Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P01009

- A1AT_HUMAN

UniProt

P01009 - A1AT_HUMAN

Protein

Alpha-1-antitrypsin

Gene

SERPINA1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 209 (01 Oct 2014)
      Sequence version 3 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.
    Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei382 – 3832Reactive bond

    GO - Molecular functioni

    1. glycoprotein binding Source: UniProt
    2. identical protein binding Source: IntAct
    3. protease binding Source: UniProtKB
    4. protein binding Source: UniProtKB
    5. serine-type endopeptidase inhibitor activity Source: UniProtKB

    GO - Biological processi

    1. acute-phase response Source: UniProtKB-KW
    2. blood coagulation Source: Reactome
    3. negative regulation of endopeptidase activity Source: RefGenome
    4. platelet activation Source: Reactome
    5. platelet degranulation Source: Reactome
    6. regulation of proteolysis Source: RefGenome
    7. response to chromate Source: Ensembl
    8. response to cytokine Source: Ensembl
    9. response to estradiol Source: Ensembl
    10. response to hypoxia Source: Ensembl
    11. response to lead ion Source: Ensembl
    12. response to lipopolysaccharide Source: Ensembl
    13. response to methanol Source: Ensembl
    14. response to triglyceride Source: Ensembl

    Keywords - Molecular functioni

    Protease inhibitor, Serine protease inhibitor

    Keywords - Biological processi

    Acute phase, Blood coagulation, Hemostasis

    Protein family/group databases

    MEROPSiI04.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha-1-antitrypsin
    Alternative name(s):
    Alpha-1 protease inhibitor
    Alpha-1-antiproteinase
    Serpin A1
    Cleaved into the following chain:
    Short peptide from AAT
    Short name:
    SPAAT
    Gene namesi
    Name:SERPINA1
    Synonyms:AAT, PI
    ORF Names:PRO0684, PRO2209
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:8941. SERPINA1.

    Subcellular locationi

    Secreted. Endoplasmic reticulum
    Note: The S and Z allele are not secreted effectively and accumulate intracellularly in the endoplasmic reticulum.

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB
    2. extracellular region Source: UniProtKB
    3. extracellular space Source: UniProtKB
    4. extracellular vesicular exosome Source: UniProt
    5. Golgi apparatus Source: UniProt
    6. platelet alpha granule lumen Source: Reactome
    7. proteinaceous extracellular matrix Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Endoplasmic reticulum, Extracellular matrix, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Alpha-1-antitrypsin deficiency (A1ATD) [MIM:613490]: A disorder whose most common manifestation is emphysema, which becomes evident by the third to fourth decade. A less common manifestation of the deficiency is liver disease, which occurs in children and adults, and may result in cirrhosis and liver failure. Environmental factors, particularly cigarette smoking, greatly increase the risk of emphysema at an earlier age.3 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi382 – 3821M → V: Oxidation-resistant inhibitor of therapeutic importance. 1 Publication

    Organism-specific databases

    MIMi613490. phenotype.
    Orphaneti60. Alpha-1-antitrypsin deficiency.
    178396. Hemorrhagic disease due to alpha-1-antitrypsin Pittsburgh mutation.
    PharmGKBiPA35509.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 24241 PublicationAdd
    BLAST
    Chaini25 – 418394Alpha-1-antitrypsin1 PublicationPRO_0000032377Add
    BLAST
    Peptidei375 – 41844Short peptide from AATPRO_0000364030Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi70 – 701N-linked (GlcNAc...) (complex)10 Publications
    Glycosylationi107 – 1071N-linked (GlcNAc...) (complex)6 Publications
    Modified residuei256 – 2561S-cysteinyl cysteine
    Glycosylationi271 – 2711N-linked (GlcNAc...) (complex)10 Publications

    Post-translational modificationi

    N-glycosylated. Differential glycosylation produces a number of isoforms. N-linked glycan at Asn-107 is alternatively di-antennary, tri-antennary or tetra-antennary. The glycan at Asn-70 is di-antennary with trace amounts of tri-antennary. Glycan at Asn-271 is exclusively di-antennary. Structure of glycans at Asn-70 and Asn-271 is Hex5HexNAc4. The structure of the antennae is Neu5Ac(alpha1-6)Gal(beta1-4)GlcNAc attached to the core structure Man(alpha1-6)[Man(alpha1-3)]Man(beta1-4)GlcNAc(beta1-4)GlcNAc. Some antennae are fucosylated, which forms a Lewis-X determinant.11 Publications
    Proteolytic processing may yield the truncated form that ranges from Asp-30 to Lys-418.

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiP01009.
    PaxDbiP01009.
    PRIDEiP01009.

    2D gel databases

    DOSAC-COBS-2DPAGEP01009.
    OGPiP01009.
    REPRODUCTION-2DPAGEIPI00553177.
    P01009.
    SWISS-2DPAGEP01009.
    UCD-2DPAGEP01009.

    PTM databases

    PhosphoSiteiP01009.
    UniCarbKBiP01009.

    Miscellaneous databases

    PMAP-CutDBP01009.

    Expressioni

    Tissue specificityi

    Ubiquitous. Expressed in leukocytes and plasma.1 Publication

    Gene expression databases

    ArrayExpressiP01009.
    BgeeiP01009.
    GenevestigatoriP01009.

    Organism-specific databases

    HPAiCAB013211.
    CAB016648.
    HPA000927.
    HPA001292.

    Interactioni

    Subunit structurei

    The variants S and Z interact with CANX AND PDIA3.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself5EBI-986224,EBI-986224
    P007605EBI-986224,EBI-986385From a different organism.
    CELA1P007722EBI-986224,EBI-986248From a different organism.
    espBP712133EBI-986224,EBI-2615322From a different organism.
    SSR1P433074EBI-986224,EBI-714168

    Protein-protein interaction databases

    BioGridi111283. 22 interactions.
    DIPiDIP-35493N.
    IntActiP01009. 20 interactions.
    MINTiMINT-365327.

