Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thyroglobulin

Gene

TG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).

GO - Molecular functioni

GO - Biological processi

  • hormone biosynthetic process Source: UniProtKB-KW
  • iodide transport Source: Ensembl
  • regulation of myelination Source: Ensembl
  • signal transduction Source: ProtInc
  • thyroid gland development Source: UniProtKB
  • thyroid hormone metabolic process Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hormone, Thyroid hormone

Keywords - Biological processi

Thyroid hormones biosynthesis

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000042832-MONOMER.
ZFISH:ENSG00000042832-MONOMER.

Protein family/group databases

ESTHERihuman-TG. Thyroglobulin.
MEROPSiS09.978.

Names & Taxonomyi

Protein namesi
Recommended name:
Thyroglobulin
Short name:
Tg
Gene namesi
Name:TG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:11764. TG.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: UniProtKB
  • extracellular space Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

Thyroid dyshormonogenesis 3 (TDH3)5 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder due to thyroid dyshormonogenesis, causing large goiters of elastic and soft consistency in the majority of patients. Although the degree of thyroid dysfunction varies considerably among patients with defective thyroglobulin synthesis, patients usually have a relatively high serum free triiodothyronine (T3) concentration with disproportionately low free tetraiodothyronine (T4) level. The maintenance of relatively high free T3 levels prevents profound tissue hypothyroidism except in brain and pituitary, which are dependent on T4 supply, resulting in neurologic and intellectual defects in some cases.
See also OMIM:274700
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_063034183C → Y in TDH3. 1 Publication1
Natural variantiVAR_0102161264C → R in TDH3; autosomal recessive. 1 PublicationCorresponds to variant rs2076738dbSNPEnsembl.1
Natural variantiVAR_0630351897C → Y in TDH3. 1 PublicationCorresponds to variant rs121912649dbSNPEnsembl.1
Natural variantiVAR_0102191996C → S in TDH3; autosomal recessive. 1 PublicationCorresponds to variant rs2076739dbSNPEnsembl.1
Natural variantiVAR_0630362234A → D in TDH3; reduces thyroglobulin synthesis and secretion; promotes thyroglobulin retention within the endoplasmic reticulum. 2 PublicationsCorresponds to variant rs370991693dbSNPEnsembl.1
Natural variantiVAR_0630372336R → Q in TDH3. 1 PublicationCorresponds to variant rs121912650dbSNPEnsembl.1
Natural variantiVAR_0630382375G → R in TDH3. 1 PublicationCorresponds to variant rs137854434dbSNPEnsembl.1
Autoimmune thyroid disease 3 (AITD3)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA complex autoimmune disorder comprising two related diseases affecting the thyroid: Graves disease and Hashimoto thyroiditis. In both disorders, thyroid-reactive T-cells are formed and infiltrate the thyroid gland. In Graves disease, the majority of the T-cells undergo a Th2 differentiation and activate B-cells to produce antibodies against the TSH receptor, which stimulate the thyroid and cause clinical hyperthyroidism. In contrast, Hashimoto thyroiditis is characterized by Th1 switching of the thyroid-infiltrating T-cells, which induces apoptosis of thyroid follicular cells and clinical hypothyroidism.
See also OMIM:608175
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_010213734S → A Polymorphism associated with AITD3. 3 PublicationsCorresponds to variant rs180223dbSNPEnsembl.1
Natural variantiVAR_0102151028M → V Polymorphism associated with AITD3. 2 PublicationsCorresponds to variant rs853326dbSNPEnsembl.1
Natural variantiVAR_0320131979R → W Polymorphism associated with AITD3. 1 Publication1

Keywords - Diseasei

Congenital hypothyroidism, Disease mutation

Organism-specific databases

DisGeNETi7038.
MalaCardsiTG.
MIMi274700. phenotype.
608175. phenotype.
OpenTargetsiENSG00000042832.
Orphaneti95716. Familial thyroid dyshormonogenesis.
PharmGKBiPA36479.

