Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P01266

- THYG_HUMAN

UniProt

P01266 - THYG_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Thyroglobulin

Gene

TG

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei110 – 1101Not glycosylated (PubMed:8615697)1 Publication
Sitei496 – 4961Not glycosylated (PubMed:8615697)1 Publication
Sitei1869 – 18691Not glycosylated (PubMed:8615697)1 Publication
Sitei2122 – 21221Not glycosylated (PubMed:8615697)1 Publication

GO - Biological processi

  1. hormone biosynthetic process Source: UniProtKB-KW
  2. iodide transport Source: Ensembl
  3. regulation of myelination Source: Ensembl
  4. signal transduction Source: ProtInc
  5. thyroid gland development Source: UniProtKB
  6. thyroid hormone generation Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Hormone, Thyroid hormone

Keywords - Biological processi

Thyroid hormones biosynthesis

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000042832-MONOMER.

Protein family/group databases

MEROPSiI31.950.

Names & Taxonomyi

Protein namesi
Recommended name:
Thyroglobulin
Short name:
Tg
Gene namesi
Name:TG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:11764. TG.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: UniProtKB
  2. extracellular space Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

Thyroid dyshormonogenesis 3 (TDH3) [MIM:274700]: A disorder due to thyroid dyshormonogenesis, causing large goiters of elastic and soft consistency in the majority of patients. Although the degree of thyroid dysfunction varies considerably among patients with defective thyroglobulin synthesis, patients usually have a relatively high serum free triiodothyronine (T3) concentration with disproportionately low free tetraiodothyronine (T4) level. The maintenance of relatively high free T3 levels prevents profound tissue hypothyroidism except in brain and pituitary, which are dependent on T4 supply, resulting in neurologic and intellectual defects in some cases.5 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti183 – 1831C → Y in TDH3. 1 Publication
VAR_063034
Natural varianti1264 – 12641C → R in TDH3; autosomal recessive. 1 Publication
Corresponds to variant rs2076738 [ dbSNP | Ensembl ].
VAR_010216
Natural varianti1897 – 18971C → Y in TDH3. 1 Publication
VAR_063035
Natural varianti1996 – 19961C → S in TDH3; autosomal recessive. 1 Publication
Corresponds to variant rs2076739 [ dbSNP | Ensembl ].
VAR_010219
Natural varianti2234 – 22341A → D in TDH3; reduces thyroglobulin synthesis and secretion; promotes thyroglobulin retention within the endoplasmic reticulum. 2 Publications
VAR_063036
Natural varianti2336 – 23361R → Q in TDH3. 1 Publication
VAR_063037
Natural varianti2375 – 23751G → R in TDH3. 1 Publication
VAR_063038
Autoimmune thyroid disease 3 (AITD3) [MIM:608175]: A complex autoimmune disorder comprising two related diseases affecting the thyroid: Graves disease and Hashimoto thyroiditis. In both disorders, thyroid-reactive T-cells are formed and infiltrate the thyroid gland. In Graves disease, the majority of the T-cells undergo a Th2 differentiation and activate B-cells to produce antibodies against the TSH receptor, which stimulate the thyroid and cause clinical hyperthyroidism. In contrast, Hashimoto thyroiditis is characterized by Th1 switching of the thyroid-infiltrating T-cells, which induces apoptosis of thyroid follicular cells and clinical hypothyroidism.1 Publication
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti734 – 7341S → A Polymorphism associated with AITD3. 3 Publications
Corresponds to variant rs180223 [ dbSNP | Ensembl ].
VAR_010213
Natural varianti1028 – 10281M → V Polymorphism associated with AITD3. 2 Publications
Corresponds to variant rs853326 [ dbSNP | Ensembl ].
VAR_010215
Natural varianti1979 – 19791R → W Polymorphism associated with AITD3. 1 Publication
VAR_032013

