Reviewed,
UniProtKB/Swiss-Prot P01266 (THYG_HUMAN)
Last modified
June 16, 2009.
Version 113.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Thyroglobulin Short name=Tg | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2768 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). |
| Subunit structure | Homodimer. |
| Subcellular location | |
| Tissue specificity | Thyroid gland specific. |
| Post-translational modification | Sulfated. |
| Involvement in disease | Defects in TG are a cause of some forms of goiter [MIM:188450]. Goiter is an enlargement of the thyroid gland. This is sometimes linked to hypothyroidism. Variations in TG are associated with susceptibility to autoimmune thyroid disease type 3 (AITD3) [MIM:608175]. AITDs including Graves disease (GD) and Hashimoto thyroiditis (HT), are among the most common human autoimmune diseases. They are complex diseases, which are caused by an interaction between susceptibility genes and nongenetic factors, such as infection. Ref.20 |
| Sequence similarities | Belongs to the type-B carboxylesterase/lipase family. Contains 11 thyroglobulin type-1 domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Thyroid hormones biosynthesis |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Repeat Signal |
| Molecular function | Hormone Thyroid hormone |
| PTM | Disulfide bond Glycoprotein Iodination Sulfation |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | hormone biosynthetic process Inferred from electronic annotation. Source: UniProtKB-KW signal transductionNon-traceable author statement. Source: ProtInc thyroid hormone generationInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | extracellular region Non-traceable author statement. Source: UniProtKB |
| Molecular function | hormone activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P01266-1) Also known as: Major; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P01266-2) Also known as: Minor; The sequence of this isoform differs from the canonical sequence as follows: 1510-1567: CVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLM → L |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | |||||||||
| Chain | 20 – 2768 | 2749 | Thyroglobulin | PRO_0000008636 | |||||||
Regions | |||||||||||
| Domain | 31 – 92 | 62 | Thyroglobulin type-1 1 | ||||||||
| Domain | 93 – 160 | 68 | Thyroglobulin type-1 2 | ||||||||
| Domain | 161 – 297 | 137 | Thyroglobulin type-1 3 | ||||||||
| Domain | 298 – 358 | 61 | Thyroglobulin type-1 4 | ||||||||
| Domain | 605 – 658 | 54 | Thyroglobulin type-1 5 | ||||||||
| Domain | 659 – 726 | 68 | Thyroglobulin type-1 6 | ||||||||
| Domain | 727 – 921 | 195 | Thyroglobulin type-1 7 | ||||||||
| Domain | 922 – 1073 | 152 | Thyroglobulin type-1 8 | ||||||||
| Domain | 1074 – 1145 | 72 | Thyroglobulin type-1 9 | ||||||||
| Domain | 1146 – 1210 | 65 | Thyroglobulin type-1 10 | ||||||||
| Repeat | 1456 – 1469 | 14 | Type II | ||||||||
| Repeat | 1470 – 1486 | 17 | Type II | ||||||||
| Repeat | 1487 – 1503 | 17 | Type II | ||||||||
| Domain | 1511 – 1565 | 55 | Thyroglobulin type-1 11 | ||||||||
| Repeat | 1603 – 1723 | 121 | Type IIIA | ||||||||
| Repeat | 1724 – 1892 | 169 | Type IIIB | ||||||||
| Repeat | 1893 – 1995 | 103 | Type IIIA | ||||||||
| Repeat | 1996 – 2129 | 134 | Type IIIB | ||||||||
| Repeat | 2130 – 2187 | 58 | Type IIIA | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 24 | 1 | Sulfotyrosine | ||||||||
| Modified residue | 24 | 1 | Thyroxine | ||||||||
| Modified residue | 1310 | 1 | Thyroxine | ||||||||
| Modified residue | 2573 | 1 | Thyroxine | ||||||||
| Modified residue | 2587 | 1 | Thyroxine | ||||||||
| Modified residue | 2766 | 1 | Triiodothyronine | ||||||||
| Glycosylation | 76 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 110 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 198 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 484 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 496 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 529 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 748 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 816 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 947 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1220 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1348 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1349 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1365 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1716 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1774 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1869 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2013 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2122 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2250 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2295 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2582 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 34 ↔ 52 | By similarity | |||||||||
| Disulfide bond | 63 ↔ 70 | By similarity | |||||||||
| Disulfide bond | 72 ↔ 92 | By similarity | |||||||||
| Disulfide bond | 96 ↔ 120 | By similarity | |||||||||
| Disulfide bond | 131 ↔ 138 | By similarity | |||||||||
| Disulfide bond | 140 ↔ 160 | By similarity | |||||||||
| Disulfide bond | 164 ↔ 183 | By similarity | |||||||||
| Disulfide bond | 194 ↔ 235 | By similarity | |||||||||
| Disulfide bond | 301 ↔ 319 | By similarity | |||||||||
| Disulfide bond | 330 ↔ 336 | By similarity | |||||||||
| Disulfide bond | 338 ↔ 358 | By similarity | |||||||||
| Disulfide bond | 608 ↔ 620 | By similarity | |||||||||
| Disulfide bond | 631 ↔ 636 | By similarity | |||||||||
| Disulfide bond | 638 ↔ 658 | By similarity | |||||||||
| Disulfide bond | 662 ↔ 687 | By similarity | |||||||||
| Disulfide bond | 698 ↔ 703 | By similarity | |||||||||
| Disulfide bond | 705 ↔ 726 | By similarity | |||||||||
| Disulfide bond | 730 ↔ 763 | By similarity | |||||||||
| Disulfide bond | 774 ↔ 898 | By similarity | |||||||||
| Disulfide bond | 900 ↔ 921 | By similarity | |||||||||
| Disulfide bond | 1042 ↔ 1049 | By similarity | |||||||||
| Disulfide bond | 1051 ↔ 1073 | By similarity | |||||||||
| Disulfide bond | 1077 ↔ 1108 | By similarity | |||||||||
| Disulfide bond | 1126 ↔ 1145 | By similarity | |||||||||
| Disulfide bond | 1149 ↔ 1169 | By similarity | |||||||||
| Disulfide bond | 1181 ↔ 1188 | By similarity | |||||||||
| Disulfide bond | 1190 ↔ 1210 | By similarity | |||||||||
| Disulfide bond | 1514 ↔ 1523 | By similarity | |||||||||
| Disulfide bond | 1543 ↔ 1565 | By similarity | |||||||||
| Disulfide bond | 2264 ↔ 2281 | Potential | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1510 – 1567 | 58 | CVTDC…SQCLM → L in isoform 2. | VSP_012655 | |||||||
| Natural variant | 135 | 1 | Q → H: dbSNP rs2069546. Ref.19 | VAR_010212 | |||||||
| Natural variant | 515 | 1 | Q → E: dbSNP rs180222. Ref.3 | VAR_016190 | |||||||
| Natural variant | 604 | 1 | S → D Requires 2 nucleotide substitutions. Ref.19 Ref.1 Ref.4 | VAR_016852 | |||||||
| Natural variant | 653 | 1 | G → D: dbSNP rs2069548. Ref.19 Ref.1 Ref.4 | VAR_016853 | |||||||
| Natural variant | 734 | 1 | S → A Polymorphism associated with AITD3. dbSNP rs180223. Ref.20 Ref.19 Ref.5 | VAR_010213 | |||||||
| Natural variant | 777 | 1 | P → L: dbSNP rs3739274. | VAR_049077 | |||||||
| Natural variant | 815 | 1 | G → R: dbSNP rs16904774. | VAR_049078 | |||||||
| Natural variant | 830 | 1 | Q → E: dbSNP rs2076737. Ref.19 | VAR_010214 | |||||||
| Natural variant | 870 | 1 | Q → H in goiter; simple. dbSNP rs2229843. Ref.18 | VAR_002365 | |||||||
| Natural variant | 985 | 1 | Missing Ref.19 Ref.1 | VAR_016854 | |||||||
| Natural variant | 988 | 1 | R → P: dbSNP rs16893332. | VAR_049079 | |||||||