    Structurei

    Secondary structure

    1
    418
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni48 – 503
    Helixi51 – 6818
    Beta strandi70 – 723
    Beta strandi74 – 763
    Helixi78 – 8912
    Helixi94 – 10310
    Turni108 – 1103
    Helixi113 – 12715
    Beta strandi135 – 14511
    Beta strandi146 – 1483
    Helixi152 – 16211
    Beta strandi164 – 1696
    Beta strandi171 – 1733
    Helixi174 – 18815
    Turni189 – 1913
    Beta strandi206 – 22015
    Helixi224 – 2263
    Beta strandi228 – 2358
    Beta strandi238 – 25619
    Turni257 – 2604
    Beta strandi261 – 27919
    Beta strandi280 – 2823
    Helixi284 – 2907
    Helixi293 – 3019
    Beta strandi306 – 3138
    Beta strandi315 – 3228
    Helixi324 – 3296
    Helixi334 – 3363
    Turni337 – 3393
    Turni343 – 3453
    Beta strandi347 – 3493
    Beta strandi351 – 36414
    Beta strandi366 – 38116
    Beta strandi387 – 3893
    Beta strandi394 – 4007
    Turni401 – 4033
    Beta strandi406 – 4149

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1ATUX-ray2.70A45-418[»]
    1D5SX-ray3.00A44-377[»]
    B378-418[»]
    1EZXX-ray2.60A48-382[»]
    B383-418[»]
    1HP7X-ray2.10A25-418[»]
    1IZ2X-ray2.20A25-418[»]
    1KCTX-ray3.46A25-418[»]
    1OO8X-ray2.65A26-418[»]
    1OPHX-ray2.30A26-418[»]
    1PSIX-ray2.92A26-418[»]
    1QLPX-ray2.00A26-418[»]
    1QMBX-ray2.60A49-376[»]
    B377-418[»]
    2D26X-ray3.30A25-382[»]
    B383-418[»]
    2QUGX-ray2.00A25-418[»]
    3CWLX-ray2.44A25-418[»]
    3CWMX-ray2.51A25-418[»]
    3DRMX-ray2.20A26-418[»]
    3DRUX-ray3.20A/B/C26-418[»]
    3NDDX-ray1.50A46-382[»]
    B383-418[»]
    3NDFX-ray2.70A46-382[»]
    B383-418[»]
    3NE4X-ray1.81A48-418[»]
    3T1PX-ray3.90A48-418[»]
    7APIX-ray3.00A36-382[»]
    B383-418[»]
    8APIX-ray3.10A36-382[»]
    B383-418[»]
    9APIX-ray3.00A36-382[»]
    B383-418[»]
    ProteinModelPortaliP01009.
    SMRiP01009. Positions 48-417.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP01009.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni368 – 39225RCLAdd
    BLAST

    Domaini

    The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.

    Sequence similaritiesi

    Belongs to the serpin family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG4826.
    HOVERGENiHBG005957.
    InParanoidiP01009.
    KOiK03984.
    OMAiVVNPTQK.
    OrthoDBiEOG7QC7W9.
    PhylomeDBiP01009.
    TreeFamiTF343201.

    Family and domain databases

    InterProiIPR023795. Serpin_CS.
    IPR023796. Serpin_dom.
    IPR000215. Serpin_fam.
    [Graphical view]
    PANTHERiPTHR11461. PTHR11461. 1 hit.
    PfamiPF00079. Serpin. 1 hit.
    [Graphical view]
    SMARTiSM00093. SERPIN. 1 hit.
    [Graphical view]
    SUPFAMiSSF56574. SSF56574. 1 hit.
    PROSITEiPS00284. SERPIN. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P01009-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPSSVSWGIL LLAGLCCLVP VSLAEDPQGD AAQKTDTSHH DQDHPTFNKI    50
    TPNLAEFAFS LYRQLAHQSN STNIFFSPVS IATAFAMLSL GTKADTHDEI 100
    LEGLNFNLTE IPEAQIHEGF QELLRTLNQP DSQLQLTTGN GLFLSEGLKL 150
    VDKFLEDVKK LYHSEAFTVN FGDTEEAKKQ INDYVEKGTQ GKIVDLVKEL 200
    DRDTVFALVN YIFFKGKWER PFEVKDTEEE DFHVDQVTTV KVPMMKRLGM 250
    FNIQHCKKLS SWVLLMKYLG NATAIFFLPD EGKLQHLENE LTHDIITKFL 300
    ENEDRRSASL HLPKLSITGT YDLKSVLGQL GITKVFSNGA DLSGVTEEAP 350
    LKLSKAVHKA VLTIDEKGTE AAGAMFLEAI PMSIPPEVKF NKPFVFLMIE 400
    QNTKSPLFMG KVVNPTQK 418
    Length:418
    Mass (Da):46,737
    Last modified:October 1, 1996 - v3
    Checksum:i7016555F273B7F16
    GO
    Isoform 2 (identifier: P01009-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         356-418: AVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK → VRSP

    Note: No experimental confirmation available.

    Show »
    Length:359
    Mass (Da):40,263
    Checksum:iD16A255538FB2945
    GO
    Isoform 3 (identifier: P01009-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         307-418: Missing.

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:306
    Mass (Da):34,755
    Checksum:i15C708E6C25CE0C4
    GO

    Sequence cautioni

    The sequence CAD62334.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence CAD62585.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti12 – 121Missing in AAA51546. (PubMed:2985281)Curated
    Sequence conflicti23 – 231L → P in BAG38005. (PubMed:14702039)Curated
    Sequence conflicti26 – 261D → H AA sequence (PubMed:1906855)Curated
    Sequence conflicti39 – 391H → L AA sequence (PubMed:1906855)Curated
    Sequence conflicti61 – 611L → P in AAF29581. 1 PublicationCurated
    Sequence conflicti96 – 961T → A in ABG73380. (PubMed:17650587)Curated
    Sequence conflicti139 – 1402GN → DG in AAB59375. (PubMed:6319097)Curated
    Sequence conflicti174 – 1741T → H in AAA51546. (PubMed:2985281)Curated
    Sequence conflicti229 – 2291E → D in AAA51546. (PubMed:2985281)Curated
    Sequence conflicti273 – 2731T → N in AAB59375. (PubMed:6319097)Curated
    Sequence conflicti280 – 2801D → G in ABG73380. (PubMed:17650587)Curated
    Sequence conflicti326 – 3261V → I in CAA25838. (PubMed:6387509)Curated
    Sequence conflicti410 – 4101G → L AA sequence (PubMed:1406456)Curated
    Sequence conflicti414 – 4141N → S AA sequence (PubMed:1406456)Curated