Keywords - Diseasei

Congenital hypothyroidism, Disease mutation

Organism-specific databases

MIMi274700. phenotype.
608175. phenotype.
Orphaneti95716. Familial thyroid dyshormonogenesis.
PharmGKBiPA36479.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Add
BLAST
Chaini20 – 27682749ThyroglobulinPRO_0000008636Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei24 – 241Sulfotyrosine; alternateBy similarity
Modified residuei24 – 241Thyroxine; alternate
Disulfide bondi34 ↔ 52PROSITE-ProRule annotation
Disulfide bondi63 ↔ 70PROSITE-ProRule annotation
Disulfide bondi72 ↔ 92PROSITE-ProRule annotation
Glycosylationi76 – 761N-linked (GlcNAc...)1 Publication
Disulfide bondi96 ↔ 120PROSITE-ProRule annotation
Disulfide bondi131 ↔ 138PROSITE-ProRule annotation
Disulfide bondi140 ↔ 160PROSITE-ProRule annotation
Disulfide bondi164 ↔ 183PROSITE-ProRule annotation
Disulfide bondi194 ↔ 235PROSITE-ProRule annotation
Glycosylationi198 – 1981N-linked (GlcNAc...)1 Publication
Disulfide bondi301 ↔ 319PROSITE-ProRule annotation
Disulfide bondi330 ↔ 336PROSITE-ProRule annotation
Disulfide bondi338 ↔ 358PROSITE-ProRule annotation
Glycosylationi484 – 4841N-linked (GlcNAc...)1 Publication
Glycosylationi529 – 5291N-linked (GlcNAc...)1 Publication
Disulfide bondi608 ↔ 620PROSITE-ProRule annotation
Disulfide bondi631 ↔ 636PROSITE-ProRule annotation
Disulfide bondi638 ↔ 658PROSITE-ProRule annotation
Disulfide bondi662 ↔ 687PROSITE-ProRule annotation
Disulfide bondi698 ↔ 703PROSITE-ProRule annotation
Disulfide bondi705 ↔ 726PROSITE-ProRule annotation
Disulfide bondi730 ↔ 763PROSITE-ProRule annotation
Glycosylationi748 – 7481N-linked (GlcNAc...)1 Publication
Disulfide bondi774 ↔ 898PROSITE-ProRule annotation
Glycosylationi816 – 8161N-linked (GlcNAc...)1 Publication
Disulfide bondi900 ↔ 921PROSITE-ProRule annotation
Glycosylationi947 – 9471N-linked (GlcNAc...)1 Publication
Disulfide bondi1042 ↔ 1049PROSITE-ProRule annotation
Disulfide bondi1051 ↔ 1073PROSITE-ProRule annotation
Disulfide bondi1077 ↔ 1108PROSITE-ProRule annotation
Disulfide bondi1126 ↔ 1145PROSITE-ProRule annotation
Disulfide bondi1149 ↔ 1169PROSITE-ProRule annotation
Disulfide bondi1181 ↔ 1188PROSITE-ProRule annotation
Disulfide bondi1190 ↔ 1210PROSITE-ProRule annotation
Glycosylationi1220 – 12201N-linked (GlcNAc...)1 Publication
Modified residuei1310 – 13101Thyroxine
Glycosylationi1348 – 13481N-linked (GlcNAc...)1 Publication
Glycosylationi1349 – 13491N-linked (GlcNAc...)1 Publication
Glycosylationi1365 – 13651N-linked (GlcNAc...)1 Publication
Disulfide bondi1514 ↔ 1523PROSITE-ProRule annotation
Disulfide bondi1543 ↔ 1565PROSITE-ProRule annotation
Glycosylationi1716 – 17161N-linked (GlcNAc...)1 Publication
Glycosylationi1774 – 17741N-linked (GlcNAc...)1 Publication
Glycosylationi2013 – 20131N-linked (GlcNAc...)1 Publication
Glycosylationi2250 – 22501N-linked (GlcNAc...)1 Publication
Disulfide bondi2264 ↔ 2281PROSITE-ProRule annotation
Glycosylationi2295 – 22951N-linked (GlcNAc...)1 Publication
Modified residuei2573 – 25731Thyroxine
Glycosylationi2582 – 25821N-linked (GlcNAc...)1 Publication
Modified residuei2587 – 25871Thyroxine
Glycosylationi2749 – 27491O-linked (Xyl...) (chondroitin sulfate)1 Publication
Modified residuei2766 – 27661Triiodothyronine

Post-translational modificationi

Sulfated tyrosines are desulfated during iodination.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Iodination, Sulfation

Proteomic databases

PaxDbiP01266.
PRIDEiP01266.

PTM databases

PhosphoSiteiP01266.

Expressioni

Tissue specificityi

Thyroid gland specific.

Gene expression databases

BgeeiP01266.
ExpressionAtlasiP01266. baseline and differential.
GenevestigatoriP01266.

Organism-specific databases

HPAiCAB000077.
CAB056155.
HPA002740.

Interactioni

Subunit structurei

Homodimer.

Protein-protein interaction databases

BioGridi112896. 3 interactions.
IntActiP01266. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliP01266.
SMRiP01266. Positions 2204-2728.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 9262Thyroglobulin type-1 1PROSITE-ProRule annotationAdd
BLAST
Domaini93 – 16068Thyroglobulin type-1 2PROSITE-ProRule annotationAdd
BLAST
Domaini161 – 297137Thyroglobulin type-1 3PROSITE-ProRule annotationAdd
BLAST
Domaini298 – 35861Thyroglobulin type-1 4PROSITE-ProRule annotationAdd
BLAST
Domaini605 – 65854Thyroglobulin type-1 5PROSITE-ProRule annotationAdd
BLAST
Domaini659 – 72668Thyroglobulin type-1 6PROSITE-ProRule annotationAdd
BLAST
Domaini727 – 921195Thyroglobulin type-1 7PROSITE-ProRule annotationAdd
BLAST
Domaini922 – 1073152Thyroglobulin type-1 8PROSITE-ProRule annotationAdd
BLAST
Domaini1074 – 114572Thyroglobulin type-1 9PROSITE-ProRule annotationAdd
BLAST
Domaini1146 – 121065Thyroglobulin type-1 10PROSITE-ProRule annotationAdd
BLAST
Repeati1456 – 146914Type II1 PublicationAdd
BLAST
Repeati1470 – 148617Type II1 PublicationAdd
BLAST
Repeati1487 – 150317Type II1 PublicationAdd
BLAST
Domaini1511 – 156555Thyroglobulin type-1 11PROSITE-ProRule annotationAdd
BLAST
Repeati1603 – 1723121Type IIIA1 PublicationAdd
BLAST
Repeati1724 – 1892169Type IIIB1 PublicationAdd
BLAST
Repeati1893 – 1995103Type IIIA1 PublicationAdd
BLAST
Repeati1996 – 2129134Type IIIB1 PublicationAdd
BLAST
Repeati2130 – 218758Type IIIA1 PublicationAdd
BLAST

