069562 [ dbSNP | Ensembl ]. | VAR_016859 | |||||||
| Natural variant | 1974 | 1 | M → T. Corresponds to variant rs56230101 [ dbSNP | Ensembl ]. | VAR_061173 | |||||||
| Natural variant | 1979 | 1 | R → W Polymorphism associated with AITD3. Ref.21 | VAR_032013 | |||||||
| Natural variant | 1996 | 1 | C → S in TDH3; autosomal recessive. Ref.20 Corresponds to variant rs2076739 [ dbSNP | Ensembl ]. | VAR_010219 | |||||||
| Natural variant | 1999 | 1 | R → W. Ref.20 Corresponds to variant rs2076740 [ dbSNP | Ensembl ]. | VAR_010220 | |||||||
| Natural variant | 2091 | 1 | D → E. Ref.1 Ref.20 | VAR_016860 | |||||||
| Natural variant | 2149 | 1 | P → L. Ref.1 Ref.8 Ref.20 Corresponds to variant rs2069564 [ dbSNP | Ensembl ]. | VAR_016861 | |||||||
| Natural variant | 2170 | 1 | Q → R. Ref.1 Ref.8 Ref.20 Corresponds to variant rs2069565 [ dbSNP | Ensembl ]. | VAR_016862 | |||||||
| Natural variant | 2234 | 1 | A → D in TDH3; reduces thyroglobulin synthesis and secretion; promotes thyroglobulin retention within the endoplasmic reticulum. Ref.23 Ref.25 | VAR_063036 | |||||||
| Natural variant | 2242 | 1 | R → H. Ref.1 Ref.20 Corresponds to variant rs2069566 [ dbSNP | Ensembl ]. | VAR_016863 | |||||||
| Natural variant | 2336 | 1 | R → Q in TDH3. Ref.22 | VAR_063037 | |||||||
| Natural variant | 2375 | 1 | G → R in TDH3. Ref.24 | VAR_063038 | |||||||
| Natural variant | 2455 | 1 | R → H. Corresponds to variant rs2272707 [ dbSNP | Ensembl ]. | VAR_049083 | |||||||
| Natural variant | 2469 | 1 | L → P. Corresponds to variant rs2069568 [ dbSNP | Ensembl ]. | VAR_049084 | |||||||
| Natural variant | 2501 | 1 | W → R. Ref.20 Corresponds to variant rs2069569 [ dbSNP | Ensembl ]. | VAR_010221 | |||||||
| Natural variant | 2526 | 1 | F → L. Corresponds to variant rs12114109 [ dbSNP | Ensembl ]. | VAR_049085 | |||||||
| Natural variant | 2530 | 1 | R → Q. Ref.20 Corresponds to variant rs1133076 [ dbSNP | Ensembl ]. | VAR_010222 | |||||||
| Natural variant | 2616 | 1 | N → S. Corresponds to variant rs10091530 [ dbSNP | Ensembl ]. | VAR_049086 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 23 – 25 | 3 | EYQ → GKF in CAA26527. Ref.6 | ||||||||
| Sequence conflict | 848 | 1 | Missing AA sequence Ref.13 | ||||||||
| Sequence conflict | 984 – 985 | 2 | EQ → DR in CAA29456. Ref.5 | ||||||||
| Sequence conflict | 1359 – 1360 | 2 | Missing AA sequence Ref.13 | ||||||||
| Sequence conflict | 1717 | 1 | L → A AA sequence Ref.13 | ||||||||
| Sequence conflict | 1776 | 1 | T → S AA sequence Ref.13 | ||||||||
| Sequence conflict | 2019 | 1 | G → H AA sequence Ref.13 | ||||||||
| Sequence conflict | 2287 | 1 | F → P AA sequence Ref.13 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Primary structure of human thyroglobulin deduced from the sequence of its 8448-base complementary DNA." Malthiery Y., Lissitzky S. Eur. J. Biochem. 165:491-498(1987) [PubMed: 3595599] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ASP-604; ASP-653; GLN-985 DEL; TYR-1043; THR-1059; GLY-1312; ARG-1437; HIS-1463; THR-1936; GLU-2091; LEU-2149; ARG-2170 AND HIS-2242. |
| [2] | "The revised 8307 base pair coding sequence of human thyroglobulin transiently expressed in eukaryotic cells." van de Graaf S.A.R., Pauws E., de Vijlder J.J.M., Ris-Stalpers C. Eur. J. Endocrinol. 136:508-515(1997) [PubMed: 9186272] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-1312. Tissue: Thyroid. |
| [3] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-515. |