Polymorphism and mutation databases

BioMutaiTG.
DMDMi126302607.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Add BLAST19
ChainiPRO_000000863620 – 2768ThyroglobulinAdd BLAST2749

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei24Sulfotyrosine; alternateBy similarity1
Modified residuei24Thyroxine; alternate1
Disulfide bondi34 ↔ 52PROSITE-ProRule annotation
Disulfide bondi63 ↔ 70PROSITE-ProRule annotation
Disulfide bondi72 ↔ 92PROSITE-ProRule annotation
Glycosylationi76N-linked (GlcNAc...)1 Publication1
Disulfide bondi96 ↔ 120PROSITE-ProRule annotation
Disulfide bondi131 ↔ 138PROSITE-ProRule annotation
Disulfide bondi140 ↔ 160PROSITE-ProRule annotation
Disulfide bondi164 ↔ 183PROSITE-ProRule annotation
Disulfide bondi194 ↔ 235PROSITE-ProRule annotation
Glycosylationi198N-linked (GlcNAc...)1 Publication1
Disulfide bondi301 ↔ 319PROSITE-ProRule annotation
Disulfide bondi330 ↔ 336PROSITE-ProRule annotation
Disulfide bondi338 ↔ 358PROSITE-ProRule annotation
Glycosylationi484N-linked (GlcNAc...)1 Publication1
Glycosylationi529N-linked (GlcNAc...)1 Publication1
Disulfide bondi608 ↔ 620PROSITE-ProRule annotation
Disulfide bondi631 ↔ 636PROSITE-ProRule annotation
Disulfide bondi638 ↔ 658PROSITE-ProRule annotation
Disulfide bondi662 ↔ 687PROSITE-ProRule annotation
Disulfide bondi698 ↔ 703PROSITE-ProRule annotation
Disulfide bondi705 ↔ 726PROSITE-ProRule annotation
Disulfide bondi730 ↔ 763PROSITE-ProRule annotation
Glycosylationi748N-linked (GlcNAc...)1 Publication1
Disulfide bondi774 ↔ 898PROSITE-ProRule annotation
Glycosylationi816N-linked (GlcNAc...)1 Publication1
Disulfide bondi900 ↔ 921PROSITE-ProRule annotation
Glycosylationi947N-linked (GlcNAc...)1 Publication1
Disulfide bondi1042 ↔ 1049PROSITE-ProRule annotation
Disulfide bondi1051 ↔ 1073PROSITE-ProRule annotation
Disulfide bondi1077 ↔ 1108PROSITE-ProRule annotation
Disulfide bondi1126 ↔ 1145PROSITE-ProRule annotation
Disulfide bondi1149 ↔ 1169PROSITE-ProRule annotation
Disulfide bondi1181 ↔ 1188PROSITE-ProRule annotation
Disulfide bondi1190 ↔ 1210PROSITE-ProRule annotation
Glycosylationi1220N-linked (GlcNAc...)1 Publication1
Modified residuei1310Thyroxine1
Glycosylationi1348N-linked (GlcNAc...)1 Publication1
Glycosylationi1349N-linked (GlcNAc...)1 Publication1
Glycosylationi1365N-linked (GlcNAc...)1 Publication1
Disulfide bondi1514 ↔ 1523PROSITE-ProRule annotation
Disulfide bondi1543 ↔ 1565PROSITE-ProRule annotation
Glycosylationi1716N-linked (GlcNAc...)1 Publication1
Glycosylationi1774N-linked (GlcNAc...)1 Publication1
Glycosylationi2013N-linked (GlcNAc...)1 Publication1
Glycosylationi2250N-linked (GlcNAc...)1 Publication1
Disulfide bondi2264 ↔ 2281PROSITE-ProRule annotation
Glycosylationi2295N-linked (GlcNAc...)1 Publication1
Modified residuei2573Thyroxine1
Glycosylationi2582N-linked (GlcNAc...)1 Publication1
Modified residuei2587Thyroxine1
Glycosylationi2749O-linked (Xyl...) (chondroitin sulfate)1 Publication1
Modified residuei2766Triiodothyronine1

Post-translational modificationi

Sulfated tyrosines are desulfated during iodination.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei110Not glycosylated1 Publication1
Sitei496Not glycosylated1 Publication1
Sitei1869Not glycosylated1 Publication1
Sitei2122Not glycosylated1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, Iodination, Sulfation

Proteomic databases

PaxDbiP01266.
PeptideAtlasiP01266.
PRIDEiP01266.