Sequence similaritiesi

Contains 11 thyroglobulin type-1 domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiCOG2272.
GeneTreeiENSGT00680000100015.
HOVERGENiHBG017929.
InParanoidiP01266.
KOiK10809.
OMAiLRSCWCV.
OrthoDBiEOG77M8MP.
PhylomeDBiP01266.
TreeFamiTF351833.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
4.10.800.10. 13 hits.
InterProiIPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019819. Carboxylesterase_B_CS.
IPR016324. Thyroglobulin.
IPR000716. Thyroglobulin_1.
IPR011641. Tyr-kin_ephrin_A/B_rcpt-like.
[Graphical view]
PfamiPF00135. COesterase. 1 hit.
PF07699. GCC2_GCC3. 1 hit.
PF00086. Thyroglobulin_1. 8 hits.
[Graphical view]
PIRSFiPIRSF001831. Thyroglobulin. 1 hit.
SMARTiSM00211. TY. 10 hits.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.
SSF57610. SSF57610. 13 hits.
PROSITEiPS00941. CARBOXYLESTERASE_B_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 9 hits.
PS51162. THYROGLOBULIN_1_2. 11 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P01266-1) [UniParc]FASTAAdd to Basket

Also known as: Major

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALVLEIFTL LASICWVSAN IFEYQVDAQP LRPCELQRET AFLKQADYVP
60 70 80 90 100
QCAEDGSFQT VQCQNDGRSC WCVGANGSEV LGSRQPGRPV ACLSFCQLQK
110 120 130 140 150
QQILLSGYIN STDTSYLPQC QDSGDYAPVQ CDVQQVQCWC VDAEGMEVYG
160 170 180 190 200
TRQLGRPKRC PRSCEIRNRR LLHGVGDKSP PQCSAEGEFM PVQCKFVNTT
210 220 230 240 250
DMMIFDLVHS YNRFPDAFVT FSSFQRRFPE VSGYCHCADS QGRELAETGL
260 270 280 290 300
ELLLDEIYDT IFAGLDLPST FTETTLYRIL QRRFLAVQSV ISGRFRCPTK
310 320 330 340 350
CEVERFTATS FGHPYVPSCR RNGDYQAVQC QTEGPCWCVD AQGKEMHGTR
360 370 380 390 400
QQGEPPSCAE GQSCASERQQ ALSRLYFGTS GYFSQHDLFS SPEKRWASPR
410 420 430 440 450
VARFATSCPP TIKELFVDSG LLRPMVEGQS QQFSVSENLL KEAIRAIFPS
460 470 480 490 500
RGLARLALQF TTNPKRLQQN LFGGKFLVNV GQFNLSGALG TRGTFNFSQF
510 520 530 540 550
FQQLGLASFL NGGRQEDLAK PLSVGLDSNS STGTPEAAKK DGTMNKPTVG
560 570 580 590 600
SFGFEINLQE NQNALKFLAS LLELPEFLLF LQHAISVPED VARDLGDVME
610 620 630 640 650
TVLSSQTCEQ TPERLFVPSC TTEGSYEDVQ CFSGECWCVN SWGKELPGSR
660 670 680 690 700
VRGGQPRCPT DCEKQRARMQ SLMGSQPAGS TLFVPACTSE GHFLPVQCFN
710 720 730 740 750
SECYCVDAEG QAIPGTRSAI GKPKKCPTPC QLQSEQAFLR TVQALLSNSS
760 770 780 790 800
MLPTLSDTYI PQCSTDGQWR QVQCNGPPEQ VFELYQRWEA QNKGQDLTPA
810 820 830 840 850
KLLVKIMSYR EAASGNFSLF IQSLYEAGQQ DVFPVLSQYP SLQDVPLAAL
860 870 880 890 900
EGKRPQPREN ILLEPYLFWQ ILNGQLSQYP GSYSDFSTPL AHFDLRNCWC
910 920 930 940 950
VDEAGQELEG MRSEPSKLPT CPGSCEEAKL RVLQFIRETE EIVSASNSSR
960 970 980 990 1000
FPLGESFLVA KGIRLRNEDL GLPPLFPPRE AFAEQFLRGS DYAIRLAAQS
1010 1020 1030 1040 1050
TLSFYQRRRF SPDDSAGASA LLRSGPYMPQ CDAFGSWEPV QCHAGTGHCW
1060 1070 1080 1090 1100
CVDEKGGFIP GSLTARSLQI PQCPTTCEKS RTSGLLSSWK QARSQENPSP
1110 1120 1130 1140 1150
KDLFVPACLE TGEYARLQAS GAGTWCVDPA SGEELRPGSS SSAQCPSLCN
1160 1170 1180 1190 1200