| [4] | "Sequence of the 5'-end quarter of the human-thyroglobulin messenger ribonucleic acid and of its deduced amino-acid sequence." Malthiery Y., Lissitzky S. Eur. J. Biochem. 147:53-58(1985) [PubMed: 3971976] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-730, VARIANTS ASP-604 AND ASP-653. |
| [5] | "Structural organization of the 5' region of the thyroglobulin gene. Evidence for intron loss and 'exonization' during evolution." Parma J., Christophe D., Pohl V., Vassart G. J. Mol. Biol. 196:769-779(1987) [PubMed: 3681978] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-415; 640-737 AND 880-1000, VARIANT ALA-734. |
| [6] | "An unusually long poly(purine)-poly(pyrimidine) sequence is located upstream from the human thyroglobulin gene." Christophe D., Cabrer B., Bacolla A., Targovnik H.M., Pohl V., Vassart G. Nucleic Acids Res. 13:5127-5144(1985) [PubMed: 2991855] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-25. |
| [7] | "Genomic organization of the 5' region of the human thyroglobulin gene." Moya C.M., Mendive F.M., Rivolta C.M., Vassart G., Targovnik H.M. Eur. J. Endocrinol. 143:789-798(2000) [PubMed: 11124863] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1002-1566 (ISOFORM 1), VARIANT GLY-1312. |
| [8] | "Genomic organization of the 3' region of the human thyroglobulin gene." Mendive F.M., Rivolta C.M., Vassart G., Targovnik H.M. Thyroid 9:903-912(1999) [PubMed: 10524569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1645-2768, VARIANTS LEU-2149 AND ARG-2170. |
| [9] | "Identification of a minor Tg mRNA transcript in RNA from normal and goitrous thyroids." Targovnik H.M., Cochaux P., Corach D., Vassart G. Mol. Cell. Endocrinol. 84:R23-R26(1992) [PubMed: 1639210] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1504-1602 (ISOFORM 2). |
| [10] | "Hormone synthesis in human thyroglobulin: possible cleavage of the polypeptide chain at the tyrosine donor site." Marriq C., Lejeune P.J., Venot N., Vinet L. FEBS Lett. 242:414-418(1989) [PubMed: 2914619] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| [11] | "Preferential sites of proteolytic cleavage of bovine, human and rat thyroglobulin. The use of limited proteolysis to detect solvent-exposed regions of the primary structure." Gentile F., Salvatore G. Eur. J. Biochem. 218:603-621(1993) [PubMed: 8269951] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| [12] | "Characterization of hormonogenic sites in an N-terminal, cyanogen bromide fragment of human thyroglobulin." Xiao S., Pollock H.G., Taurog A., Rawitch A.B. Arch. Biochem. Biophys. 320:96-105(1995) [PubMed: 7793989] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| [13] | "Glycosylation in human thyroglobulin: location of the N-linked oligosaccharide units and comparison with bovine thyroglobulin." Yang S.X., Pollock H.G., Rawitch A.B. Arch. Biochem. Biophys. 327:61-70(1996) [PubMed: 8615697] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, GLYCOSYLATION AT ASN-76; ASN-198; ASN-484; ASN-529; ASN-748; ASN-816; ASN-947; ASN-1220; ASN-1348; ASN-1349; ASN-1365; ASN-1716; ASN-1774; ASN-2013; ASN-2250; ASN-2295 AND ASN-2582, ABSENCE OF GLYCOSYLATION AT ASN-110; ASN-496; ASN-1869 AND ASN-2122. |
| [14] | "Characterization of the type-1 repeat from thyroglobulin, a cysteine-rich module found in proteins from different families." Molina F., Bouanani M., Pau B., Granier C. Eur. J. Biochem. 240:125-133(1996) [PubMed: 8797845] [Abstract] Cited for: PRESENCE OF A 11TH TYROGLOBULIN TYPE-1 REPEAT. |
| [15] | "Consensus sequences for early iodination and hormonogenesis in human thyroglobulin." Lamas L., Anderson P.C., Fox J.W., Dunn J.T. J. Biol. Chem. 264:13541-13545(1989) [PubMed: 2760035] [Abstract] Cited for: IODINATION AT TYR-24; TYR-1310; TYR-2573; TYR-2587 AND TYR-2766. |