| Natural variant | 1028 | 1 | M → V Polymorphism associated with AITD3. dbSNP rs853326. Ref.20 Ref.19 | VAR_010215 | |||||||
| Natural variant | 1043 | 1 | H → Y Ref.19 Ref.1 | VAR_016855 | |||||||
| Natural variant | 1059 | 1 | I → T Ref.19 Ref.1 | VAR_016856 | |||||||
| Natural variant | 1063 | 1 | L → M: dbSNP rs11992497. | VAR_049080 | |||||||
| Natural variant | 1222 | 1 | S → L: dbSNP rs12549018. | VAR_049081 | |||||||
| Natural variant | 1264 | 1 | C → R in goiter; autosomal recessive. dbSNP rs2076738. Ref.19 | VAR_010216 | |||||||
| Natural variant | 1312 | 1 | D → G: dbSNP rs2069556. Ref.1 Ref.2 Ref.7 | VAR_010217 | |||||||
| Natural variant | 1437 | 1 | W → R: dbSNP rs2069558. Ref.19 Ref.1 | VAR_016857 | |||||||
| Natural variant | 1463 | 1 | P → H Ref.19 Ref.1 | VAR_016858 | |||||||
| Natural variant | 1740 | 1 | T → K: dbSNP rs16904791. | VAR_049082 | |||||||
| Natural variant | 1838 | 1 | D → N: dbSNP rs2069561. Ref.19 | VAR_010218 | |||||||
| Natural variant | 1936 | 1 | A → T: dbSNP rs2069562. Ref.19 Ref.1 | VAR_016859 | |||||||
| Natural variant | 1979 | 1 | R → W Polymorphism associated with AITD3. Ref.20 | VAR_032013 | |||||||
| Natural variant | 1996 | 1 | C → S in goiter; autosomal recessive. Ref.19 | VAR_010219 | |||||||
| Natural variant | 1999 | 1 | R → W: dbSNP rs2076740. Ref.19 | VAR_010220 | |||||||
| Natural variant | 2091 | 1 | D → E Ref.19 Ref.1 | VAR_016860 | |||||||
| Natural variant | 2149 | 1 | P → L Ref.19 Ref.1 Ref.8 | VAR_016861 | |||||||
| Natural variant | 2170 | 1 | Q → R: dbSNP rs2069565. Ref.19 Ref.1 Ref.8 | VAR_016862 | |||||||
| Natural variant | 2242 | 1 | R → H: dbSNP rs2069566. Ref.19 Ref.1 | VAR_016863 | |||||||
| Natural variant | 2455 | 1 | R → H: dbSNP rs2272707. | VAR_049083 | |||||||
| Natural variant | 2469 | 1 | L → P: dbSNP rs2069568. | VAR_049084 | |||||||
| Natural variant | 2501 | 1 | W → R: dbSNP rs2069569. Ref.19 | VAR_010221 | |||||||
| Natural variant | 2526 | 1 | F → L: dbSNP rs12114109. | VAR_049085 | |||||||
| Natural variant | 2530 | 1 | R → Q: dbSNP rs1133076. Ref.19 | VAR_010222 | |||||||
| Natural variant | 2616 | 1 | N → S: dbSNP rs10091530. | VAR_049086 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 23 – 25 | 3 | EYQ → GKF Ref.6 | ||||||||
| Sequence conflict | 848 | 1 | Missing AA sequence Ref.13 | ||||||||
| Sequence conflict | 984 – 985 | 2 | EQ → DR Ref.5 | ||||||||
| Sequence conflict | 1359 – 1360 | 2 | Missing AA sequence Ref.13 | ||||||||
| Sequence conflict | 1717 | 1 | L → A AA sequence Ref.13 | ||||||||
| Sequence conflict | 1776 | 1 | T → S AA sequence Ref.13 | ||||||||
| Sequence conflict | 2019 | 1 | G → H AA sequence Ref.13 | ||||||||
| Sequence conflict | 2287 | 1 | F → P AA sequence Ref.13 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Primary structure of human thyroglobulin deduced from the sequence of its 8448-base complementary DNA." Malthiery Y., Lissitzky S. Eur. J. Biochem. 165:491-498(1987) [PubMed: 3595599] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ASP-604; ASP-653; GLN-985 DEL; TYR-1043; THR-1059; GLY-1312; ARG-1437; HIS-1463; THR-1936; GLU-2091; LEU-2149; ARG-2170 AND HIS-2242. |
| [2] | "The revised 8307 base pair coding sequence of human thyroglobulin transiently expressed in eukaryotic cells." van de Graaf S.A.R., Pauws E., de Vijlder J.J.M., Ris-Stalpers C. Eur. J. Endocrinol. 136:508-515(1997) [PubMed: 9186272] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-1312. Tissue: Thyroid. |
| [3] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-515. |
| [4] | "Sequence of the 5'-end quarter of the human-thyroglobulin messenger ribonucleic acid and of its deduced amino-acid sequence." Malthiery Y., Lissitzky S. Eur. J. Biochem. 147:53-58(1985) [PubMed: 3971976] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-730, VARIANTS ASP-604 AND ASP-653. |