VLKSGVLSRR VSPGYVPACR AEDGGFSPVQ CDQAQGSCWC VMDSGEEVPG
1210 1220 1230 1240 1250
TRVTGGQPAC ESPRCPLPFN ASEVVGGTIL CETISGPTGS AMQQCQLLCR
1260 1270 1280 1290 1300
QGSWSVFPPG PLICSLESGR WESQLPQPRA CQRPQLWQTI QTQGHFQLQL
1310 1320 1330 1340 1350
PPGKMCSADY ADLLQTFQVF ILDELTARGF CQIQVKTFGT LVSIPVCNNS
1360 1370 1380 1390 1400
SVQVGCLTRE RLGVNVTWKS RLEDIPVASL PDLHDIERAL VGKDLLGRFT
1410 1420 1430 1440 1450
DLIQSGSFQL HLDSKTFPAE TIRFLQGDHF GTSPRTWFGC SEGFYQVLTS
1460 1470 1480 1490 1500
EASQDGLGCV KCPEGSYSQD EECIPCPVGF YQEQAGSLAC VPCPVGRTTI
1510 1520 1530 1540 1550
SAGAFSQTHC VTDCQRNEAG LQCDQNGQYR ASQKDRGSGK AFCVDGEGRR
1560 1570 1580 1590 1600
LPWWETEAPL EDSQCLMMQK FEKVPESKVI FDANAPVAVR SKVPDSEFPV
1610 1620 1630 1640 1650
MQCLTDCTED EACSFFTVST TEPEISCDFY AWTSDNVACM TSDQKRDALG
1660 1670 1680 1690 1700
NSKATSFGSL RCQVKVRSHG QDSPAVYLKK GQGSTTTLQK RFEPTGFQNM
1710 1720 1730 1740 1750
LSGLYNPIVF SASGANLTDA HLFCLLACDR DLCCDGFVLT QVQGGAIICG
1760 1770 1780 1790 1800
LLSSPSVLLC NVKDWMDPSE AWANATCPGV TYDQESHQVI LRLGDQEFIK
1810 1820 1830 1840 1850
SLTPLEGTQD TFTNFQQVYL WKDSDMGSRP ESMGCRKDTV PRPASPTEAG
1860 1870 1880 1890 1900
LTTELFSPVD LNQVIVNGNQ SLSSQKHWLF KHLFSAQQAN LWCLSRCVQE
1910 1920 1930 1940 1950
HSFCQLAEIT ESASLYFTCT LYPEAQVCDD IMESNAQGCR LILPQMPKAL
1960 1970 1980 1990 2000
FRKKVILEDK VKNFYTRLPF QKLMGISIRN KVPMSEKSIS NGFFECERRC
2010 2020 2030 2040 2050
DADPCCTGFG FLNVSQLKGG EVTCLTLNSL GIQMCSEENG GAWRILDCGS
2060 2070 2080 2090 2100
PDIEVHTYPF GWYQKPIAQN NAPSFCPLVV LPSLTEKVSL DSWQSLALSS
2110 2120 2130 2140 2150
VVVDPSIRHF DVAHVSTAAT SNFSAVRDLC LSECSQHEAC LITTLQTQPG
2160 2170 2180 2190 2200
AVRCMFYADT QSCTHSLQGQ NCRLLLREEA THIYRKPGIS LLSYEASVPS
2210 2220 2230 2240 2250
VPISTHGRLL GRSQAIQVGT SWKQVDQFLG VPYAAPPLAE RRFQAPEPLN
2260 2270 2280 2290 2300
WTGSWDASKP RASCWQPGTR TSTSPGVSED CLYLNVFIPQ NVAPNASVLV
2310 2320 2330 2340 2350
FFHNTMDREE SEGWPAIDGS FLAAVGNLIV VTASYRVGVF GFLSSGSGEV
2360 2370 2380 2390 2400
SGNWGLLDQV AALTWVQTHI RGFGGDPRRV SLAADRGGAD VASIHLLTAR
2410 2420 2430 2440 2450
ATNSQLFRRA VLMGGSALSP AAVISHERAQ QQAIALAKEV SCPMSSSQEV
2460 2470 2480 2490 2500
VSCLRQKPAN VLNDAQTKLL AVSGPFHYWG PVIDGHFLRE PPARALKRSL
2510 2520 2530 2540 2550
WVEVDLLIGS SQDDGLINRA KAVKQFEESR GRTSSKTAFY QALQNSLGGE
2560 2570 2580 2590 2600
DSDARVEAAA TWYYSLEHST DDYASFSRAL ENATRDYFII CPIIDMASAW
2610 2620 2630 2640 2650
AKRARGNVFM YHAPENYGHG SLELLADVQF ALGLPFYPAY EGQFSLEEKS
2660 2670 2680 2690 2700
LSLKIMQYFS HFIRSGNPNY PYEFSRKVPT FATPWPDFVP RAGGENYKEF
2710 2720 2730 2740 2750
SELLPNRQGL KKADCSFWSK YISSLKTSAD GAKGGQSAES EEEELTAGSG
2760
LREDLLSLQE PGSKTYSK
Length:2,768
Mass (Da):304,790
Last modified:February 20, 2007 - v5
Checksum:i69A87D935F1BAA72
GO
Isoform 2 (identifier: P01266-2) [UniParc]FASTAAdd to Basket

Also known as: Minor

The sequence of this isoform differs from the canonical sequence as follows:
     1510-1567: CVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLM → L