    Polymorphismi

    The sequence shown is that of the M1V allele which is the most common form of PI (44 to 49%). Other frequent alleles are: M1A 20 to 23%; M2 10 to 11%; M3 14 to 19%.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti4 – 41S → L in Z-Wrexham. 1 Publication
    VAR_006978
    Natural varianti26 – 261D → A in V-Munich. 1 Publication
    VAR_006979
    Natural varianti37 – 371T → A.
    Corresponds to variant rs11558262 [ dbSNP | Ensembl ].
    VAR_051938
    Natural varianti58 – 581A → T in M5-Karlsruhe.
    VAR_006980
    Natural varianti63 – 631R → C in I. 1 Publication
    Corresponds to variant rs28931570 [ dbSNP | Ensembl ].
    VAR_006981
    Natural varianti65 – 651L → P in M-Procida. 1 Publication
    Corresponds to variant rs28931569 [ dbSNP | Ensembl ].
    VAR_006982
    Natural varianti69 – 691S → F in M6-Bonn.
    VAR_006983
    Natural varianti75 – 751Missing in M-Malton, M-Nichinan and M-Palermo; associated with very low serum levels of AAT; homozygosity for allele M-Malton may be associated with a risk for chronic emphysema or infantile liver cirrhosis. 3 Publications
    VAR_006984
    Natural varianti77 – 771S → F in S-Iiyama. 1 Publication
    Corresponds to variant rs55819880 [ dbSNP | Ensembl ].
    VAR_006985
    Natural varianti84 – 841A → T in M6-Passau.
    VAR_006986
    Natural varianti91 – 911G → E in M-Mineral springs; causes reduced AAT secretion. 1 Publication
    Corresponds to variant rs28931568 [ dbSNP | Ensembl ].
    VAR_006987
    Natural varianti92 – 921T → I in QO-Lisbon; deficient AAT with very low serum levels.
    VAR_006988
    Natural varianti109 – 1091T → M in Z-Bristol; deficient AA; disrupts the N-glycosylation site N-107. 1 Publication
    VAR_011620
    Natural varianti112 – 1121P → T in M5-Berlin.
    VAR_006989
    Natural varianti116 – 1161I → N in QO-Ludwigshafen. 1 Publication
    Corresponds to variant rs28931572 [ dbSNP | Ensembl ].
    VAR_006990
    Natural varianti125 – 1251R → H in M2; associated with D-400.
    Corresponds to variant rs709932 [ dbSNP | Ensembl ].
    VAR_006991
    Natural varianti139 – 1391G → S in QO-Newport. 1 Publication
    Corresponds to variant rs11558261 [ dbSNP | Ensembl ].
    VAR_006992
    Natural varianti172 – 1721G → R in V and M-Nichinan.
    VAR_006993
    Natural varianti172 – 1721G → W in M2-Obernburg. 1 Publication
    VAR_006994
    Natural varianti180 – 1801Q → E in L-Frankfurt.
    VAR_006995
    Natural varianti190 – 1989QGKIVDLVK → GFQNAILVR in Aberrant form.
    VAR_036746
    Natural varianti228 – 2281E → K in X.
    VAR_006996
    Natural varianti237 – 2371V → A in M1A and Z; associated with K-366 in Z. 4 Publications
    Corresponds to variant rs6647 [ dbSNP | Ensembl ].
    VAR_006997
    Natural varianti247 – 2471R → C in F. 1 Publication
    Corresponds to variant rs28929470 [ dbSNP | Ensembl ].
    VAR_006998
    Natural varianti280 – 2801D → V in P-Duarte/P-Cardiff/P-Lowell; associated with H-415 in Y-Barcelona. 3 Publications
    Corresponds to variant rs28929472 [ dbSNP | Ensembl ].
    VAR_006999
    Natural varianti288 – 2881E → V in S and T. 2 Publications
    Corresponds to variant rs17580 [ dbSNP | Ensembl ].
    VAR_007000
    Natural varianti305 – 3051Missing in Basque. 1 Publication
    VAR_009216
    Natural varianti354 – 3541S → F in S-Munich.
    VAR_007001
    Natural varianti360 – 3601A → T in W-Bethesda. 1 Publication
    Corresponds to variant rs1802959 [ dbSNP | Ensembl ].
    VAR_007002
    Natural varianti365 – 3651D → N in P-St.Albans/P-Donauwoerth.
    VAR_007003
    Natural varianti366 – 3661E → K in Z/Z-Augsburg/Z-Tun; associated with A-237 in Z. 3 Publications
    Corresponds to variant rs28929474 [ dbSNP | Ensembl ].
    VAR_007004
    Natural varianti382 – 3821M → R in Pittsburgh; has antithrombin activity; causes fatal bleeding diathesis.
    VAR_007005
    Natural varianti386 – 3861P → H in Sao Tome. 1 Publication
    VAR_007006
    Natural varianti386 – 3861P → T in L-Offenbach.
    VAR_007007
    Natural varianti387 – 3871E → K in Christchurch.
    Corresponds to variant rs121912712 [ dbSNP | Ensembl ].
    VAR_007008
    Natural varianti393 – 3931P → L in M-Heerlen. 1 Publication
    VAR_007009
    Natural varianti400 – 4001E → D in M2 and M3; associated with H-125 in M2. 2 Publications
    Corresponds to variant rs1303 [ dbSNP | Ensembl ].
    VAR_007010
    Natural varianti415 – 4151P → H in Y-Barcelona; associated with V-280. 1 Publication
    VAR_007011