| [16] | "Sulfated tyrosines of thyroglobulin are involved in thyroid hormone synthesis." Nlend M.-C., Cauvi D., Venot N., Chabaud O. Biochem. Biophys. Res. Commun. 262:193-197(1999) [PubMed: 10448091] [Abstract] Cited for: SULFATION. |
| [17] | "The hormonogenic tyrosine 5 of porcine thyroglobulin is sulfated." Venot N., Nlend M.-C., Cauvi D., Chabaud O. Biochem. Biophys. Res. Commun. 298:193-197(2002) [PubMed: 12387814] [Abstract] Cited for: SULFATION AT TYR-24. |
| [18] | "A single chondroitin 6-sulfate oligosaccharide unit at Ser-2730 of human thyroglobulin enhances hormone formation and limits proteolytic accessibility at the carboxyl terminus. Potential insights into thyroid homeostasis and autoimmunity." Conte M., Arcaro A., D'Angelo D., Gnata A., Mamone G., Ferranti P., Formisano S., Gentile F. J. Biol. Chem. 281:22200-22211(2006) [PubMed: 16679516] [Abstract] Cited for: GLYCOSYLATION AT SER-2749. |
| [19] | "Thyroglobulin gene point mutation associated with non-endemic simple goitre." Corral J., Martin C., Perez R., Sanchez I., Mories M.T., San Millan J.L., Miralles J.M., Gonzalez-Sarmiento R. Lancet 341:462-464(1993) [PubMed: 8094490] [Abstract] Cited for: VARIANT HIS-870. |
| [20] | "Two novel cysteine substitutions (C1263R and C1995S) of thyroglobulin cause a defect in intracellular transport of thyroglobulin in patients with congenital goiter and the variant type of adenomatous goiter." Hishinuma A., Takamatsu J., Ohyama Y., Yokozawa T., Kanno Y., Kuma K., Yoshida S., Matsuura N., Ieiri T. J. Clin. Endocrinol. Metab. 84:1438-1444(1999) [PubMed: 10199792] [Abstract] Cited for: VARIANTS TDH3 ARG-1264 AND SER-1996, VARIANTS HIS-135; ASP-604; ASP-653; ALA-734; GLU-830; GLN-985 DEL; VAL-1028; TYR-1043; THR-1059; ARG-1437; HIS-1463; ASN-1838; THR-1936; TRP-1999; GLU-2091; LEU-2149; ARG-2170; HIS-2242; ARG-2501 AND GLN-2530. |
| [21] | "Amino acid substitutions in the thyroglobulin gene are associated with susceptibility to human and murine autoimmune thyroid disease." Ban Y., Greenberg D.A., Concepcion E., Skrabanek L., Villanueva R., Tomer Y. Proc. Natl. Acad. Sci. U.S.A. 100:15119-15124(2003) [PubMed: 14657345] [Abstract] Cited for: VARIANTS ALA-734; VAL-1028 AND TRP-1979, INVOLVEMENT IN AITD3. |
| [22] | "A novel compound heterozygous mutation in the thyroglobulin gene resulting in congenital goitrous hypothyroidism with high serum triiodothyronine levels." Kitanaka S., Takeda A., Sato U., Miki Y., Hishinuma A., Ieiri T., Igarashi T. J. Hum. Genet. 51:379-382(2006) [PubMed: 16477365] [Abstract] Cited for: VARIANTS TDH3 TYR-1897 AND GLN-2336. |
| [23] | "Congenital hypothyroidism with goitre caused by new mutations in the thyroglobulin gene." Caputo M., Rivolta C.M., Esperante S.A., Gruneiro-Papendieck L., Chiesa A., Pellizas C.G., Gonzalez-Sarmiento R., Targovnik H.M. Clin. Endocrinol. (Oxf.) 67:351-357(2007) [PubMed: 17532758] [Abstract] Cited for: VARIANTS TDH3 TYR-183 AND ASP-2234. |
| [24] | "Thyroglobulin gene mutations producing defective intracellular transport of thyroglobulin are associated with increased thyroidal type 2 iodothyronine deiodinase activity." Kanou Y., Hishinuma A., Tsunekawa K., Seki K., Mizuno Y., Fujisawa H., Imai T., Miura Y., Nagasaka T., Yamada C., Ieiri T., Murakami M., Murata Y. J. Clin. Endocrinol. Metab. 92:1451-1457(2007) [PubMed: 17244789] [Abstract] Cited for: VARIANT TDH3 ARG-2375. |