Show »
Length:2,711
Mass (Da):298,383
Checksum:iEEC6895F22D55EE0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti23 – 253EYQ → GKF in CAA26527. (PubMed:2991855)Curated
Sequence conflicti848 – 8481Missing AA sequence (PubMed:8615697)Curated
Sequence conflicti984 – 9852EQ → DR in CAA29456. (PubMed:3681978)Curated
Sequence conflicti1359 – 13602Missing AA sequence (PubMed:8615697)Curated
Sequence conflicti1717 – 17171L → A AA sequence (PubMed:8615697)Curated
Sequence conflicti1776 – 17761T → S AA sequence (PubMed:8615697)Curated
Sequence conflicti2019 – 20191G → H AA sequence (PubMed:8615697)Curated
Sequence conflicti2287 – 22871F → P AA sequence (PubMed:8615697)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti135 – 1351Q → H.1 Publication
Corresponds to variant rs2069546 [ dbSNP | Ensembl ].
VAR_010212
Natural varianti183 – 1831C → Y in TDH3. 1 Publication
VAR_063034
Natural varianti515 – 5151Q → E.1 Publication
Corresponds to variant rs180222 [ dbSNP | Ensembl ].
VAR_016190
Natural varianti604 – 6041S → D Requires 2 nucleotide substitutions. 3 Publications
Corresponds to variant rs2069547 [ dbSNP | Ensembl ].
VAR_016852
Natural varianti653 – 6531G → D.3 Publications
Corresponds to variant rs2069548 [ dbSNP | Ensembl ].
VAR_016853
Natural varianti734 – 7341S → A Polymorphism associated with AITD3. 3 Publications
Corresponds to variant rs180223 [ dbSNP | Ensembl ].
VAR_010213
Natural varianti777 – 7771P → L.
Corresponds to variant rs3739274 [ dbSNP | Ensembl ].
VAR_049077
Natural varianti815 – 8151G → R.
Corresponds to variant rs16904774 [ dbSNP | Ensembl ].
VAR_049078
Natural varianti830 – 8301Q → E.1 Publication
Corresponds to variant rs2076737 [ dbSNP | Ensembl ].
VAR_010214
Natural varianti870 – 8701Q → H.1 Publication
Corresponds to variant rs2229843 [ dbSNP | Ensembl ].
VAR_002365
Natural varianti985 – 9851Missing.2 Publications
VAR_016854
Natural varianti988 – 9881R → P.
Corresponds to variant rs16893332 [ dbSNP | Ensembl ].
VAR_049079
Natural varianti1028 – 10281M → V Polymorphism associated with AITD3. 2 Publications
Corresponds to variant rs853326 [ dbSNP | Ensembl ].
VAR_010215
Natural varianti1043 – 10431H → Y.2 Publications
VAR_016855
Natural varianti1059 – 10591I → T.2 Publications
VAR_016856
Natural varianti1063 – 10631L → M.
Corresponds to variant rs11992497 [ dbSNP | Ensembl ].
VAR_049080
Natural varianti1222 – 12221S → L.
Corresponds to variant rs12549018 [ dbSNP | Ensembl ].
VAR_049081
Natural varianti1264 – 12641C → R in TDH3; autosomal recessive. 1 Publication
Corresponds to variant rs2076738 [ dbSNP | Ensembl ].
VAR_010216
Natural varianti1312 – 13121D → G.3 Publications
Corresponds to variant rs2069556 [ dbSNP | Ensembl ].
VAR_010217
Natural varianti1437 – 14371W → R.2 Publications
Corresponds to variant rs2069558 [ dbSNP | Ensembl ].
VAR_016857
Natural varianti1463 – 14631P → H.2 Publications
VAR_016858
Natural varianti1740 – 17401T → K.
Corresponds to variant rs16904791 [ dbSNP | Ensembl ].
VAR_049082
Natural varianti1838 – 18381D → N.1 Publication
Corresponds to variant rs2069561 [ dbSNP | Ensembl ].
VAR_010218
Natural varianti1897 – 18971C → Y in TDH3. 1 Publication
VAR_063035
Natural varianti1936 – 19361A → T.2 Publications
Corresponds to variant rs2069562 [ dbSNP | Ensembl ].
VAR_016859
Natural varianti1974 – 19741M → T.
Corresponds to variant rs56230101 [ dbSNP | Ensembl ].
VAR_061173
Natural varianti1979 – 19791R → W Polymorphism associated with AITD3. 1 Publication
VAR_032013
Natural varianti1996 – 19961C → S in TDH3; autosomal recessive. 1 Publication
Corresponds to variant rs2076739 [ dbSNP | Ensembl ].
VAR_010219
Natural varianti1999 – 19991R → W.1 Publication
Corresponds to variant rs2076740 [ dbSNP | Ensembl ].
VAR_010220
Natural varianti2091 – 20911D → E.2 Publications
VAR_016860
Natural varianti2149 – 21491P → L.3 Publications
Corresponds to variant rs2069564 [ dbSNP | Ensembl ].
VAR_016861
Natural varianti2170 – 21701Q → R.3 Publications
Corresponds to variant rs2069565 [ dbSNP | Ensembl ].
VAR_016862
Natural varianti2234 – 22341A → D in TDH3; reduces thyroglobulin synthesis and secretion; promotes thyroglobulin retention within the endoplasmic reticulum. 2 Publications
VAR_063036
Natural varianti2242 – 22421R → H.2 Publications
Corresponds to variant rs2069566 [ dbSNP | Ensembl ].
VAR_016863
Natural varianti2336 – 23361R → Q in TDH3. 1 Publication
VAR_063037
Natural varianti2375 – 23751G → R in TDH3. 1 Publication
VAR_063038
Natural varianti2455 – 24551R → H.
Corresponds to variant rs2272707 [ dbSNP | Ensembl ].
VAR_049083
Natural varianti2469 – 24691L → P.
Corresponds to variant rs2069568 [ dbSNP | Ensembl ].
VAR_049084
Natural varianti2501 – 25011W → R.1 Publication
Corresponds to variant rs2069569 [ dbSNP | Ensembl ].
VAR_010221
Natural varianti2526 – 25261F → L.
Corresponds to variant rs12114109 [ dbSNP | Ensembl ].
VAR_049085
Natural varianti2530 – 25301R → Q.1 Publication
Corresponds to variant rs1133076 [ dbSNP | Ensembl ].
VAR_010222
Natural varianti2616 – 26161N → S.
Corresponds to variant rs10091530 [ dbSNP | Ensembl ].
VAR_049086