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei307 – 418112Missing in isoform 3. 1 PublicationVSP_028890Add
    BLAST
    Alternative sequencei356 – 41863AVHKA…NPTQK → VRSP in isoform 2. 1 PublicationVSP_028889Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    K01396 mRNA. Translation: AAB59375.1.
    K02212 Genomic DNA. Translation: AAB59495.1.
    X01683 mRNA. Translation: CAA25838.1.
    M11465 mRNA. Translation: AAA51546.1.
    J02619 Genomic DNA. Translation: AAA51547.1.
    DQ682455 mRNA. Translation: ABG73380.1.
    AM048838 Genomic DNA. Translation: CAJ15161.1.
    AF113676 mRNA. Translation: AAF29581.1.
    AF130068 mRNA. Translation: AAG35496.1.
    BX161449 mRNA. Translation: CAD61914.1.
    BX247968 mRNA. Translation: CAD62306.1.
    BX248002 mRNA. Translation: CAD62334.1. Different initiation.
    BX248257 mRNA. Translation: CAD62585.1. Different initiation.
    AK315637 mRNA. Translation: BAG38005.1.
    BT019455 mRNA. Translation: AAV38262.1.
    BC011991 mRNA. Translation: AAH11991.1.
    BC015642 mRNA. Translation: AAH15642.1.
    J00064 Genomic DNA. Translation: AAB59369.1.
    J00066, J00065 Genomic DNA. Translation: AAB59370.1.
    J00067 Genomic DNA. Translation: AAB59371.1.
    X02920 mRNA. Translation: CAA26677.1.
    V00496 mRNA. Translation: CAA23755.1.
    M26123 mRNA. Translation: AAA51545.1.
    CCDSiCCDS9925.1. [P01009-1]
    PIRiA21853. ITHU.
    A61391.
    RefSeqiNP_000286.3. NM_000295.4. [P01009-1]
    NP_001002235.1. NM_001002235.2. [P01009-1]
    NP_001002236.1. NM_001002236.2. [P01009-1]
    NP_001121172.1. NM_001127700.1. [P01009-1]
    NP_001121173.1. NM_001127701.1. [P01009-1]
    NP_001121174.1. NM_001127702.1. [P01009-1]
    NP_001121175.1. NM_001127703.1. [P01009-1]
    NP_001121176.1. NM_001127704.1. [P01009-1]
    NP_001121177.1. NM_001127705.1. [P01009-1]
    NP_001121178.1. NM_001127706.1. [P01009-1]
    NP_001121179.1. NM_001127707.1. [P01009-1]
    UniGeneiHs.525557.

    Genome annotation databases

    EnsembliENST00000355814; ENSP00000348068; ENSG00000197249. [P01009-1]
    ENST00000393087; ENSP00000376802; ENSG00000197249. [P01009-1]
    ENST00000393088; ENSP00000376803; ENSG00000197249. [P01009-1]
    ENST00000402629; ENSP00000386094; ENSG00000197249. [P01009-2]
    ENST00000404814; ENSP00000385960; ENSG00000197249. [P01009-1]
    ENST00000437397; ENSP00000408474; ENSG00000197249. [P01009-1]
    ENST00000440909; ENSP00000390299; ENSG00000197249. [P01009-1]
    ENST00000448921; ENSP00000416066; ENSG00000197249. [P01009-1]
    ENST00000449399; ENSP00000416354; ENSG00000197249. [P01009-1]
    ENST00000489769; ENSP00000451525; ENSG00000197249. [P01009-3]
    GeneIDi5265.
    KEGGihsa:5265.
    UCSCiuc001ycx.4. human. [P01009-1]
    uc001yda.1. human. [P01009-2]

    Polymorphism databases

    DMDMi1703025.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Alpha-1 antitrypsin entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    K01396 mRNA. Translation: AAB59375.1 .
    K02212 Genomic DNA. Translation: AAB59495.1 .
    X01683 mRNA. Translation: CAA25838.1 .
    M11465 mRNA. Translation: AAA51546.1 .
    J02619 Genomic DNA. Translation: AAA51547.1 .
    DQ682455 mRNA. Translation: ABG73380.1 .
    AM048838 Genomic DNA. Translation: CAJ15161.1 .
    AF113676 mRNA. Translation: AAF29581.1 .
    AF130068 mRNA. Translation: AAG35496.1 .
    BX161449 mRNA. Translation: CAD61914.1 .
    BX247968 mRNA. Translation: CAD62306.1 .
    BX248002 mRNA. Translation: CAD62334.1 . Different initiation.
    BX248257 mRNA. Translation: CAD62585.1 . Different initiation.
    AK315637 mRNA. Translation: BAG38005.1 .
    BT019455 mRNA. Translation: AAV38262.1 .
    BC011991 mRNA. Translation: AAH11991.1 .
    BC015642 mRNA. Translation: AAH15642.1 .
    J00064 Genomic DNA. Translation: AAB59369.1 .
    J00066 , J00065 Genomic DNA. Translation: AAB59370.1 .
    J00067 Genomic DNA. Translation: AAB59371.1 .
    X02920 mRNA. Translation: CAA26677.1 .
    V00496 mRNA. Translation: CAA23755.1 .
    M26123 mRNA. Translation: AAA51545.1 .
    CCDSi CCDS9925.1. [P01009-1 ]
    PIRi A21853. ITHU.
    A61391.
    RefSeqi NP_000286.3. NM_000295.4. [P01009-1 ]
    NP_001002235.1. NM_001002235.2. [P01009-1 ]
    NP_001002236.1. NM_001002236.2. [P01009-1 ]
    NP_001121172.1. NM_001127700.1. [P01009-1 ]
    NP_001121173.1. NM_001127701.1. [P01009-1 ]
    NP_001121174.1. NM_001127702.1. [P01009-1 ]
    NP_001121175.1. NM_001127703.1. [P01009-1 ]
    NP_001121176.1. NM_001127704.1. [P01009-1 ]
    NP_001121177.1. NM_001127705.1. [P01009-1 ]
    NP_001121178.1. NM_001127706.1. [P01009-1 ]
    NP_001121179.1. NM_001127707.1. [P01009-1 ]
    UniGenei Hs.525557.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1ATU X-ray 2.70 A 45-418 [» ]
    1D5S X-ray 3.00 A 44-377 [» ]
    B 378-418 [» ]
    1EZX X-ray 2.60 A 48-382 [» ]
    B 383-418 [» ]
    1HP7 X-ray 2.10 A 25-418 [» ]
    1IZ2 X-ray 2.20 A 25-418 [» ]
    1KCT X-ray 3.46 A 25-418 [» ]
    1OO8 X-ray 2.65 A 26-418 [» ]
    1OPH X-ray 2.30 A 26-418 [» ]
    1PSI X-ray 2.92 A 26-418 [» ]
    1QLP X-ray 2.00 A 26-418 [» ]
    1QMB X-ray 2.60 A 49-376 [» ]
    B 377-418 [» ]
    2D26 X-ray 3.30 A 25-382 [» ]
    B 383-418 [» ]
    2QUG X-ray 2.00 A 25-418 [» ]
    3CWL X-ray 2.44 A 25-418 [» ]
    3CWM X-ray 2.51 A 25-418 [» ]
    3DRM X-ray 2.20 A 26-418 [» ]
    3DRU X-ray 3.20 A/B/C 26-418 [» ]
    3NDD X-ray 1.50 A 46-382 [» ]
    B 383-418 [» ]
    3NDF X-ray 2.70 A 46-382 [» ]
    B 383-418 [» ]
    3NE4 X-ray 1.81 A 48-418 [» ]
    3T1P X-ray 3.90 A 48-418 [» ]
    7API X-ray 3.00 A 36-382 [» ]
    B 383-418 [» ]
    8API X-ray 3.10 A 36-382 [» ]
    B 383-418 [» ]
    9API X-ray 3.00 A 36-382 [» ]
    B 383-418 [» ]
    ProteinModelPortali P01009.
    SMRi P01009. Positions 48-417.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111283. 22 interactions.
    DIPi DIP-35493N.
    IntActi P01009. 20 interactions.
    MINTi MINT-365327.