PTM databases

iPTMnetiP01266.
PhosphoSitePlusiP01266.
UniCarbKBiP01266.

Expressioni

Tissue specificityi

Thyroid gland specific.

Gene expression databases

BgeeiENSG00000042832.
ExpressionAtlasiP01266. baseline and differential.
GenevisibleiP01266. HS.

Organism-specific databases

HPAiCAB000077.
CAB056155.
HPA002740.

Interactioni

Subunit structurei

Homodimer.

Protein-protein interaction databases

BioGridi112896. 3 interactors.
IntActiP01266. 2 interactors.
STRINGi9606.ENSP00000220616.

Structurei

3D structure databases

ProteinModelPortaliP01266.
SMRiP01266.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini31 – 92Thyroglobulin type-1 1PROSITE-ProRule annotationAdd BLAST62
Domaini93 – 160Thyroglobulin type-1 2PROSITE-ProRule annotationAdd BLAST68
Domaini161 – 297Thyroglobulin type-1 3PROSITE-ProRule annotationAdd BLAST137
Domaini298 – 358Thyroglobulin type-1 4PROSITE-ProRule annotationAdd BLAST61
Domaini605 – 658Thyroglobulin type-1 5PROSITE-ProRule annotationAdd BLAST54
Domaini659 – 726Thyroglobulin type-1 6PROSITE-ProRule annotationAdd BLAST68
Domaini727 – 921Thyroglobulin type-1 7PROSITE-ProRule annotationAdd BLAST195
Domaini922 – 1073Thyroglobulin type-1 8PROSITE-ProRule annotationAdd BLAST152
Domaini1074 – 1145Thyroglobulin type-1 9PROSITE-ProRule annotationAdd BLAST72
Domaini1146 – 1210Thyroglobulin type-1 10PROSITE-ProRule annotationAdd BLAST65
Repeati1456 – 1469Type II1 PublicationAdd BLAST14
Repeati1470 – 1486Type II1 PublicationAdd BLAST17
Repeati1487 – 1503Type II1 PublicationAdd BLAST17
Domaini1511 – 1565Thyroglobulin type-1 11PROSITE-ProRule annotationAdd BLAST55
Repeati1603 – 1723Type IIIA1 PublicationAdd BLAST121
Repeati1724 – 1892Type IIIB1 PublicationAdd BLAST169
Repeati1893 – 1995Type IIIA1 PublicationAdd BLAST103
Repeati1996 – 2129Type IIIB1 PublicationAdd BLAST134
Repeati2130 – 2187Type IIIA1 PublicationAdd BLAST58

Sequence similaritiesi

Contains 11 thyroglobulin type-1 domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IG6K. Eukaryota.
COG2272. LUCA.
GeneTreeiENSGT00680000100015.
HOVERGENiHBG017929.
InParanoidiP01266.
KOiK10809.
OMAiLRSCWCV.
OrthoDBiEOG091G004S.
PhylomeDBiP01266.
TreeFamiTF351833.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
4.10.800.10. 13 hits.
InterProiIPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019819. Carboxylesterase_B_CS.
IPR016324. Thyroglobulin.
IPR000716. Thyroglobulin_1.
IPR011641. Tyr-kin_ephrin_A/B_rcpt-like.
[Graphical view]
PfamiPF00135. COesterase. 1 hit.
PF07699. Ephrin_rec_like. 1 hit.
PF00086. Thyroglobulin_1. 10 hits.
[Graphical view]
PIRSFiPIRSF001831. Thyroglobulin. 1 hit.
SMARTiSM01411. Ephrin_rec_like. 1 hit.
SM00211. TY. 10 hits.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.
SSF57610. SSF57610. 13 hits.
PROSITEiPS00941. CARBOXYLESTERASE_B_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 9 hits.
PS51162. THYROGLOBULIN_1_2. 11 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P01266-1) [UniParc]FASTAAdd to basket
Also known as: Major