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1510 – 156758CVTDC…SQCLM → L in isoform 2. 1 PublicationVSP_012655Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X05615 mRNA. Translation: CAA29104.1.
U93033 mRNA. Translation: AAC51924.1.
AF230667 Genomic DNA. No translation available.
AF235100 Genomic DNA. No translation available.
AF230666 Genomic DNA. No translation available.
AF305872 Genomic DNA. No translation available.
X02154 mRNA. Translation: CAA26089.1.
X06059
, X06060, X06061, X06062, X06063, X06064, X06065, X06066 Genomic DNA. Translation: CAA29454.1.
X06067, X06068 Genomic DNA. Translation: CAA29455.1.
X06069, X06070 Genomic DNA. Translation: CAA29456.1.
X02749 Genomic DNA. Translation: CAA26527.1.
AH008122 Genomic DNA. Translation: AAD51647.1.
AH007064 Genomic DNA. Translation: AAC95473.1.
AF080484
, AF169654, AF169655, AF169656, AF169657, AF169658, AF169659, AF169661, AF169662, AF169663, AF169664, AF080472, AF080473, AF080474, AF080475, AF080476, AF080477, AF080478, AF080479, AF080480, AF080481, AF080482, AF080483 Genomic DNA. Translation: AAD50912.2.
S40807 mRNA. Translation: AAB22685.1.
CCDSiCCDS34944.1. [P01266-1]
PIRiA59110. UIHU.
RefSeqiNP_003226.4. NM_003235.4. [P01266-1]
UniGeneiHs.654591.

Genome annotation databases

EnsembliENST00000220616; ENSP00000220616; ENSG00000042832. [P01266-1]
GeneIDi7038.
KEGGihsa:7038.
UCSCiuc003ytw.3. human. [P01266-1]

Polymorphism databases

DMDMi126302607.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Thyroglobulin entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X05615 mRNA. Translation: CAA29104.1 .
U93033 mRNA. Translation: AAC51924.1 .
AF230667 Genomic DNA. No translation available.
AF235100 Genomic DNA. No translation available.
AF230666 Genomic DNA. No translation available.
AF305872 Genomic DNA. No translation available.
X02154 mRNA. Translation: CAA26089.1 .
X06059
, X06060 , X06061 , X06062 , X06063 , X06064 , X06065 , X06066 Genomic DNA. Translation: CAA29454.1 .
X06067 , X06068 Genomic DNA. Translation: CAA29455.1 .
X06069 , X06070 Genomic DNA. Translation: CAA29456.1 .
X02749 Genomic DNA. Translation: CAA26527.1 .
AH008122 Genomic DNA. Translation: AAD51647.1 .
AH007064 Genomic DNA. Translation: AAC95473.1 .
AF080484
, AF169654 , AF169655 , AF169656 , AF169657 , AF169658 , AF169659 , AF169661 , AF169662 , AF169663 , AF169664 , AF080472 , AF080473 , AF080474 , AF080475 , AF080476 , AF080477 , AF080478 , AF080479 , AF080480 , AF080481 , AF080482 , AF080483 Genomic DNA. Translation: AAD50912.2 .
S40807 mRNA. Translation: AAB22685.1 .
CCDSi CCDS34944.1. [P01266-1 ]
PIRi A59110. UIHU.
RefSeqi NP_003226.4. NM_003235.4. [P01266-1 ]
UniGenei Hs.654591.

3D structure databases

ProteinModelPortali P01266.
SMRi P01266. Positions 2204-2728.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112896. 3 interactions.
IntActi P01266. 2 interactions.

Protein family/group databases

MEROPSi I31.950.

PTM databases

PhosphoSitei P01266.

Polymorphism databases

DMDMi 126302607.

Proteomic databases

PaxDbi P01266.
PRIDEi P01266.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000220616 ; ENSP00000220616 ; ENSG00000042832 . [P01266-1 ]
GeneIDi 7038.
KEGGi hsa:7038.
UCSCi uc003ytw.3. human. [P01266-1 ]

Organism-specific databases

CTDi 7038.
GeneCardsi GC08P133879.
H-InvDB HIX0034371.
HGNCi HGNC:11764. TG.
HPAi CAB000077.
CAB056155.
HPA002740.
MIMi 188450. gene.
274700. phenotype.
608175. phenotype.
neXtProti NX_P01266.
Orphaneti 95716. Familial thyroid dyshormonogenesis.
PharmGKBi PA36479.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2272.
GeneTreei ENSGT00680000100015.
HOVERGENi HBG017929.
InParanoidi P01266.
KOi K10809.
OMAi LRSCWCV.
OrthoDBi EOG77M8MP.
PhylomeDBi P01266.
TreeFami TF351833.