    Chemistry

    DrugBanki DB00058. Alpha-1-proteinase inhibitor.

    Protein family/group databases

    MEROPSi I04.001.

    PTM databases

    PhosphoSitei P01009.
    UniCarbKBi P01009.

    Polymorphism databases

    DMDMi 1703025.

    2D gel databases

    DOSAC-COBS-2DPAGE P01009.
    OGPi P01009.
    REPRODUCTION-2DPAGE IPI00553177.
    P01009.
    SWISS-2DPAGE P01009.
    UCD-2DPAGE P01009.

    Proteomic databases

    MaxQBi P01009.
    PaxDbi P01009.
    PRIDEi P01009.

    Protocols and materials databases

    DNASUi 5265.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000355814 ; ENSP00000348068 ; ENSG00000197249 . [P01009-1 ]
    ENST00000393087 ; ENSP00000376802 ; ENSG00000197249 . [P01009-1 ]
    ENST00000393088 ; ENSP00000376803 ; ENSG00000197249 . [P01009-1 ]
    ENST00000402629 ; ENSP00000386094 ; ENSG00000197249 . [P01009-2 ]
    ENST00000404814 ; ENSP00000385960 ; ENSG00000197249 . [P01009-1 ]
    ENST00000437397 ; ENSP00000408474 ; ENSG00000197249 . [P01009-1 ]
    ENST00000440909 ; ENSP00000390299 ; ENSG00000197249 . [P01009-1 ]
    ENST00000448921 ; ENSP00000416066 ; ENSG00000197249 . [P01009-1 ]
    ENST00000449399 ; ENSP00000416354 ; ENSG00000197249 . [P01009-1 ]
    ENST00000489769 ; ENSP00000451525 ; ENSG00000197249 . [P01009-3 ]
    GeneIDi 5265.
    KEGGi hsa:5265.
    UCSCi uc001ycx.4. human. [P01009-1 ]
    uc001yda.1. human. [P01009-2 ]

    Organism-specific databases

    CTDi 5265.
    GeneCardsi GC14M094843.
    GeneReviewsi SERPINA1.
    HGNCi HGNC:8941. SERPINA1.
    HPAi CAB013211.
    CAB016648.
    HPA000927.
    HPA001292.
    MIMi 107400. gene.
    613490. phenotype.
    neXtProti NX_P01009.
    Orphaneti 60. Alpha-1-antitrypsin deficiency.
    178396. Hemorrhagic disease due to alpha-1-antitrypsin Pittsburgh mutation.
    PharmGKBi PA35509.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG4826.
    HOVERGENi HBG005957.
    InParanoidi P01009.
    KOi K03984.
    OMAi VVNPTQK.
    OrthoDBi EOG7QC7W9.
    PhylomeDBi P01009.
    TreeFami TF343201.

    Miscellaneous databases

    ChiTaRSi SERPINA1. human.
    EvolutionaryTracei P01009.
    GeneWikii Alpha_1-antitrypsin.
    GenomeRNAii 5265.
    NextBioi 20336.
    PMAP-CutDB P01009.
    PROi P01009.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P01009.
    Bgeei P01009.
    Genevestigatori P01009.