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALVLEIFTL LASICWVSAN IFEYQVDAQP LRPCELQRET AFLKQADYVP
60 70 80 90 100
QCAEDGSFQT VQCQNDGRSC WCVGANGSEV LGSRQPGRPV ACLSFCQLQK
110 120 130 140 150
QQILLSGYIN STDTSYLPQC QDSGDYAPVQ CDVQQVQCWC VDAEGMEVYG
160 170 180 190 200
TRQLGRPKRC PRSCEIRNRR LLHGVGDKSP PQCSAEGEFM PVQCKFVNTT
210 220 230 240 250
DMMIFDLVHS YNRFPDAFVT FSSFQRRFPE VSGYCHCADS QGRELAETGL
260 270 280 290 300
ELLLDEIYDT IFAGLDLPST FTETTLYRIL QRRFLAVQSV ISGRFRCPTK
310 320 330 340 350
CEVERFTATS FGHPYVPSCR RNGDYQAVQC QTEGPCWCVD AQGKEMHGTR
360 370 380 390 400
QQGEPPSCAE GQSCASERQQ ALSRLYFGTS GYFSQHDLFS SPEKRWASPR
410 420 430 440 450
VARFATSCPP TIKELFVDSG LLRPMVEGQS QQFSVSENLL KEAIRAIFPS
460 470 480 490 500
RGLARLALQF TTNPKRLQQN LFGGKFLVNV GQFNLSGALG TRGTFNFSQF
510 520 530 540 550
FQQLGLASFL NGGRQEDLAK PLSVGLDSNS STGTPEAAKK DGTMNKPTVG
560 570 580 590 600
SFGFEINLQE NQNALKFLAS LLELPEFLLF LQHAISVPED VARDLGDVME
610 620 630 640 650
TVLSSQTCEQ TPERLFVPSC TTEGSYEDVQ CFSGECWCVN SWGKELPGSR
660 670 680 690 700
VRGGQPRCPT DCEKQRARMQ SLMGSQPAGS TLFVPACTSE GHFLPVQCFN
710 720 730 740 750
SECYCVDAEG QAIPGTRSAI GKPKKCPTPC QLQSEQAFLR TVQALLSNSS
760 770 780 790 800
MLPTLSDTYI PQCSTDGQWR QVQCNGPPEQ VFELYQRWEA QNKGQDLTPA
810 820 830 840 850
KLLVKIMSYR EAASGNFSLF IQSLYEAGQQ DVFPVLSQYP SLQDVPLAAL
860 870 880 890 900
EGKRPQPREN ILLEPYLFWQ ILNGQLSQYP GSYSDFSTPL AHFDLRNCWC
910 920 930 940 950
VDEAGQELEG MRSEPSKLPT CPGSCEEAKL RVLQFIRETE EIVSASNSSR
960 970 980 990 1000
FPLGESFLVA KGIRLRNEDL GLPPLFPPRE AFAEQFLRGS DYAIRLAAQS
1010 1020 1030 1040 1050
TLSFYQRRRF SPDDSAGASA LLRSGPYMPQ CDAFGSWEPV QCHAGTGHCW
1060 1070 1080 1090 1100
CVDEKGGFIP GSLTARSLQI PQCPTTCEKS RTSGLLSSWK QARSQENPSP
1110 1120 1130 1140 1150
KDLFVPACLE TGEYARLQAS GAGTWCVDPA SGEELRPGSS SSAQCPSLCN
1160 1170 1180 1190 1200
VLKSGVLSRR VSPGYVPACR AEDGGFSPVQ CDQAQGSCWC VMDSGEEVPG
1210 1220 1230 1240 1250
TRVTGGQPAC ESPRCPLPFN ASEVVGGTIL CETISGPTGS AMQQCQLLCR
1260 1270 1280 1290 1300
QGSWSVFPPG PLICSLESGR WESQLPQPRA CQRPQLWQTI QTQGHFQLQL
1310 1320 1330 1340 1350
PPGKMCSADY ADLLQTFQVF ILDELTARGF CQIQVKTFGT LVSIPVCNNS
1360 1370 1380 1390 1400
SVQVGCLTRE RLGVNVTWKS RLEDIPVASL PDLHDIERAL VGKDLLGRFT
1410 1420 1430 1440 1450
DLIQSGSFQL HLDSKTFPAE TIRFLQGDHF GTSPRTWFGC SEGFYQVLTS
1460 1470 1480 1490 1500