| [25] | "The p.A2215D thyroglobulin gene mutation leads to deficient synthesis and secretion of the mutated protein and congenital hypothyroidism with wide phenotype variation." Pardo V., Vono-Toniolo J., Rubio I.G., Knobel M., Possato R.F., Targovnik H.M., Kopp P., Medeiros-Neto G. J. Clin. Endocrinol. Metab. 94:2938-2944(2009) [PubMed: 19509106] [Abstract] Cited for: VARIANT TDH3 ASP-2234, CHARACTERIZATION OF VARIANT TDH3 ASP-2234. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Thyroglobulin entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X05615 mRNA. Translation: CAA29104.1. U93033 mRNA. Translation: AAC51924.1. AF230667 Genomic DNA. No translation available. AF235100 Genomic DNA. No translation available. AF230666 Genomic DNA. No translation available. AF305872 Genomic DNA. No translation available. X02154 mRNA. Translation: CAA26089.1. X06059 X06066 Genomic DNA. Translation: CAA29454.1.X06067, X06068 Genomic DNA. Translation: CAA29455.1. X06069, X06070 Genomic DNA. Translation: CAA29456.1. X02749 Genomic DNA. Translation: CAA26527.1. AF170489 AF170488 Genomic DNA. Translation: AAD51647.1.AF105687 AF105686 Genomic DNA. Translation: AAC95473.1.AF080484 AF080483 Genomic DNA. Translation: AAD50912.2.S40807 mRNA. Translation: AAB22685.1. |
| IPI | IPI00306129. IPI00549199. |
| PIR | UIHU. A59110. |
| RefSeq | NP_003226.4. NM_003235.4. |
| UniGene | Hs.654591. |
3D structure databases | |
| ProteinModelPortal | P01266. |
| SMR | P01266. Positions 48-85, 93-161, 314-358, 611-798, 1024-1073, 1147-1211, 2198-2730. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P01266. 2 interactions. |
| STRING | P01266. |
Protein family/group databases | |
| MEROPS | S09.978. |
PTM databases | |
| PhosphoSite | P01266. |
Polymorphism databases | |
| DMDM | 126302607. |
Proteomic databases | |
| PRIDE | P01266. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000220616; ENSP00000220616; ENSG00000042832. |
| GeneID | 7038. |
| KEGG | hsa:7038. |
| NMPDR | fig|9606.3.peg.30756. |
| UCSC | uc003ytw.1. human. |
Organism-specific databases | |
| CTD | 7038. |
| GeneCards | GC08P133948. |
| H-InvDB | HIX0034371. |
| HGNC | HGNC:11764. TG. |
| HPA | CAB000077. HPA002740. |
| MIM | 188450. gene. 274700. phenotype. 608175. phenotype. |
| neXtProt | NX_P01266. |
| PharmGKB | PA36479. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG017929. |
| InParanoid | P01266. |
| OMA | RGTFNFS. |
| PhylomeDB | P01266. |
Gene expression databases | |
| ArrayExpress | P01266. |
| Bgee | P01266. |
| Genevestigator | P01266. |
Family and domain databases | |
| InterPro | IPR002018. CarbesteraseB. IPR019819. Carboxylesterase_B_CS. IPR016324. Thyroglobulin. IPR000716. Thyroglobulin_1. IPR011641. Tyr-kin_ephrin_A/B_rcpt-like. [Graphical view] |
| Gene3D | G3DSA:4.10.800.10. Thyroglobulin_1. 13 hits. |
| KO | K10809. |
| Pfam | PF00135. COesterase. 1 hit. PF07699. GCC2_GCC3. 1 hit. PF00086. Thyroglobulin_1. 8 hits. [Graphical view] |
| PIRSF | PIRSF001831. Thyroglobulin. 1 hit. |
| SMART | SM00211. TY. 10 hits. [Graphical view] |
| SUPFAM | SSF57610. Thyroglobulin_1. 11 hits. |
| PROSITE | PS00941. CARBOXYLESTERASE_B_2. 1 hit. PS00484. THYROGLOBULIN_1_1. 9 hits. PS51162. THYROGLOBULIN_1_2. 11 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 27497. |
| SOURCE | Search... |
Entry information
| Entry name | THYG_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P01266 Secondary accession number(s): O15274 Q9UNY3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Recent format changes Overview of recent format changes |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with