Enzyme and pathway databases

BioCyci MetaCyc:ENSG00000042832-MONOMER.

Miscellaneous databases

ChiTaRSi TG. human.
GeneWikii Thyroglobulin.
GenomeRNAii 7038.
NextBioi 27497.
PROi P01266.
SOURCEi Search...

Gene expression databases

Bgeei P01266.
ExpressionAtlasi P01266. baseline and differential.
Genevestigatori P01266.

Family and domain databases

Gene3Di 3.40.50.1820. 1 hit.
4.10.800.10. 13 hits.
InterProi IPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019819. Carboxylesterase_B_CS.
IPR016324. Thyroglobulin.
IPR000716. Thyroglobulin_1.
IPR011641. Tyr-kin_ephrin_A/B_rcpt-like.
[Graphical view ]
Pfami PF00135. COesterase. 1 hit.
PF07699. GCC2_GCC3. 1 hit.
PF00086. Thyroglobulin_1. 8 hits.
[Graphical view ]
PIRSFi PIRSF001831. Thyroglobulin. 1 hit.
SMARTi SM00211. TY. 10 hits.
[Graphical view ]
SUPFAMi SSF53474. SSF53474. 1 hit.
SSF57610. SSF57610. 13 hits.
PROSITEi PS00941. CARBOXYLESTERASE_B_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 9 hits.
PS51162. THYROGLOBULIN_1_2. 11 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Primary structure of human thyroglobulin deduced from the sequence of its 8448-base complementary DNA."
    Malthiery Y., Lissitzky S.
    Eur. J. Biochem. 165:491-498(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ASP-604; ASP-653; GLN-985 DEL; TYR-1043; THR-1059; GLY-1312; ARG-1437; HIS-1463; THR-1936; GLU-2091; LEU-2149; ARG-2170 AND HIS-2242.
  2. "The revised 8307 base pair coding sequence of human thyroglobulin transiently expressed in eukaryotic cells."
    van de Graaf S.A.R., Pauws E., de Vijlder J.J.M., Ris-Stalpers C.
    Eur. J. Endocrinol. 136:508-515(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-1312.
    Tissue: Thyroid.
  3. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-515.
  4. "Sequence of the 5'-end quarter of the human-thyroglobulin messenger ribonucleic acid and of its deduced amino-acid sequence."
    Malthiery Y., Lissitzky S.
    Eur. J. Biochem. 147:53-58(1985) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-730, VARIANTS ASP-604 AND ASP-653.
  5. "Structural organization of the 5' region of the thyroglobulin gene. Evidence for intron loss and 'exonization' during evolution."
    Parma J., Christophe D., Pohl V., Vassart G.
    J. Mol. Biol. 196:769-779(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-415; 640-737 AND 880-1000, VARIANT ALA-734.
  6. "An unusually long poly(purine)-poly(pyrimidine) sequence is located upstream from the human thyroglobulin gene."
    Christophe D., Cabrer B., Bacolla A., Targovnik H.M., Pohl V., Vassart G.
    Nucleic Acids Res. 13:5127-5144(1985) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-25.
  7. "Genomic organization of the 5' region of the human thyroglobulin gene."
    Moya C.M., Mendive F.M., Rivolta C.M., Vassart G., Targovnik H.M.
    Eur. J. Endocrinol. 143:789-798(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1002-1566 (ISOFORM 1), VARIANT GLY-1312.
  8. "Genomic organization of the 3' region of the human thyroglobulin gene."
    Mendive F.M., Rivolta C.M., Vassart G., Targovnik H.M.
    Thyroid 9:903-912(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1645-2768, VARIANTS LEU-2149 AND ARG-2170.
  9. "Identification of a minor Tg mRNA transcript in RNA from normal and goitrous thyroids."
    Targovnik H.M., Cochaux P., Corach D., Vassart G.
    Mol. Cell. Endocrinol. 84:R23-R26(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1504-1602 (ISOFORM 2).
  10. "Hormone synthesis in human thyroglobulin: possible cleavage of the polypeptide chain at the tyrosine donor site."
    Marriq C., Lejeune P.J., Venot N., Vinet L.
    FEBS Lett. 242:414-418(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL PROTEIN SEQUENCE.
  11. "Preferential sites of proteolytic cleavage of bovine, human and rat thyroglobulin. The use of limited proteolysis to detect solvent-exposed regions of the primary structure."
    Gentile F., Salvatore G.
    Eur. J. Biochem. 218:603-621(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL PROTEIN SEQUENCE.
  12. "Characterization of hormonogenic sites in an N-terminal, cyanogen bromide fragment of human thyroglobulin."
    Xiao S., Pollock H.G., Taurog A., Rawitch A.B.
    Arch. Biochem. Biophys. 320:96-105(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL PROTEIN SEQUENCE.
  13. "Glycosylation in human thyroglobulin: location of the N-linked oligosaccharide units and comparison with bovine thyroglobulin."
    Yang S.X., Pollock H.G., Rawitch A.B.
    Arch. Biochem. Biophys. 327:61-70(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL PROTEIN SEQUENCE, GLYCOSYLATION AT ASN-76; ASN-198; ASN-484; ASN-529; ASN-748; ASN-816; ASN-947; ASN-1220; ASN-1348; ASN-1349; ASN-1365; ASN-1716; ASN-1774; ASN-2013; ASN-2250; ASN-2295 AND ASN-2582, ABSENCE OF GLYCOSYLATION AT ASN-110; ASN-496; ASN-1869 AND ASN-2122.