EASQDGLGCV KCPEGSYSQD EECIPCPVGF YQEQAGSLAC VPCPVGRTTI
1510 1520 1530 1540 1550
SAGAFSQTHC VTDCQRNEAG LQCDQNGQYR ASQKDRGSGK AFCVDGEGRR
1560 1570 1580 1590 1600
LPWWETEAPL EDSQCLMMQK FEKVPESKVI FDANAPVAVR SKVPDSEFPV
1610 1620 1630 1640 1650
MQCLTDCTED EACSFFTVST TEPEISCDFY AWTSDNVACM TSDQKRDALG
1660 1670 1680 1690 1700
NSKATSFGSL RCQVKVRSHG QDSPAVYLKK GQGSTTTLQK RFEPTGFQNM
1710 1720 1730 1740 1750
LSGLYNPIVF SASGANLTDA HLFCLLACDR DLCCDGFVLT QVQGGAIICG
1760 1770 1780 1790 1800
LLSSPSVLLC NVKDWMDPSE AWANATCPGV TYDQESHQVI LRLGDQEFIK
1810 1820 1830 1840 1850
SLTPLEGTQD TFTNFQQVYL WKDSDMGSRP ESMGCRKDTV PRPASPTEAG
1860 1870 1880 1890 1900
LTTELFSPVD LNQVIVNGNQ SLSSQKHWLF KHLFSAQQAN LWCLSRCVQE
1910 1920 1930 1940 1950
HSFCQLAEIT ESASLYFTCT LYPEAQVCDD IMESNAQGCR LILPQMPKAL
1960 1970 1980 1990 2000
FRKKVILEDK VKNFYTRLPF QKLMGISIRN KVPMSEKSIS NGFFECERRC
2010 2020 2030 2040 2050
DADPCCTGFG FLNVSQLKGG EVTCLTLNSL GIQMCSEENG GAWRILDCGS
2060 2070 2080 2090 2100
PDIEVHTYPF GWYQKPIAQN NAPSFCPLVV LPSLTEKVSL DSWQSLALSS
2110 2120 2130 2140 2150
VVVDPSIRHF DVAHVSTAAT SNFSAVRDLC LSECSQHEAC LITTLQTQPG
2160 2170 2180 2190 2200
AVRCMFYADT QSCTHSLQGQ NCRLLLREEA THIYRKPGIS LLSYEASVPS
2210 2220 2230 2240 2250
VPISTHGRLL GRSQAIQVGT SWKQVDQFLG VPYAAPPLAE RRFQAPEPLN
2260 2270 2280 2290 2300
WTGSWDASKP RASCWQPGTR TSTSPGVSED CLYLNVFIPQ NVAPNASVLV
2310 2320 2330 2340 2350
FFHNTMDREE SEGWPAIDGS FLAAVGNLIV VTASYRVGVF GFLSSGSGEV
2360 2370 2380 2390 2400
SGNWGLLDQV AALTWVQTHI RGFGGDPRRV SLAADRGGAD VASIHLLTAR
2410 2420 2430 2440 2450
ATNSQLFRRA VLMGGSALSP AAVISHERAQ QQAIALAKEV SCPMSSSQEV
2460 2470 2480 2490 2500
VSCLRQKPAN VLNDAQTKLL AVSGPFHYWG PVIDGHFLRE PPARALKRSL
2510 2520 2530 2540 2550
WVEVDLLIGS SQDDGLINRA KAVKQFEESR GRTSSKTAFY QALQNSLGGE
2560 2570 2580 2590 2600
DSDARVEAAA TWYYSLEHST DDYASFSRAL ENATRDYFII CPIIDMASAW
2610 2620 2630 2640 2650
AKRARGNVFM YHAPENYGHG SLELLADVQF ALGLPFYPAY EGQFSLEEKS
2660 2670 2680 2690 2700
LSLKIMQYFS HFIRSGNPNY PYEFSRKVPT FATPWPDFVP RAGGENYKEF
2710 2720 2730 2740 2750
SELLPNRQGL KKADCSFWSK YISSLKTSAD GAKGGQSAES EEEELTAGSG
2760
LREDLLSLQE PGSKTYSK
Length:2,768
Mass (Da):304,790
Last modified:February 20, 2007 - v5
Checksum:i69A87D935F1BAA72
GO
Isoform 2 (identifier: P01266-2) [UniParc]FASTAAdd to basket
Also known as: Minor