| [5] | "Structural organization of the 5' region of the thyroglobulin gene. Evidence for intron loss and 'exonization' during evolution." Parma J., Christophe D., Pohl V., Vassart G. J. Mol. Biol. 196:769-779(1987) [PubMed: 3681978] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-415; 640-737 AND 880-1000, VARIANT ALA-734. |
| [6] | "An unusually long poly(purine)-poly(pyrimidine) sequence is located upstream from the human thyroglobulin gene." Christophe D., Cabrer B., Bacolla A., Targovnik H.M., Pohl V., Vassart G. Nucleic Acids Res. 13:5127-5144(1985) [PubMed: 2991855] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-25. |
| [7] | "Genomic organization of the 5' region of the human thyroglobulin gene." Moya C.M., Mendive F.M., Rivolta C.M., Vassart G., Targovnik H.M. Eur. J. Endocrinol. 143:789-798(2000) [PubMed: 11124863] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1002-1566 (ISOFORM 1), VARIANT GLY-1312. |
| [8] | "Genomic organization of the 3' region of the human thyroglobulin gene." Mendive F.M., Rivolta C.M., Vassart G., Targovnik H.M. Thyroid 9:903-912(1999) [PubMed: 10524569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1645-2768, VARIANTS LEU-2149 AND ARG-2170. |
| [9] | "Identification of a minor Tg mRNA transcript in RNA from normal and goitrous thyroids." Targovnik H.M., Cochaux P., Corach D., Vassart G. Mol. Cell. Endocrinol. 84:R23-R26(1992) [PubMed: 1639210] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1504-1602 (ISOFORM 2). |
| [10] | "Hormone synthesis in human thyroglobulin: possible cleavage of the polypeptide chain at the tyrosine donor site." Marriq C., Lejeune P.J., Venot N., Vinet L. FEBS Lett. 242:414-418(1989) [PubMed: 2914619] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| [11] | "Preferential sites of proteolytic cleavage of bovine, human and rat thyroglobulin. The use of limited proteolysis to detect solvent-exposed regions of the primary structure." Gentile F., Salvatore G. Eur. J. Biochem. 218:603-621(1993) [PubMed: 8269951] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| [12] | "Characterization of hormonogenic sites in an N-terminal, cyanogen bromide fragment of human thyroglobulin." Xiao S., Pollock H.G., Taurog A., Rawitch A.B. Arch. Biochem. Biophys. 320:96-105(1995) [PubMed: 7793989] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| [13] | "Glycosylation in human thyroglobulin: location of the N-linked oligosaccharide units and comparison with bovine thyroglobulin." Yang S.X., Pollock H.G., Rawitch A.B. Arch. Biochem. Biophys. 327:61-70(1996) [PubMed: 8615697] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| [14] | "Characterization of the type-1 repeat from thyroglobulin, a cysteine-rich module found in proteins from different families." Molina F., Bouanani M., Pau B., Granier C. Eur. J. Biochem. 240:125-133(1996) [PubMed: 8797845] [Abstract] Cited for: PRESENCE OF A 11TH TYROGLOBULIN TYPE-1 REPEAT. |
| [15] | "Consensus sequences for early iodination and hormonogenesis in human thyroglobulin." Lamas L., Anderson P.C., Fox J.W., Dunn J.T. J. Biol. Chem. 264:13541-13545(1989) [PubMed: 2760035] [Abstract] Cited for: IODINATION AT TYR-24; TYR-1310; TYR-2573; TYR-2587 AND TYR-2766. |
| [16] | "Sulfated tyrosines of thyroglobulin are involved in thyroid hormone synthesis." Nlend M.-C., Cauvi D., Venot N., Chabaud O. Biochem. Biophys. Res. Commun. 262:193-197(1999) [PubMed: 10448091] [Abstract] Cited for: SULFATION. |
| [17] | "The hormonogenic tyrosine 5 of porcine thyroglobulin is sulfated." Venot N., Nlend M.-C., Cauvi D., Chabaud O. Biochem. Biophys. Res. Commun. 298:193-197(2002) [PubMed: 12387814] [Abstract] Cited for: SULFATION AT TYR-24. |
| [18] | "Thyroglobulin gene point mutation associated with non-endemic simple goitre." Corral J., Martin C., Perez R., Sanchez I., Mories M.T., San Millan J.L., Miralles J.M., Gonzalez-Sarmiento R. Lancet 341:462-464(1993) [PubMed: 8094490] [Abstract] Cited for: VARIANT GOITER HIS-870. |