    Family and domain databases

    InterProi IPR023795. Serpin_CS.
    IPR023796. Serpin_dom.
    IPR000215. Serpin_fam.
    [Graphical view ]
    PANTHERi PTHR11461. PTHR11461. 1 hit.
    Pfami PF00079. Serpin. 1 hit.
    [Graphical view ]
    SMARTi SM00093. SERPIN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56574. SSF56574. 1 hit.
    PROSITEi PS00284. SERPIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression in Escherichia coli of full-length complementary DNA coding for human alpha 1-antitrypsin."
      Bollen A., Herzog A., Cravador A., Herion P., Chuchana P., van der Straten A., Loriau R., Jacobs P., van Elsen A.
      DNA 2:255-264(1983) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequence of the cDNA for human alpha 1-antitrypsin and the gene for the S variant."
      Long G.L., Chandra T., Woo S.L.C., Davie E.W., Kurachi K.
      Biochemistry 23:4828-4837(1984) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Synthesis in yeast of a functional oxidation-resistant mutant of human alpha-antitrypsin."
      Rosenberg S., Barr P.J., Najarian R.C., Hallewell R.A.
      Nature 312:77-80(1984) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), MUTAGENESIS OF MET-382.
    4. "Cell-specific expression of a transfected human alpha 1-antitrypsin gene."
      Ciliberto G., Dente L., Cortese R.
      Cell 41:531-540(1985) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    5. "Identification of a second mutation in the protein-coding sequence of the Z type alpha 1-antitrypsin gene."
      Nukiwa T., Satoh K., Brantly M.L., Ogushi F., Fells G.A., Courtney M., Crystal R.G.
      J. Biol. Chem. 261:15989-15994(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], CHARACTERIZATION OF VARIANT Z.
    6. Erratum
      Nukiwa T., Satoh K., Brantly M.L., Ogushi F., Fells G.A., Courtney M., Crystal R.G.
      J. Biol. Chem. 262:10412-10412(1987)
    7. "An alpha-1 antitrypsin genetic variant from India."
      Shasany A.K., Shukla A.K., Darokar M.P., Saraiya M., Chaturvedi N., Tewari L., Khanuja S.P.
      Indian J. Biochem. Biophys. 44:176-178(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ALA-237 AND ASP-400.
      Tissue: Liver.
    8. "Characterization of a new variant of alpha1 antitrypsin M Lille (p.Gly148Trp)."
      Balduyck M., Porchet N., Aubert J.-P., Zerimech F., Douchain F., Verchain S.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TRP-172; ALA-237 AND LYS-366.
      Tissue: Lymphocyte.
    9. "Functional prediction of the coding sequences of 32 new genes deduced by analysis of cDNA clones from human fetal liver."
      Zhang C., Yu Y., Zhang S., Ouyang S., Luo L., Wei H., Zhou G., Zhou W., Bi J., Zhang Y., Liu M., He F.
      Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Fetal liver.
    10. "Full-length cDNA libraries and normalization."
      Li W.B., Gruber C., Jessee J., Polayes D.
      Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Fetal liver and Placenta.
    11. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Synovium.
    12. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-237.
    13. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon and Ovary.
    14. "Sequence homology and structural comparison between the chromosomal human alpha 1-antitrypsin and chicken ovalbumin genes."
      Leicht M., Long G.L., Chandra T., Kurachi K., Kidd V.J., Mace M. Jr., Davie E.W., Woo S.L.C.
      Nature 297:655-659(1982) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-67; 196-255 AND 387-418.
    15. "The covalent structure of human alpha1-protease inhibitor."
      Chan S.K.
      Fed. Proc. 41:1016-1016(1982)
      Cited for: PRELIMINARY PROTEIN SEQUENCE OF 25-418 (ISOFORM 1).
    16. Cited for: PROTEIN SEQUENCE OF 25-418 (ISOFORM 1).
    17. "Appearance of an aberrant form of alpha-antitrypsin in the circulation of chronic cigarette smokers and its effect on the insulin induced NO synthesis in blood platelets."
      Sinha A.K., Girish G.V.
      Submitted (AUG-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 25-418 (ISOFORM 1), VARIANTS ABERRANT FORM 190-GLY--ARG-198 AND VAL-288, FUNCTION.
      Tissue: Blood.
    18. "Characterization of a 54 kDa, alpha 1-antitrypsin-like protein isolated from ascitic fluid of an endometrial cancer patient."
      Tanaka N., Sekiya S., Takamizawa H., Kato N., Moriyama Y., Fujimura S.
      Jpn. J. Cancer Res. 82:693-700(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 25-39, FUNCTION.
      Tissue: Ascites.
    19. "Comprehensive glyco-proteomic analysis of human alpha1-antitrypsin and its charge isoforms."
      Kolarich D., Weber A., Turecek P.L., Schwarz H.P., Altmann F.
      Proteomics 6:3369-3380(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 30-48 AND 248-257 (ISOFORMS 1/2/3), GLYCOSYLATION AT ASN-70; ASN-107 AND ASN-271, STRUCTURE OF CARBOHYDRATES, CYSTEINE-BINDING, IDENTIFICATION BY MASS SPECTROMETRY.
    20. "Sequencing of a urinary stone protein, identical to alpha-one antitrypsin, which lacks 22 amino acids."
      Umekawa T., Kohri K., Amasaki N., Yamate T., Yoshida K., Yamamoto K., Suzuki Y., Sinohara H., Kurita T.
      Biochem. Biophys. Res. Commun. 193:1049-1053(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 47-66.
      Tissue: Urine.
    21. Lubec G., Afjehi-Sadat L.
      Submitted (MAR-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 50-63 AND 161-178 (ISOFORMS 1/2/3), IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Brain and Cajal-Retzius cell.
    22. "Alpha 1-antitrypsin and serum albumin mRNA accumulation in normal, acute phase and ZZ human liver."
      Riley J.H., Bathurst I.C., Edbrooke M.R., Carrell R.W., Craig R.K.
      FEBS Lett. 189:361-366(1985) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 292-418 (ISOFORM 1).
    23. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 350-418 (ISOFORM 1).
    24. "Isolation and serine protease inhibitory activity of the 44-residue, C-terminal fragment of alpha 1-antitrypsin from human placenta."
      Niemann M.A., Narkates A.J., Miller E.J.
      Matrix 12:233-241(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 375-414, IDENTIFICATION OF SPAAT, FUNCTION, SUBCELLULAR LOCATION.
      Tissue: Placenta.
    25. "Construction and partial characterization of a human liver cDNA library."
      Coutelle C., Speer A., Rogers J., Kalsheker N., Humphries S., Williamson R.
      Biomed. Biochim. Acta 44:421-431(1985) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 387-418 (ISOFORM 1).