The sequence of this isoform differs from the canonical sequence as follows:
     1510-1567: CVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLM → L

Show »
Length:2,711
Mass (Da):298,383
Checksum:iEEC6895F22D55EE0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti23 – 25EYQ → GKF in CAA26527 (PubMed:2991855).Curated3
Sequence conflicti848Missing AA sequence (PubMed:8615697).Curated1
Sequence conflicti984 – 985EQ → DR in CAA29456 (PubMed:3681978).Curated2
Sequence conflicti1359 – 1360Missing AA sequence (PubMed:8615697).Curated2
Sequence conflicti1717L → A AA sequence (PubMed:8615697).Curated1
Sequence conflicti1776T → S AA sequence (PubMed:8615697).Curated1
Sequence conflicti2019G → H AA sequence (PubMed:8615697).Curated1
Sequence conflicti2287F → P AA sequence (PubMed:8615697).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_010212135Q → H.1 PublicationCorresponds to variant rs2069546dbSNPEnsembl.1
Natural variantiVAR_063034183C → Y in TDH3. 1 Publication1
Natural variantiVAR_016190515Q → E.1 PublicationCorresponds to variant rs180222dbSNPEnsembl.1
Natural variantiVAR_016852604S → D Requires 2 nucleotide substitutions. 3 PublicationsCorresponds to variant rs2069547dbSNPEnsembl.1
Natural variantiVAR_016853653G → D.3 PublicationsCorresponds to variant rs2069548dbSNPEnsembl.1
Natural variantiVAR_010213734S → A Polymorphism associated with AITD3. 3 PublicationsCorresponds to variant rs180223dbSNPEnsembl.1
Natural variantiVAR_049077777P → L.Corresponds to variant rs3739274dbSNPEnsembl.1
Natural variantiVAR_049078815G → R.Corresponds to variant rs16904774dbSNPEnsembl.1
Natural variantiVAR_010214830Q → E.1 PublicationCorresponds to variant rs2076737dbSNPEnsembl.1
Natural variantiVAR_002365870Q → H.1 PublicationCorresponds to variant rs2229843dbSNPEnsembl.1
Natural variantiVAR_016854985Missing .2 Publications1
Natural variantiVAR_049079988R → P.Corresponds to variant rs16893332dbSNPEnsembl.1
Natural variantiVAR_0102151028M → V Polymorphism associated with AITD3. 2 PublicationsCorresponds to variant rs853326dbSNPEnsembl.1
Natural variantiVAR_0168551043H → Y.2 PublicationsCorresponds to variant rs143983705dbSNPEnsembl.1
Natural variantiVAR_0168561059I → T.2 Publications1
Natural variantiVAR_0490801063L → M.Corresponds to variant rs11992497dbSNPEnsembl.1
Natural variantiVAR_0490811222S → L.Corresponds to variant rs12549018dbSNPEnsembl.1
Natural variantiVAR_0102161264C → R in TDH3; autosomal recessive. 1 PublicationCorresponds to variant rs2076738dbSNPEnsembl.1
Natural variantiVAR_0102171312D → G.3 PublicationsCorresponds to variant rs2069556dbSNPEnsembl.1
Natural variantiVAR_0168571437W → R.2 PublicationsCorresponds to variant rs2069558dbSNPEnsembl.1
Natural variantiVAR_0168581463P → H.2 Publications1
Natural variantiVAR_0490821740T → K.Corresponds to variant rs16904791dbSNPEnsembl.1
Natural variantiVAR_0102181838D → N.1 PublicationCorresponds to variant rs2069561dbSNPEnsembl.1
Natural variantiVAR_0630351897C → Y in TDH3. 1 PublicationCorresponds to variant rs121912649dbSNPEnsembl.1
