P01011 (AACT_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 168.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Alpha-1-antichymotrypsin Short name=ACT Alternative name(s): Cell growth-inhibiting gene 24/25 protein Serpin A3 Cleaved into the following chain: | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Although its physiological function is unclear, it can inhibit neutrophil cathepsin G and mast cell chymase, both of which can convert angiotensin-1 to the active angiotensin-2. Ref.14 |
| Subunit structure | Interacts with DNAJC1. Ref.18 |
| Subcellular location | |
| Tissue specificity | Plasma. Synthesized in the liver. Like the related alpha-1-antitrypsin, its concentration increases in the acute phase of inflammation or infection. Found in the amyloid plaques from the hippocampus of Alzheimer disease brains. Ref.7 Ref.8 |
| Domain | The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable. |
| Post-translational modification | |
| Miscellaneous | Alpha-1-antichymotrypsin can bind DNA. |
| Sequence similarities | Belongs to the serpin family. |
| Caution | It is uncertain whether Met-1 or Met-4 is the initiator. |
| Sequence caution | The sequence AAA51543.1 differs from that shown. Reason: Frameshift at positions 101, 106, 111, 117, 123, 129 and 421. The sequence AAT08029.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAT08029.1 differs from that shown. Reason: Frameshift at position 4. The sequence BAD92297.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAA48671.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DNAJC1 | Q96KC8 | 3 | EBI-296557,EBI-296550 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P01011-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P01011-2) The sequence of this isoform differs from the canonical sequence as follows: 215-216: AK → ER 217-423: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P01011-3) The sequence of this isoform differs from the canonical sequence as follows: 64-95: LVLKAPDKNVIFSPLSISTALAFLSLGAHNTT → SPRWSIRLCLMYLRRAQKHLLPQQSKSPSFLH 96-423: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 24 – 423 | 400 | Alpha-1-antichymotrypsin | PRO_0000032411 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 26 – 423 | 398 | Alpha-1-antichymotrypsin His-Pro-less | PRO_0000032412 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 235 – 237 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 369 – 394 | 26 | RCL | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 381 – 389 | 9 | O-glycosylated at one site | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 383 – 384 | 2 | Reactive bond | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Ref.21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 93 | 1 | N-linked (GlcNAc...) Ref.17 Ref.20 Ref.21 Ref.22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 106 | 1 | N-linked (GlcNAc...) Ref.17 Ref.21 Ref.22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 127 | 1 | N-linked (GlcNAc...) Ref.21 Ref.22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 186 | 1 | N-linked (GlcNAc...) Ref.21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 271 | 1 | N-linked (GlcNAc...) Ref.21 Ref.22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 64 – 95 | 32 | LVLKA…AHNTT → SPRWSIRLCLMYLRRAQKHL LPQQSKSPSFLH in isoform 3. | VSP_014225 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 96 – 423 | 328 | Missing in isoform 3. | VSP_014226 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 215 – 216 | 2 | AK → ER in isoform 2. | VSP_014227 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 217 – 423 | 207 | Missing in isoform 2. | VSP_014228 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 9 | 1 | A → T. Ref.3 Ref.4 Ref.5 Ref.6 Corresponds to variant rs4934 [ dbSNP | Ensembl ]. | VAR_006973 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 78 | 1 | L → P in Bochum-1. Ref.2 Corresponds to variant rs1800463 [ dbSNP | Ensembl ]. | VAR_006974 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 167 | 1 | A → G. | VAR_006975 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | P → A in Bonn-1. Ref.2 Ref.29 Corresponds to variant rs17473 [ dbSNP | Ensembl ]. | VAR_006976 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 267 | 1 | K → R. Ref.6 Corresponds to variant rs17853314 [ dbSNP | Ensembl ]. | VAR_037902 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 401 | 1 | M → V Associated with occlusive-cerebrovascular disease; Isehara-1. Ref.28 Ref.30 | VAR_006977 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 407 | 1 | D → G. Corresponds to variant rs10956 [ dbSNP | Ensembl ]. | VAR_011742 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 55 | 1 | D → S AA sequence Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 69 | 1 | P → L in AAA51543. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 101 | 1 | K → R in BAD92297. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 106 | 1 | N → Y in AAT08028. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 198 | 1 | D → N in AAT08029. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 199 | 1 | L → P in AAA51543. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 234 | 1 | S → N in AAT08029. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 339 | 1 | S → G in AAT08028. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 346 | 1 | I → S in AAT08028. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 361 – 363 | 3 | AVL → VVS in AAA51543. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 50 – 67 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 69 – 71 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 73 – 75 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 77 – 87 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 88 – 90 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 93 – 102 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 107 – 109 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 112 – 126 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 130 – 132 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 146 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 151 – 161 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 164 – 168 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 170 – 172 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 173 – 183 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 185 – 194 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 205 – 219 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 223 – 225 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 236 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 238 – 256 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 257 – 260 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 261 – 279 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 288 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 301 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 304 – 314 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 316 – 323 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 325 – 330 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 335 – 337 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 344 – 347 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 348 – 350 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 352 – 365 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 367 – 373 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 392 – 394 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 399 – 405 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 412 – 418 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence homology between human alpha 1-antichymotrypsin, alpha 1-antitrypsin, and antithrombin III." Chandra T., Stackhouse R., Kidd V.J., Robson K.J.H., Woo S.L.C. Biochemistry 22:5055-5061(1983) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [2] | "A leucine-to-proline substitution causes a defective alpha 1-antichymotrypsin allele associated with familial obstructive lung disease." Poller W., Faber J.-P., Weidinger S., Tief K., Scholz S., Fischer M., Olek K., Kirchgesser M., Heidtmann H.-H. Genomics 17:740-743(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS BOCHUM-1 PRO-78 AND BONN-1 ALA-252. |
| [3] | "Identification of a human cell growth inhibiting gene." Kim J.W. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-9. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-9. Tissue: Urinary bladder. |
| [5] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-9. Tissue: Brain. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS THR-9 AND ARG-267. Tissue: Brain, Liver and Skin. |
| [7] | "Immunochemical identification of the serine protease inhibitor alpha 1-antichymotrypsin in the brain amyloid deposits of Alzheimer's disease." Abraham C.R., Selkoe D.J., Potter H. Cell 52:487-501(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-46, TISSUE SPECIFICITY. Tissue: Liver. |
| [8] | "Molecular studies define the primary structure of alpha1-antichymotrypsin (ACT) protease inhibitor in Alzheimer's disease brains. Comparison of act in hippocampus and liver." Hwang S.-R., Steineckert B., Kohn A., Palkovits M., Hook V.Y.H. J. Biol. Chem. 274:1821-1827(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-423 (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Hippocampus. |
| [9] | Rubin H. Submitted (OCT-1989) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-86 AND 130-423 (ISOFORM 1). |
| [10] | "The microheterogeneity of desialylated alpha 1-antichymotrypsin: the occurrence of two amino-terminal isoforms, one lacking a His-Pro dipeptide." Lindmark B., Hilja H., Alan R., Eriksson S. Biochim. Biophys. Acta 997:90-95(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 24-34. |
| [11] | "Interactions of alpha-1-antichymotrypsin, alpha-1-proteinase inhibitor, and alpha-2-macroglobulin with the fungal enzyme, seaprose." Korzus E., Luisetti M., Travis J. Biol. Chem. Hoppe-Seyler 375:335-341(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 36-45. |
| [12] | "Structural alterations in alpha 1-antichymotrypsin from normal and acute phase human plasma." Morii M., Travis J. Biochem. Biophys. Res. Commun. 111:438-443(1983) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 41-60. |
| [13] | "Characterisation of the tumour-associated carbohydrate epitope recognised by monoclonal antibody 4D3." Pinczower G.D., Williams R.P.W., Gianello R.D., Robinson H.C., Preston B.N., Linnane A.W. Int. J. Cancer 66:636-644(1996) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 48-68 (ISOFORMS 1/2). |
| [14] | "Cloning, expression, purification, and biological activity of recombinant native and variant human alpha 1-antichymotrypsins." Rubin H., Wang Z., Nickbarg E.B., McLarney S., Naidoo N., Schoenberger O.L., Johnson J.L., Cooperman B.S. J. Biol. Chem. 265:1199-1207(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 87-129 (ISOFORMS 1/2), FUNCTION. Tissue: Liver. |
| [15] | "Plasma protease inhibitors in mouse and man: divergence within the reactive centre regions." Hill R.E., Shaw P.H., Boyd P.A., Baumann H., Hastie N.D. Nature 311:175-177(1984) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 205-423. |
| [16] | "Amino acid sequence at the reactive site of human alpha 1-antichymotrypsin." Morii M., Travis J. J. Biol. Chem. 258:12749-12752(1983) [PubMed] [Europe PMC] [Abstract] Cited for: REACTIVE SITE. |
| [17] | "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." Zhang H., Li X.-J., Martin D.B., Aebersold R. Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-93 AND ASN-106. |
| [18] | "The SANT2 domain of the murine tumor cell DnaJ-like protein 1 human homologue interacts with alpha1-antichymotrypsin and kinetically interferes with its serpin inhibitory activity." Kroczynska B., Evangelista C.M., Samant S.S., Elguindi E.C., Blond S.Y. J. Biol. Chem. 279:11432-11443(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DNAJC1. |
| [19] | "Expression patterns of murine antichymotrypsin-like genes reflect evolutionary divergence at the Serpina3 locus." Horvath A.J., Forsyth S.L., Coughlin P.B. J. Mol. Evol. 59:488-497(2004) [PubMed] [Europe PMC] [Abstract] Cited for: REGION RCL. |
| [20] | "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry." Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. Proteomics 4:454-465(2004) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-93, MASS SPECTROMETRY. Tissue: Plasma. |
| [21] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-33; ASN-93; ASN-106; ASN-127; ASN-186 AND ASN-271, MASS SPECTROMETRY. Tissue: Plasma. |