| [19] | "Two novel cysteine substitutions (C1263R and C1995S) of thyroglobulin cause a defect in intracellular transport of thyroglobulin in patients with congenital goiter and the variant type of adenomatous goiter." Hishinuma A., Takamatsu J., Ohyama Y., Yokozawa T., Kanno Y., Kuma K., Yoshida S., Matsuura N., Ieiri T. J. Clin. Endocrinol. Metab. 84:1438-1444(1999) [PubMed: 10199792] [Abstract] Cited for: VARIANTS GOITER ARG-1264 AND SER-1996, VARIANTS HIS-135; ASP-604; ASP-653; ALA-734; GLU-830; GLN-985 DEL; VAL-1028; TYR-1043; THR-1059; ARG-1437; HIS-1463; ASN-1838; THR-1936; TRP-1999; GLU-2091; LEU-2149; ARG-2170; HIS-2242; ARG-2501 AND GLN-2530. |
| [20] | "Amino acid substitutions in the thyroglobulin gene are associated with susceptibility to human and murine autoimmune thyroid disease." Ban Y., Greenberg D.A., Concepcion E., Skrabanek L., Villanueva R., Tomer Y. Proc. Natl. Acad. Sci. U.S.A. 100:15119-15124(2003) [PubMed: 14657345] [Abstract] Cited for: VARIANTS ALA-734; VAL-1028 AND TRP-1979, INVOLVEMENT IN AITD3. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| X05615 mRNA. Translation: CAA29104.1. U93033 mRNA. Translation: AAC51924.1. AF230667 Genomic DNA. No translation available. AF235100 Genomic DNA. No translation available. AF230666 Genomic DNA. No translation available. AF305872 Genomic DNA. No translation available. X02154 mRNA. Translation: CAA26089.1. X06059 X06066 Genomic DNA. Translation: CAA29454.1. X06067, X06068 Genomic DNA. Translation: CAA29455.1. X06069, X06070 Genomic DNA. Translation: CAA29456.1. X02749 Genomic DNA. Translation: CAA26527.1. AF170489 AF170488 Genomic DNA. Translation: AAD51647.1. AF105687 AF105686 Genomic DNA. Translation: AAC95473.1. AF080484 AF080483 Genomic DNA. Translation: AAD50912.2. S40807 mRNA. Translation: AAB22685.1. | |
| IPI | IPI00306129. IPI00549199. |
| PIR | UIHU. A59110. |
| RefSeq | NP_003226.4. |
| UniGene | Hs.654591 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1N5M based on UniProtKB P21836. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | I31.950. S09.978. |
PTM databases | |
| PhosphoSite | P01266. |
Proteomic databases | |
| PRIDE | P01266. |
Genome annotation databases | |
| Ensembl | ENSG00000042832. Homo sapiens. [Contig view] |
| GeneID | 7038. |
| KEGG | hsa:7038. |
| NMPDR | fig|9606.3.peg.30756. |
Organism-specific databases | |
| GeneCards | GC08P133948. |
| H-InvDB | HIX0034371. |
| HGNC | HGNC:11764. TG. |
| HPA | CAB000077. HPA002740. |
| MIM | 188450. gene+phenotype. 608175. phenotype. |
| PharmGKB | PA28623. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | P01266. |
| OMA | P01266. ARLALQF. |
Gene expression databases | |
| ArrayExpress | P01266. |
| Bgee | P01266. |
Family and domain databases | |
| InterPro | IPR002018. CarbesteraseB. IPR019819. Carboxylesterase_B_CS. IPR011641. GCC2_GCC3. IPR016324. Thyroglobulin. IPR000716. Thyroglobulin_1. [Graphical view] |
| Gene3D | G3DSA:4.10.800.10. Thyroglobulin_1. 7 hits. |
| PANTHER | PTHR11559. CarbesteraseB. 1 hit. |
| Pfam | PF00135. COesterase. 1 hit. PF07699. GCC2_GCC3. 1 hit. PF00086. Thyroglobulin_1. 9 hits. [Graphical view] |
| PIRSF | PIRSF001831. Thyroglobulin. 1 hit. |
| SMART | SM00211. TY. 10 hits. [Graphical view] |
| PROSITE | PS00941. CARBOXYLESTERASE_B_2. 1 hit. PS00484. THYROGLOBULIN_1_1. 9 hits. PS51162. THYROGLOBULIN_1_2. 11 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 27497. |
| SOURCE | Search... |
Entry information
| Entry name | THYG_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P01266 Secondary accession number(s): O15274 Q9UNY3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |
| Recent format changes Overview of recent format changes |

Clusters with