Natural variantiVAR_0168591936A → T.2 PublicationsCorresponds to variant rs2069562dbSNPEnsembl.1
Natural variantiVAR_0611731974M → T.Corresponds to variant rs56230101dbSNPEnsembl.1
Natural variantiVAR_0320131979R → W Polymorphism associated with AITD3. 1 Publication1
Natural variantiVAR_0102191996C → S in TDH3; autosomal recessive. 1 PublicationCorresponds to variant rs2076739dbSNPEnsembl.1
Natural variantiVAR_0102201999R → W.1 PublicationCorresponds to variant rs2076740dbSNPEnsembl.1
Natural variantiVAR_0168602091D → E.2 PublicationsCorresponds to variant rs2069563dbSNPEnsembl.1
Natural variantiVAR_0168612149P → L.3 PublicationsCorresponds to variant rs2069564dbSNPEnsembl.1
Natural variantiVAR_0168622170Q → R.3 PublicationsCorresponds to variant rs2069565dbSNPEnsembl.1
Natural variantiVAR_0630362234A → D in TDH3; reduces thyroglobulin synthesis and secretion; promotes thyroglobulin retention within the endoplasmic reticulum. 2 PublicationsCorresponds to variant rs370991693dbSNPEnsembl.1
Natural variantiVAR_0168632242R → H.2 PublicationsCorresponds to variant rs2069566dbSNPEnsembl.1
Natural variantiVAR_0630372336R → Q in TDH3. 1 PublicationCorresponds to variant rs121912650dbSNPEnsembl.1
Natural variantiVAR_0630382375G → R in TDH3. 1 PublicationCorresponds to variant rs137854434dbSNPEnsembl.1
Natural variantiVAR_0490832455R → H.Corresponds to variant rs2272707dbSNPEnsembl.1
Natural variantiVAR_0490842469L → P.Corresponds to variant rs2069568dbSNPEnsembl.1
Natural variantiVAR_0102212501W → R.1 PublicationCorresponds to variant rs2069569dbSNPEnsembl.1
Natural variantiVAR_0490852526F → L.Corresponds to variant rs12114109dbSNPEnsembl.1
Natural variantiVAR_0102222530R → Q.1 PublicationCorresponds to variant rs1133076dbSNPEnsembl.1
Natural variantiVAR_0490862616N → S.Corresponds to variant rs10091530dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0126551510 – 1567CVTDC…SQCLM → L in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X05615 mRNA. Translation: CAA29104.1.
U93033 mRNA. Translation: AAC51924.1.
AF230667 Genomic DNA. No translation available.
AF235100 Genomic DNA. No translation available.
AF230666 Genomic DNA. No translation available.
AF305872 Genomic DNA. No translation available.
X02154 mRNA. Translation: CAA26089.1.
X06059
, X06060, X06061, X06062, X06063, X06064, X06065, X06066 Genomic DNA. Translation: CAA29454.1.
X06067, X06068 Genomic DNA. Translation: CAA29455.1.
X06069, X06070 Genomic DNA. Translation: CAA29456.1.
X02749 Genomic DNA. Translation: CAA26527.1.
AH008122 Genomic DNA. Translation: AAD51647.1.
AH007064 Genomic DNA. Translation: AAC95473.1.
AF080484
, AF169654, AF169655, AF169656, AF169657, AF169658, AF169659, AF169661, AF169662, AF169663, AF169664, AF080472, AF080473, AF080474, AF080475, AF080476, AF080477, AF080478, AF080479, AF080480, AF080481, AF080482, AF080483 Genomic DNA. Translation: AAD50912.2.
S40807 mRNA. Translation: AAB22685.1.
CCDSiCCDS34944.1. [P01266-1]
PIRiA59110. UIHU.
RefSeqiNP_003226.4. NM_003235.4. [P01266-1]
XP_016869284.1. XM_017013795.1. [P01266-2]
UniGeneiHs.654591.