| [22] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-93; ASN-106; ASN-127 AND ASN-271, MASS SPECTROMETRY. Tissue: Liver. |
| [23] | "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins." Halim A., Ruetschi U., Larson G., Nilsson J. J. Proteome Res. 12:573-584(2013) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION, MASS SPECTROMETRY. |
| [24] | "Crystal structure of cleaved human alpha 1-antichymotrypsin at 2.7-A resolution and its comparison with other serpins." Baumann U., Huber R., Bode W., Grosse D., Lesjak M., Laurell C.-B. J. Mol. Biol. 218:595-606(1991) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 24-423. |
| [25] | "Arginine substitutions in the hinge region of antichymotrypsin affect serpin beta-sheet rearrangement." Lukacs C.M., Zhong J.Q., Plotnick M.I., Rubin H., Cooperman B.S., Christianson D.W. Nat. Struct. Biol. 3:888-893(1996) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.95 ANGSTROMS) OF 43-423 OF MUTANTS ARG-370 AND ARG-372. |
| [26] | "Engineering an anion-binding cavity in antichymotrypsin modulates the 'spring-loaded' serpin-protease interaction." Lukacs C.M., Rubin H., Christianson D.W. Biochemistry 37:3297-3304(1998) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 43-423 OF MUTANTS ARG-370; ARG-372 AND ARG-374. |
| [27] | "Inactive conformation of the serpin alpha(1)-antichymotrypsin indicates two-stage insertion of the reactive loop: implications for inhibitory function and conformational disease." Gooptu B., Hazes B., Chang W.-S.W., Dafforn T.R., Carrell R.W., Read R.J., Lomas D.A. Proc. Natl. Acad. Sci. U.S.A. 97:67-72(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.27 ANGSTROMS) OF 26-423. |
| [28] | "Detection of a new mutant alpha-1-antichymotrypsin in patients with occlusive-cerebrovascular disease." Tsuda M., Sei Y., Yamamura M., Yamamoto M., Shinohara Y. FEBS Lett. 304:66-68(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ISEHARA-1 VAL-401. |
| [29] | "Mis-sense mutation of alpha 1-antichymotrypsin gene associated with chronic lung disease." Poller W., Faber J.-P., Scholz S., Weindinger S., Bartholome K., Olek K., Eriksson S. Lancet 339:1538-1538(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT BONN-1 ALA-252. |
| [30] | "Alpha-1-antichymotrypsin gene A1252G variant (ACT Isehara-1) is associated with a lacunar type of ischemic cerebrovascular disease." Tachikawa H., Tsuda M., Onoe K., Ueno M., Takagi S., Shinohara Y. J. Hum. Genet. 46:45-47(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT VAL-401. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Alpha-1 antichymotrypsin entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | K01500 mRNA. Translation: AAA51543.1. Frameshift. X68733 X68737 Genomic DNA. Translation: CAA48671.1. Different initiation.AY513275 mRNA. Translation: AAT08028.1. AY513276 mRNA. Translation: AAT08029.1. Sequence problems. AK123091 mRNA. Translation: BAG53869.1. AB209060 mRNA. Translation: BAD92297.1. Different initiation. BC003559 mRNA. Translation: AAH03559.3. BC010530 mRNA. Translation: AAH10530.1. BC013189 mRNA. Translation: AAH13189.1. BC034554 mRNA. Translation: AAH34554.1. BC070265 mRNA. Translation: AAH70265.1. M18906 mRNA. Translation: AAA51559.1. AF089747 mRNA. Translation: AAD08810.1. J05176 mRNA. Translation: AAA51560.1. X00947 Genomic DNA. Translation: CAA25459.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00550991. IPI00607870. IPI00847635. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | ITHUC. A90475. S62374. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001076.2. NM_001085.4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.534293. Hs.710488. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P01011. 9 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MEROPS | I04.002. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GlycoSuiteDB | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 112874. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DOSAC-COBS-2DPAGE | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SWISS-2DPAGE | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 12. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000393078; ENSP00000376793; ENSG00000196136. ENST00000393080; ENSP00000376795; ENSG00000196136. ENST00000467132; ENSP00000450540; ENSG00000196136. ENST00000556968; ENSP00000452476; ENSG00000196136. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 12. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:12. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001ydp.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 12. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC14P095078. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0079611. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:16. SERPINA3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB016647. HPA000893. HPA002560. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 107280. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA35020. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG4826. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG005957. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K04525. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4FFD1T. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000196136. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR023795. Protease_inhib_I4_serpin_CS. IPR023796. Serpin_dom. IPR000215. Serpin_fam. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11461. PTHR11461. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00079. Serpin. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00093. SERPIN. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF56574. Prot_inh_serpin. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00284. SERPIN. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL5960. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | SERPINA3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 12. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 23. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P01011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | AACT_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P01011 Secondary accession number(s): B3KVQ7 Q9UNU9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