    26. "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry."
      Zhang H., Li X.-J., Martin D.B., Aebersold R.
      Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT ASN-70 AND ASN-271.
    27. Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70 AND ASN-271.
      Tissue: Bile.
    28. "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry."
      Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R.
      Proteomics 4:454-465(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70 AND ASN-271.
      Tissue: Plasma.
    29. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
      Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
      J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70; ASN-107 AND ASN-271.
      Tissue: Plasma.
    30. "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach."
      Lewandrowski U., Moebius J., Walter U., Sickmann A.
      Mol. Cell. Proteomics 5:226-233(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70.
      Tissue: Platelet.
    31. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70; ASN-107 AND ASN-271.
      Tissue: Liver.
    32. Cited for: GLYCOSYLATION AT ASN-107 AND ASN-271.
    33. "Enrichment of glycopeptides for glycan structure and attachment site identification."
      Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E., Brinkmalm G., Larson G.
      Nat. Methods 6:809-811(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70; ASN-107 AND ASN-271, STRUCTURE OF CARBOHYDRATES.
      Tissue: Cerebrospinal fluid.
    34. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    35. "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD."
      Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.
      Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT ASN-70 AND ASN-271, STRUCTURE OF CARBOHYDRATES, IDENTIFICATION BY MASS SPECTROMETRY.
    36. "Human alpha 1-proteinase inhibitor. Crystal structure analysis of two crystal modifications, molecular model and preliminary analysis of the implications for function."
      Loebermann H., Tokuoka R., Deisenhofer J., Huber R.
      J. Mol. Biol. 177:531-556(1984) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS).
    37. "The S variant of human alpha 1-antitrypsin, structure and implications for function and metabolism."
      Engh R., Loebermann H., Schneider M., Wiegand G., Huber R., Laurell C.-B.
      Protein Eng. 2:407-415(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS).
    38. "Crystal structure of an uncleaved alpha 1-antitrypsin reveals the conformation of its inhibitory reactive loop."
      Song H.K., Lee K.N., Kwon K.-S., Yu M.-H., Suh S.W.
      FEBS Lett. 377:150-154(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.46 ANGSTROMS) OF 25-418.
    39. "Inhibitory conformation of the reactive loop of alpha 1-antitrypsin."
      Elliott P.R., Lomas D.A., Carrell R.W., Abrahams J.P.
      Nat. Struct. Biol. 3:676-681(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 26-418.
    40. "The native strains in the hydrophobic core and flexible reactive loop of a serine protease inhibitor: crystal structure of an uncleaved alpha1-antitrypsin at 2.7 A."
      Ryu S.-E., Choi H.-J., Kwon K.-S., Lee K.N., Yu M.-H.
      Structure 4:1181-1192(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 45-418.
    41. "Wild-type alpha 1-antitrypsin is in the canonical inhibitory conformation."
      Elliott P.R., Abrahams J.P., Lomas D.A.
      J. Mol. Biol. 275:419-425(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 26-418.
    42. "Structure of a serpin-protease complex shows inhibition by deformation."
      Huntington J.A., Read R.J., Carrell R.W.
      Nature 407:923-926(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 48-418 IN COMPLEX WITH BOVINE TRYPSIN.
    43. Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 44-418.
    44. "Topography of a 2.0 A structure of alpha1-antitrypsin reveals targets for rational drug design to prevent conformational disease."
      Elliott P.R., Pei X.Y., Dafforn T.R., Lomas D.A.
      Protein Sci. 9:1274-1281(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS).
    45. "A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops."
      Kim S.-J., Woo J.-R., Seo E.J., Yu M.-H., Ryu S.-E.
      J. Mol. Biol. 306:109-119(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 25-418.
    46. "Interactions causing the kinetic trap in serpin protein folding."
      Im H., Woo M.-S., Hwang K.Y., Yu M.-H.
      J. Biol. Chem. 277:46347-46354(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 25-418.
    47. "Canonical inhibitor-like interactions explain reactivity of alpha1-proteinase inhibitor Pittsburgh and antithrombin with proteinases."
      Dementiev A., Simonovic M., Volz K., Gettins P.G.
      J. Biol. Chem. 278:37881-37887(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 26-418 OF VARIANT PITTSBURGH ARG-382.
    48. "Alpha 1-antitrypsin: structure, function and molecular biology of the gene."
      Kalsheker N.
      Biosci. Rep. 9:129-138(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    49. "The molecular genetics of alpha 1 antitrypsin deficiency."
      Wu Y., Foreman R.C.
      Bioessays 13:163-169(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    50. "Characterization of the gene and protein of the common alpha 1-antitrypsin normal M2 allele."
      Nukiwa T., Brantly M.L., Ogushi F., Fells G.A., Crystal R.G.
      Am. J. Hum. Genet. 43:322-330(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION OF VARIANT M2.
    51. "Characterisation of the alpha-1-antitrypsin M3 gene, a normal variant."
      Graham A., Hayes K., Weidinger S., Newton C.R., Markham A.F., Kalsheker N.A.
      Hum. Genet. 85:381-382(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT M3 ASP-400.
    52. "Characterization of the molecular basis of the alpha 1-antitrypsin F allele."
      Okayama H., Brantly M., Holmes M., Crystal R.G.
      Am. J. Hum. Genet. 48:1154-1158(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT F CYS-247.
    53. "A Pro-->Leu substitution in codon 369 of the alpha-1-antitrypsin deficiency variant PI M-Heerlen."
      Hofker M.H., Nukiwa T., van Paassen H.M.B., Nelen M., Kramps J.A., Klasen E.C., Frants R.R., Crystal R.G.
      Hum. Genet. 81:264-268(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT M-HEERLEN LEU-393.
    54. "In-frame single codon deletion in the M-Malton deficiency allele of alpha 1-antitrypsin."