Genome annotation databases

EnsembliENST00000220616; ENSP00000220616; ENSG00000042832. [P01266-1]
GeneIDi7038.
KEGGihsa:7038.
UCSCiuc003ytw.4. human. [P01266-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Thyroglobulin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X05615 mRNA. Translation: CAA29104.1.
U93033 mRNA. Translation: AAC51924.1.
AF230667 Genomic DNA. No translation available.
AF235100 Genomic DNA. No translation available.
AF230666 Genomic DNA. No translation available.
AF305872 Genomic DNA. No translation available.
X02154 mRNA. Translation: CAA26089.1.
X06059
, X06060, X06061, X06062, X06063, X06064, X06065, X06066 Genomic DNA. Translation: CAA29454.1.
X06067, X06068 Genomic DNA. Translation: CAA29455.1.
X06069, X06070 Genomic DNA. Translation: CAA29456.1.
X02749 Genomic DNA. Translation: CAA26527.1.
AH008122 Genomic DNA. Translation: AAD51647.1.
AH007064 Genomic DNA. Translation: AAC95473.1.
AF080484
, AF169654, AF169655, AF169656, AF169657, AF169658, AF169659, AF169661, AF169662, AF169663, AF169664, AF080472, AF080473, AF080474, AF080475, AF080476, AF080477, AF080478, AF080479, AF080480, AF080481, AF080482, AF080483 Genomic DNA. Translation: AAD50912.2.
S40807 mRNA. Translation: AAB22685.1.
CCDSiCCDS34944.1. [P01266-1]
PIRiA59110. UIHU.
RefSeqiNP_003226.4. NM_003235.4. [P01266-1]
XP_016869284.1. XM_017013795.1. [P01266-2]
UniGeneiHs.654591.

3D structure databases

ProteinModelPortaliP01266.
SMRiP01266.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112896. 3 interactors.
IntActiP01266. 2 interactors.
STRINGi9606.ENSP00000220616.

Protein family/group databases

ESTHERihuman-TG. Thyroglobulin.
MEROPSiS09.978.

PTM databases

iPTMnetiP01266.
PhosphoSitePlusiP01266.
UniCarbKBiP01266.

Polymorphism and mutation databases

BioMutaiTG.
DMDMi126302607.

Proteomic databases

PaxDbiP01266.
PeptideAtlasiP01266.
PRIDEiP01266.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000220616; ENSP00000220616; ENSG00000042832. [P01266-1]
GeneIDi7038.
KEGGihsa:7038.
UCSCiuc003ytw.4. human. [P01266-1]

Organism-specific databases

CTDi7038.
DisGeNETi7038.
GeneCardsiTG.
H-InvDBHIX0034371.
HGNCiHGNC:11764. TG.
HPAiCAB000077.
CAB056155.
HPA002740.
MalaCardsiTG.
MIMi188450. gene.
274700. phenotype.
608175. phenotype.
neXtProtiNX_P01266.
OpenTargetsiENSG00000042832.
Orphaneti95716. Familial thyroid dyshormonogenesis.
PharmGKBiPA36479.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IG6K. Eukaryota.
COG2272. LUCA.
GeneTreeiENSGT00680000100015.
HOVERGENiHBG017929.
InParanoidiP01266.
KOiK10809.
OMAiLRSCWCV.
OrthoDBiEOG091G004S.
PhylomeDBiP01266.
TreeFamiTF351833.

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000042832-MONOMER.
ZFISH:ENSG00000042832-MONOMER.

Miscellaneous databases

ChiTaRSiTG. human.
GeneWikiiThyroglobulin.
GenomeRNAii7038.
PROiP01266.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000042832.
ExpressionAtlasiP01266. baseline and differential.
GenevisibleiP01266. HS.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
4.10.800.10. 13 hits.
InterProiIPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019819. Carboxylesterase_B_CS.
IPR016324. Thyroglobulin.
IPR000716. Thyroglobulin_1.
IPR011641. Tyr-kin_ephrin_A/B_rcpt-like.
[Graphical view]
PfamiPF00135. COesterase. 1 hit.
PF07699. Ephrin_rec_like. 1 hit.
PF00086. Thyroglobulin_1. 10 hits.
[Graphical view]
PIRSFiPIRSF001831. Thyroglobulin. 1 hit.
SMARTiSM01411. Ephrin_rec_like. 1 hit.
SM00211. TY. 10 hits.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.
SSF57610. SSF57610. 13 hits.
PROSITEiPS00941. CARBOXYLESTERASE_B_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 9 hits.
PS51162. THYROGLOBULIN_1_2. 11 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTHYG_HUMAN
AccessioniPrimary (citable) accession number: P01266
Secondary accession number(s): O15274
, O43899, Q15593, Q15948, Q9NYR1, Q9NYR2, Q9UMZ0, Q9UNY3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: February 20, 2007
Last modified: November 2, 2016
This is version 188 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.