  14. "Characterization of the type-1 repeat from thyroglobulin, a cysteine-rich module found in proteins from different families."
    Molina F., Bouanani M., Pau B., Granier C.
    Eur. J. Biochem. 240:125-133(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PRESENCE OF A 11TH TYROGLOBULIN TYPE-1 REPEAT.
  15. "Consensus sequences for early iodination and hormonogenesis in human thyroglobulin."
    Lamas L., Anderson P.C., Fox J.W., Dunn J.T.
    J. Biol. Chem. 264:13541-13545(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: IODINATION AT TYR-24; TYR-1310; TYR-2573; TYR-2587 AND TYR-2766.
  16. "Sulfated tyrosines of thyroglobulin are involved in thyroid hormone synthesis."
    Nlend M.-C., Cauvi D., Venot N., Chabaud O.
    Biochem. Biophys. Res. Commun. 262:193-197(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: SULFATION.
  17. "The hormonogenic tyrosine 5 of porcine thyroglobulin is sulfated."
    Venot N., Nlend M.-C., Cauvi D., Chabaud O.
    Biochem. Biophys. Res. Commun. 298:193-197(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SULFATION AT TYR-24.
  18. "A single chondroitin 6-sulfate oligosaccharide unit at Ser-2730 of human thyroglobulin enhances hormone formation and limits proteolytic accessibility at the carboxyl terminus. Potential insights into thyroid homeostasis and autoimmunity."
    Conte M., Arcaro A., D'Angelo D., Gnata A., Mamone G., Ferranti P., Formisano S., Gentile F.
    J. Biol. Chem. 281:22200-22211(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT SER-2749.
  19. "Thyroglobulin gene point mutation associated with non-endemic simple goitre."
    Corral J., Martin C., Perez R., Sanchez I., Mories M.T., San Millan J.L., Miralles J.M., Gonzalez-Sarmiento R.
    Lancet 341:462-464(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT HIS-870.
  20. "Two novel cysteine substitutions (C1263R and C1995S) of thyroglobulin cause a defect in intracellular transport of thyroglobulin in patients with congenital goiter and the variant type of adenomatous goiter."
    Hishinuma A., Takamatsu J., Ohyama Y., Yokozawa T., Kanno Y., Kuma K., Yoshida S., Matsuura N., Ieiri T.
    J. Clin. Endocrinol. Metab. 84:1438-1444(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS TDH3 ARG-1264 AND SER-1996, VARIANTS HIS-135; ASP-604; ASP-653; ALA-734; GLU-830; GLN-985 DEL; VAL-1028; TYR-1043; THR-1059; ARG-1437; HIS-1463; ASN-1838; THR-1936; TRP-1999; GLU-2091; LEU-2149; ARG-2170; HIS-2242; ARG-2501 AND GLN-2530.
  21. "Amino acid substitutions in the thyroglobulin gene are associated with susceptibility to human and murine autoimmune thyroid disease."
    Ban Y., Greenberg D.A., Concepcion E., Skrabanek L., Villanueva R., Tomer Y.
    Proc. Natl. Acad. Sci. U.S.A. 100:15119-15124(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ALA-734; VAL-1028 AND TRP-1979, INVOLVEMENT IN AITD3.
  22. "A novel compound heterozygous mutation in the thyroglobulin gene resulting in congenital goitrous hypothyroidism with high serum triiodothyronine levels."
    Kitanaka S., Takeda A., Sato U., Miki Y., Hishinuma A., Ieiri T., Igarashi T.
    J. Hum. Genet. 51:379-382(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS TDH3 TYR-1897 AND GLN-2336.
  23. Cited for: VARIANTS TDH3 TYR-183 AND ASP-2234.
  24. "Thyroglobulin gene mutations producing defective intracellular transport of thyroglobulin are associated with increased thyroidal type 2 iodothyronine deiodinase activity."
    Kanou Y., Hishinuma A., Tsunekawa K., Seki K., Mizuno Y., Fujisawa H., Imai T., Miura Y., Nagasaka T., Yamada C., Ieiri T., Murakami M., Murata Y.
    J. Clin. Endocrinol. Metab. 92:1451-1457(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT TDH3 ARG-2375.
  25. "The p.A2215D thyroglobulin gene mutation leads to deficient synthesis and secretion of the mutated protein and congenital hypothyroidism with wide phenotype variation."
    Pardo V., Vono-Toniolo J., Rubio I.G., Knobel M., Possato R.F., Targovnik H.M., Kopp P., Medeiros-Neto G.
    J. Clin. Endocrinol. Metab. 94:2938-2944(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT TDH3 ASP-2234, CHARACTERIZATION OF VARIANT TDH3 ASP-2234.

Entry informationi

Entry nameiTHYG_HUMAN
AccessioniPrimary (citable) accession number: P01266
Secondary accession number(s): O15274
, O43899, Q15593, Q15948, Q9NYR1, Q9NYR2, Q9UMZ0, Q9UNY3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: February 20, 2007
Last modified: October 29, 2014
This is version 168 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3