      Fraizer G.C., Harrold T.R., Hofker M.H., Cox D.W.
      Am. J. Hum. Genet. 44:894-902(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT M-MALTON PHE-75 DEL.
    55. "Molecular basis of alpha 1-antitrypsin deficiency and emphysema associated with the alpha 1-antitrypsin M-Mineral springs allele."
      Curiel D.T., Vogelmeier C., Hubbard R.C., Stier L.E., Crystal R.G.
      Mol. Cell. Biol. 10:47-56(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT M-MINERAL SPRINGS GLU-91.
    56. "Molecular analysis of the gene of the alpha 1-antitrypsin deficiency variant, M-Nichinan."
      Matsunaga E., Shiokawa S., Nakamura H., Maruyama T., Tsuda K., Fukumaki Y.
      Am. J. Hum. Genet. 46:602-612(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT M-NICHINAN PHE-75 DEL.
    57. "Characterization of the gene and protein of the alpha 1-antitrypsin 'deficiency' allele M-Procida."
      Takahashi H., Nukiwa T., Satoh K., Ogushi F., Brantly M., Fells G., Stier L., Courtney M., Crystal R.G.
      J. Biol. Chem. 263:15528-15534(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT M-PROCIDA PRO-65.
    58. "Genetic diversity from a limited repertoire of mutations on different common allelic backgrounds: alpha 1-antitrypsin deficiency variant P-Duarte."
      Hildesheim J., Kinsley G., Bissell M., Pierce J., Brantly M.
      Hum. Mutat. 2:221-228(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT P-DUARTE VAL-280.
    59. "Mutation of antitrypsin to antithrombin. Alpha 1-antitrypsin Pittsburgh (358 Met leads to Arg), a fatal bleeding disorder."
      Owen M.C., Brennan S.O., Lewis J.H., Carrell R.W.
      N. Engl. J. Med. 309:694-698(1983) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT OF VARIANT PITTSBURGH ARG-382 IN BLEEDING DIATHESIS.
    60. "Siiyama (serine 53 (TCC) to phenylalanine 53 (TTC)). A new alpha 1-antitrypsin-deficient variant with mutation on a predicted conserved residue of the serpin backbone."
      Seyama K., Nukiwa T., Takabe K., Takahashi H., Miyake K., Kira S.
      J. Biol. Chem. 266:12627-12632(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN A1ATD, VARIANT S-IIYAMA PHE-77.
    61. "Characterization of the normal alpha 1-antitrypsin allele V-Munich: a variant associated with a unique protein isoelectric focusing pattern."
      Holmes M.D., Brantly M.L., Curiel D.T., Weidinger S., Crystal R.G.
      Am. J. Hum. Genet. 46:810-816(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT V-MUNICH ALA-26.
    62. "Alpha 1-antitrypsin W-Bethesda: molecular basis of an unusual alpha 1-antitrypsin deficiency variant."
      Holmes M.D., Brantly M.L., Fells G.A., Crystal R.G.
      Biochem. Biophys. Res. Commun. 170:1013-1020(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN A1ATD, VARIANT W-BETHESDA THR-360.
    63. "Sequence data of the rare deficient alpha 1-antitrypsin variant PI Zaugsburg."
      Faber J.-P., Weidinger S., Olek K.
      Am. J. Hum. Genet. 46:1158-1162(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT Z-AUGSBURG LYS-366.
    64. "Molecular characterisation of two alpha-1-antitrypsin deficiency variants: proteinase inhibitor (Pi) Null(Newport) (Gly115-->Ser) and (Pi) Z Wrexham (Ser-19-->Leu)."
      Graham A., Kalsheker N.A., Bamforth F.J., Newton C.R., Markham A.F.
      Hum. Genet. 85:537-540(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN A1ATD, VARIANTS Z-WREXHAM LEU-4 AND Q0-NEWPORT SER-139.
    65. "Molecular characterisation of three alpha-1-antitrypsin deficiency variants: proteinase inhibitor (Pi) nullcardiff (Asp256-->Val); PiM-Malton (Phe51-->deletion) and PiI (Arg39-->Cys)."
      Graham A., Kalsheker N.A., Newton C.R., Bamforth F.J., Powell S.J., Markham A.F.
      Hum. Genet. 84:55-58(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS P-CARDIFF VAL-280; I CYS-63 AND M-MALTON PHE-75 DEL.
    66. "A null deficiency allele of alpha 1-antitrypsin, QO-Ludwigshafen, with altered tertiary structure."
      Fraizer G.C., Siewertsen M.A., Hofker M.H., Brubacher M.G., Cox D.W.
      J. Clin. Invest. 86:1878-1884(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT QO-LUDWIGSHAFEN ASN-116.
    67. "Identification and DNA sequence analysis of 15 new alpha 1-antitrypsin variants, including two PI*Q0 alleles and one deficient PI*M allele."
      Faber J.-P., Poller W., Weidinger S., Kirchgesser M., Schwaab R., Bidlingmaier F., Olek K.
      Am. J. Hum. Genet. 55:1113-1121(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS.
    68. "A new alpha 1-antitrypsin mutation, Thr-Met 85, (PI ZBristol) associated with novel electrophoretic properties."
      Lovegrove J.U., Jeremiah S., Gillett G.T., Temple I.K., Povey S., Whitehouse D.B.
      Ann. Hum. Genet. 61:385-391(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT Z-BRISTOL MET-109.
    69. "Identification and molecular characterization of the new alpha-1-antitrypsin deficient allele PI YBarcelona (Asp256Val and Pro391His)."
      Jardi R., Rodriguez F., Miravitlles M., Vidal R., Cotrina M., Quer J., Pascual C., Weidinger S.
      Hum. Mutat. 12:213-213(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS Y-BARCELONA VAL-280 AND HIS-415.
    70. "A novel alpha-1-antitrypsin P362H variant found in a population sample from Sao Tome e Principe (Gulf of Guinea, West Africa)."
      Seixas S., Trovoada M.J., Santos M.T., Rocha J.
      Hum. Mutat. 13:414-414(1999)
      Cited for: VARIANT SAO TOME HIS-386.
    71. "A novel alpha-1-antitrypsin r281del variant found in a population sample from the Basque country."
      Seixas S., Garcia O., Amorim A., Rocha J.
      Hum. Mutat. 15:121-122(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT BASQUE ARG-305 DEL.
    72. Cited for: VARIANTS Z ALA-237 AND LYS-366, VARIANT S VAL-288, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION, INTERACTION WITH CANX AND PDIA3.

    Entry informationi

    Entry nameiA1AT_HUMAN
    AccessioniPrimary (citable) accession number: P01009
    Secondary accession number(s): A6PX14
    , B2RDQ8, Q0PVP5, Q13672, Q53XB8, Q5U0M1, Q7M4R2, Q86U18, Q86U19, Q96BF9, Q96ES1, Q9P1P0, Q9UCE6, Q9UCM3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 21, 1986
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 209 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The aberrant form is found in the plasma of chronic smokers, and persists after smoking is ceased. It can still be found ten years after smoking has ceased.

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3