Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P01222 (TSHB_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 135. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Thyrotropin subunit beta
Alternative name(s):
Thyroid-stimulating hormone subunit beta
Short name=TSH-B
Short name=TSH-beta
Thyrotropin beta chain
INN=Thyrotropin alfa
Gene names
Name:TSHB
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length138 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Indispensable for the control of thyroid structure and metabolism.

Subunit structure

Heterodimer of a common alpha chain and a unique beta chain which confers biological specificity to thyrotropin, lutropin, follitropin and gonadotropin.

Subcellular location

Secreted.

Pharmaceutical use

Available under the name Thyrogen (Genzyme). Used in combination with other tests to detect recurring or leftover thyroid cancer cells in patients with a history of certain types of thyroid cancer.

Sequence similarities

Belongs to the glycoprotein hormones subunit beta family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P01222-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P01222-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTR → MLSFLFFPQ
Note: Major isoform in peripheral blood leukocytes and thyroid, may form heterodimers with isoform 1.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2020 Ref.9
Chain21 – 132112Thyrotropin subunit beta
PRO_0000011746
Propeptide133 – 1386
PRO_0000011747

Amino acid modifications

Glycosylation431N-linked (GlcNAc...)
Disulfide bond22 ↔ 72 By similarity
Disulfide bond36 ↔ 87 By similarity
Disulfide bond39 ↔ 125 By similarity
Disulfide bond47 ↔ 103 By similarity
Disulfide bond51 ↔ 105 By similarity
Disulfide bond108 ↔ 115 By similarity

Natural variations

Alternative sequence1 – 5454MTALF…YCMTR → MLSFLFFPQ in isoform 2.
VSP_053387
Natural variant141T → A. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.7
Corresponds to variant rs10776792 [ dbSNP | Ensembl ].
VAR_054769

Experimental info

Sequence conflict461I → M in AAB30828. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 2, 2010. Version 2.
Checksum: 6A367538D8393DB7

FASTA13815,639
        10         20         30         40         50         60 
MTALFLMSML FGLTCGQAMS FCIPTEYTMH IERRECAYCL TINTTICAGY CMTRDINGKL 

        70         80         90        100        110        120 
FLPKYALSQD VCTYRDFIYR TVEIPGCPLH VAPYFSYPVA LSCKCGKCNT DYSDCIHEAI 

       130 
KTNYCTKPQK SYLVGFSV 

« Hide

Isoform 2 [UniParc].

Checksum: E1989F2A0A00126E
Show »

FASTA9310,624

References

« Hide 'large scale' references
[1]"Molecular cloning of the human thyrotropin-beta subunit gene."
Hayashizaki Y., Miyai K., Kato K., Matsubara K.
FEBS Lett. 188:394-400(1985) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-14.
[2]"The human thyrotropin beta-subunit gene differs in 5' structure from murine TSH-beta genes."
Guidon P.T. Jr., Whitfield G.K., Porti D., Kourides I.A.
DNA 7:691-699(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-14.
[3]"The structure of the human thyrotropin beta-subunit gene."
Tatsumi K., Hayashizaki Y., Hiraoka Y., Miyai K., Matsubara K.
Gene 73:489-497(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-14.
[4]"Isolation and characterization of the human thyrotropin beta-subunit gene. Differences in gene structure and promoter function from murine species."
Wondisford F.E., Radovick S., Moates J.M., Usala S.J., Weintraub B.D.
J. Biol. Chem. 263:12538-12542(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-14.
[5]"Structure and regulation of human thyroid-stimulating hormone (TSH) gene."
Miyoshi I., Kasai N., Hayashizaki Y.
Nippon Rinsho 52:940-947(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-14.
[6]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-14.
[8]"A novel thyroid stimulating hormone beta-subunit isoform in human pituitary, peripheral blood leukocytes, and thyroid."
Schaefer J.S., Klein J.R.
Gen. Comp. Endocrinol. 162:241-244(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[9]"Human pituitary thyrotropin. The primary structure of the alpha and beta subunits."
Sairam M.R., Li C.H.
Can. J. Biochem. 55:755-760(1977) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 21-132.
+Additional computationally mapped references.

Web resources

Thyrogen

Clinical information on Thyrogen

Wikipedia

Thyroid-stimulating hormone entry

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X02866 Genomic DNA. Translation: CAA26618.1.
X02867 Genomic DNA. Translation: CAA26619.1.
M23671, M23670 Genomic DNA. Translation: AAB05845.1.
M25164 Genomic DNA. Translation: AAA61235.1.
M21024 Genomic DNA. Translation: AAA36782.1.
S70587 Genomic DNA. Translation: AAB30828.2.
AL109660 Genomic DNA. Translation: CAI22270.1.
BC069298 mRNA. Translation: AAH69298.1.
CCDSCCDS880.1. [P01222-1]
PIRTTHUB. A23997.
RefSeqNP_000540.2. NM_000549.4. [P01222-1]
NP_001264920.1. NM_001277991.1. [P01222-2]
UniGeneHs.406687.

3D structure databases

ProteinModelPortalP01222.
SMRP01222. Positions 22-115.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000256592.

PTM databases

PhosphoSiteP01222.

Polymorphism databases

DMDM311033515.

Proteomic databases

PaxDbP01222.
PRIDEP01222.

Protocols and materials databases

DNASU7252.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000256592; ENSP00000256592; ENSG00000134200. [P01222-1]
ENST00000369517; ENSP00000358530; ENSG00000134200. [P01222-1]
GeneID7252.
KEGGhsa:7252.
UCSCuc001efs.2. human. [P01222-1]

Organism-specific databases

CTD7252.
GeneCardsGC01P115572.
H-InvDBHIX0028781.
HGNCHGNC:12372. TSHB.
MIM188540. gene.
275100. phenotype.
neXtProtNX_P01222.
Orphanet90674. Isolated thyroid-stimulating hormone deficiency.
PharmGKBPA37041.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG40888.
HOGENOMHOG000116098.
HOVERGENHBG006698.
InParanoidP01222.
KOK05251.
OMATNYCTKP.
OrthoDBEOG7JQBQF.
PhylomeDBP01222.
TreeFamTF332940.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
REACT_17015. Metabolism of proteins.

Gene expression databases

BgeeP01222.
CleanExHS_TSHB.
GenevestigatorP01222.

Family and domain databases

Gene3D2.10.90.10. 1 hit.
InterProIPR029034. Cystine-knot_cytokine.
IPR006208. Glyco_hormone_CN.
IPR001545. Gonadotropin_bsu.
IPR018245. Gonadotropin_bsu_CS.
[Graphical view]
PANTHERPTHR11515. PTHR11515. 1 hit.
PfamPF00007. Cys_knot. 1 hit.
[Graphical view]
SMARTSM00068. GHB. 1 hit.
[Graphical view]
SUPFAMSSF57501. SSF57501. 1 hit.
PROSITEPS00261. GLYCO_HORMONE_BETA_1. 1 hit.
PS00689. GLYCO_HORMONE_BETA_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiTSHB.
GenomeRNAi7252.
NextBio28357.
PROP01222.
SOURCESearch...

Entry information

Entry nameTSHB_HUMAN
AccessionPrimary (citable) accession number: P01222
Secondary accession number(s): B1AKP0, Q16163
Entry history
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: November 2, 2010
Last modified: July 9, 2014
This is version 135 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM