P01009 (A1AT_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 18, 2012.
Version 183.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Alpha-1-antitrypsin Alternative name(s): Alpha-1 protease inhibitor Alpha-1-antiproteinase Serpin A1 Cleaved into the following chain:
| ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 418 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin. Ref.17 Ref.18 Ref.24 Short peptide from AAT (SPAAT) is a reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE). Ref.17 Ref.18 Ref.24 |
| Subcellular location | Short peptide from AAT: Secreted › extracellular space › extracellular matrix Ref.24. |
| Tissue specificity | Plasma. |
| Domain | The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable. |
| Post-translational modification | N-glycosylated. Differential glycosylation produces a number of isoforms. N-linked glycan at Asn-107 is alternatively di-antennary, tri-antennary or tetra-antennary. The glycan at Asn-70 is di-antennary with trace amounts of tri-antennary. Glycan at Asn-271 is exclusively di-antennary. Structure of glycans at Asn-70 and Asn-271 is Hex5HexNAc4. The structure of the antennae is Neu5Ac(alpha1-6)Gal(beta1-4)GlcNAc attached to the core structure Man(alpha1-6)[Man(alpha1-3)]Man(beta1-4)GlcNAc(beta1-4)GlcNAc. Some antennae are fucosylated, which forms a Lewis-X determinant. Ref.19 Ref.26 Ref.27 Ref.28 Ref.29 Ref.30 Ref.31 Ref.32 Ref.34 Proteolytic processing may yield the truncated form that ranges from Asp-30 to Lys-418. |
| Polymorphism | The sequence shown is that of the M1V allele which is the most common form of PI (44 to 49%). Other frequent alleles are: M1A 20 to 23%; M2 10 to 11%; M3 14 to 19%. |
| Involvement in disease | Defects in SERPINA1 are the cause of alpha-1-antitrypsin deficiency (A1ATD) [MIM:613490]. A disorder whose most common manifestation is emphysema, which becomes evident by the third to fourth decade. A less common manifestation of the deficiency is liver disease, which occurs in children and adults, and may result in cirrhosis and liver failure. Environmental factors, particularly cigarette smoking, greatly increase the risk of emphysema at an earlier age. Ref.59 Ref.61 Ref.63 |
| Miscellaneous | The aberrant form is found in the plasma of chronic smokers, and persists after smoking is ceased. It can still be found ten years after smoking has ceased. |
| Sequence similarities | Belongs to the serpin family. |
| Sequence caution | The sequence CAD62334.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAD62585.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| P00760 | 3 | EBI-986224,EBI-986385 | From a different organism. | |
| CELA1 | P00772 | 2 | EBI-986224,EBI-986248 | From a different organism. |
| espB | P71213 | 3 | EBI-986224,EBI-2615322 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P01009-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P01009-2) The sequence of this isoform differs from the canonical sequence as follows: 356-418: AVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK → VRSP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P01009-3) The sequence of this isoform differs from the canonical sequence as follows: 307-418: Missing. | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Ref.15 Ref.16 Ref.17 Ref.18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 25 – 418 | 394 | Alpha-1-antitrypsin Ref.2 | PRO_0000032377 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Peptide | 375 – 418 | 44 | Short peptide from AAT | PRO_0000364030 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 368 – 392 | 25 | RCL | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 382 – 383 | 2 | Reactive bond | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 256 | 1 | S-cysteinyl cysteine | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 70 | 1 | N-linked (GlcNAc...) (complex) Ref.19 Ref.26 Ref.27 Ref.28 Ref.29 Ref.30 Ref.31 Ref.32 Ref.34 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 107 | 1 | N-linked (GlcNAc...) (complex) Ref.19 Ref.29 Ref.31 Ref.32 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 271 | 1 | N-linked (GlcNAc...) (complex) Ref.19 Ref.26 Ref.27 Ref.28 Ref.29 Ref.31 Ref.32 Ref.34 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 307 – 418 | 112 | Missing in isoform 3. | VSP_028890 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 356 – 418 | 63 | AVHKA…NPTQK → VRSP in isoform 2. | VSP_028889 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4 | 1 | S → L in Z-Wrexham. Ref.63 | VAR_006978 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 26 | 1 | D → A in V-Munich. Ref.60 | VAR_006979 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 37 | 1 | T → A. Corresponds to variant rs11558262 [ dbSNP | Ensembl ]. | VAR_051938 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 58 | 1 | A → T in M5-Karlsruhe. | VAR_006980 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 63 | 1 | R → C in I. Ref.64 Corresponds to variant rs28931570 [ dbSNP | Ensembl ]. | VAR_006981 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 65 | 1 | L → P in M-Procida. Ref.56 Corresponds to variant rs28931569 [ dbSNP | Ensembl ]. | VAR_006982 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 69 | 1 | S → F in M6-Bonn. | VAR_006983 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 75 | 1 | Missing in M-Malton, M-Nichinan and M-Palermo; associated with very low serum levels of AAT; homozygosity for allele M-Malton may be associated with a risk for chronic emphysema or infantile liver cirrhosis. Ref.53 Ref.55 Ref.64 | VAR_006984 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 77 | 1 | S → F in S-Iiyama. Ref.59 Corresponds to variant rs55819880 [ dbSNP | Ensembl ]. | VAR_006985 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 84 | 1 | A → T in M6-Passau. | VAR_006986 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 91 | 1 | G → E in M-Mineral springs; causes reduced AAT secretion. Ref.54 Corresponds to variant rs28931568 [ dbSNP | Ensembl ]. | VAR_006987 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 92 | 1 | T → I in QO-Lisbon; deficient AAT with very low serum levels. | VAR_006988 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 109 | 1 | T → M in Z-Bristol; deficient AA; disrupts the N-glycosylation site N-107. Ref.67 | VAR_011620 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 112 | 1 | P → T in M5-Berlin. | VAR_006989 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 116 | 1 | I → N in QO-Ludwigshafen. Ref.65 Corresponds to variant rs28931572 [ dbSNP | Ensembl ]. | VAR_006990 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 125 | 1 | R → H in M2; associated with D-400. Corresponds to variant rs709932 [ dbSNP | Ensembl ]. | VAR_006991 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 139 | 1 | G → S in QO-Newport. Ref.63 Corresponds to variant rs11558261 [ dbSNP | Ensembl ]. | VAR_006992 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 172 | 1 | G → R in V and M-Nichinan. | VAR_006993 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 172 | 1 | G → W in M2-Obernburg. Ref.8 | VAR_006994 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 180 | 1 | Q → E in L-Frankfurt. | VAR_006995 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 190 – 198 | 9 | QGKIVDLVK → GFQNAILVR in Aberrant form. | VAR_036746 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 228 | 1 | E → K in X. | VAR_006996 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 237 | 1 | V → A in M1A and Z; associated with K-366 in Z. Ref.7 Ref.8 Ref.12 Corresponds to variant rs6647 [ dbSNP | Ensembl ]. | VAR_006997 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 247 | 1 | R → C in F. Ref.51 Corresponds to variant rs28929470 [ dbSNP | Ensembl ]. | VAR_006998 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 280 | 1 | D → V in P-Duarte/P-Cardiff/P-Lowell; associated with H-415 in Y-Barcelona. Ref.57 Ref.64 Ref.68 Corresponds to variant rs28929472 [ dbSNP | Ensembl ]. | VAR_006999 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 288 | 1 | E → V in S and T. Ref.17 Corresponds to variant rs17580 [ dbSNP | Ensembl ]. | VAR_007000 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 305 | 1 | Missing in Basque. Ref.70 | VAR_009216 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 354 | 1 | S → F in S-Munich. | VAR_007001 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 360 | 1 | A → T in W-Bethesda. Ref.61 Corresponds to variant rs1802959 [ dbSNP | Ensembl ]. | VAR_007002 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 365 | 1 | D → N in P-St.Albans/P-Donauwoerth. | VAR_007003 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 366 | 1 | E → K in Z/Z-Augsburg/Z-Tun; associated with A-237 in Z. Ref.8 Ref.62 Corresponds to variant rs28929474 [ dbSNP | Ensembl ]. | VAR_007004 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 382 | 1 | M → R in Pittsburgh; has antithrombin activity; causes fatal bleeding diathesis. Ref.46 Ref.58 | VAR_007005 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 386 | 1 | P → H in Sao Tome. Ref.69 | VAR_007006 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 386 | 1 | P → T in L-Offenbach. | VAR_007007 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 387 | 1 | E → K in Christchurch. | VAR_007008 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 393 | 1 | P → L in M-Heerlen. Ref.52 | VAR_007009 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 400 | 1 | E → D in M2 and M3; associated with H-125 in M2. Ref.7 Ref.50 Corresponds to variant rs1303 [ dbSNP | Ensembl ]. | VAR_007010 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 415 | 1 | P → H in Y-Barcelona; associated with V-280. Ref.68 | VAR_007011 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 382 | 1 | M → V: Oxidation-resistant inhibitor of therapeutic importance. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 12 | 1 | Missing in AAA51546. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 23 | 1 | L → P in BAG38005. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 26 | 1 | D → H AA sequence Ref.18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 39 | 1 | H → L AA sequence Ref.18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 61 | 1 | L → P in AAF29581. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 96 | 1 | T → A in ABG73380. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 139 – 140 | 2 | GN → DG in AAB59375. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 174 | 1 | T → H in AAA51546. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 229 | 1 | E → D in AAA51546. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 273 | 1 | T → N in AAB59375. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 280 | 1 | D → G in ABG73380. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 326 | 1 | V → I in CAA25838. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 410 | 1 | G → L AA sequence Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 414 | 1 | N → S AA sequence Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 48 – 50 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 51 – 68 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 72 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 74 – 76 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 78 – 89 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 94 – 103 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 108 – 110 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 113 – 127 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 135 – 145 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 152 – 160 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 165 – 169 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 174 – 188 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 189 – 191 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 206 – 215 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 218 – 220 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 224 – 226 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 228 – 237 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 239 – 256 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 257 – 260 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 261 – 268 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 269 – 271 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 272 – 279 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 290 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 299 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 306 – 313 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 315 – 322 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 323 – 329 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 334 – 336 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 343 – 345 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 346 – 349 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 355 – 364 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 387 – 389 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 394 – 400 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 401 – 403 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 406 – 413 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression in Escherichia coli of full-length complementary DNA coding for human alpha 1-antitrypsin." Bollen A., Herzog A., Cravador A., Herion P., Chuchana P., van der Straten A., Loriau R., Jacobs P., van Elsen A. DNA 2:255-264(1983) [PubMed: 6319097] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequence of the cDNA for human alpha 1-antitrypsin and the gene for the S variant." Long G.L., Chandra T., Woo S.L.C., Davie E.W., Kurachi K. Biochemistry 23:4828-4837(1984) [PubMed: 6093867] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Synthesis in yeast of a functional oxidation-resistant mutant of human alpha-antitrypsin." Rosenberg S., Barr P.J., Najarian R.C., Hallewell R.A. Nature 312:77-80(1984) [PubMed: 6387509] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), MUTAGENESIS OF MET-382. |
| [4] | "Cell-specific expression of a transfected human alpha 1-antitrypsin gene." Ciliberto G., Dente L., Cortese R. Cell 41:531-540(1985) [PubMed: 2985281] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "Identification of a second mutation in the protein-coding sequence of the Z type alpha 1-antitrypsin gene." Nukiwa T., Satoh K., Brantly M.L., Ogushi F., Fells G.A., Courtney M., Crystal R.G. J. Biol. Chem. 261:15989-15994(1986) [PubMed: 3491072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], CHARACTERIZATION OF VARIANT Z. |
| [6] | Erratum Nukiwa T., Satoh K., Brantly M.L., Ogushi F., Fells G.A., Courtney M., Crystal R.G. J. Biol. Chem. 262:10412-10412(1987) |
| [7] | "An alpha-1 antitrypsin genetic variant from India." Shasany A.K., Shukla A.K., Darokar M.P., Saraiya M., Chaturvedi N., Tewari L., Khanuja S.P. Indian J. Biochem. Biophys. 44:176-178(2007) [PubMed: 17650587] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ALA-237 AND ASP-400. Tissue: Liver. |
| [8] | "Characterization of a new variant of alpha1 antitrypsin M Lille (p.Gly148Trp)." Balduyck M., Porchet N., Aubert J.-P., Zerimech F., Douchain F., Verchain S. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TRP-172; ALA-237 AND LYS-366. Tissue: Lymphocyte. |
| [9] | "Functional prediction of the coding sequences of 32 new genes deduced by analysis of cDNA clones from human fetal liver." Zhang C., Yu Y., Zhang S., Ouyang S., Luo L., Wei H., Zhou G., Zhou W., Bi J., Zhang Y., Liu M., He F. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Fetal liver. |
| [10] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Fetal liver and Placenta. |
| [11] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Synovium. |
| [12] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-237. |
| [13] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon and Ovary. |
| [14] | "Sequence homology and structural comparison between the chromosomal human alpha 1-antitrypsin and chicken ovalbumin genes." Leicht M., Long G.L., Chandra T., Kurachi K., Kidd V.J., Mace M. Jr., Davie E.W., Woo S.L.C. Nature 297:655-659(1982) [PubMed: 6979715] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-67; 196-255 AND 387-418. |
| [15] | "The covalent structure of human alpha1-protease inhibitor." Chan S.K. Fed. Proc. 41:1016-1016(1982) Cited for: PRELIMINARY PROTEIN SEQUENCE OF 25-418 (ISOFORM 1). |
| [16] | "Structure and variation of human alpha 1-antitrypsin." Carrell R.W., Jeppsson J.-O., Laurell C.-B., Brennan S.O., Owen M.C., Vaughan L., Boswell D.R. Nature 298:329-334(1982) [PubMed: 7045697] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-418 (ISOFORM 1). |
| [17] | "Appearance of an aberrant form of alpha-antitrypsin in the circulation of chronic cigarette smokers and its effect on the insulin induced NO synthesis in blood platelets." Sinha A.K., Girish G.V. Submitted (AUG-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 25-418 (ISOFORM 1), VARIANTS ABERRANT FORM 190-GLY--ARG-198 AND VAL-288, FUNCTION. Tissue: Blood. |
| [18] | "Characterization of a 54 kDa, alpha 1-antitrypsin-like protein isolated from ascitic fluid of an endometrial cancer patient." Tanaka N., Sekiya S., Takamizawa H., Kato N., Moriyama Y., Fujimura S. Jpn. J. Cancer Res. 82:693-700(1991) [PubMed: 1906855] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-39, FUNCTION. Tissue: Ascites. |
| [19] | "Comprehensive glyco-proteomic analysis of human alpha1-antitrypsin and its charge isoforms." Kolarich D., Weber A., Turecek P.L., Schwarz H.P., Altmann F. Proteomics 6:3369-3380(2006) [PubMed: 16622833] [Abstract] Cited for: PROTEIN SEQUENCE OF 30-48 AND 248-257 (ISOFORMS 1/2/3), GLYCOSYLATION AT ASN-70; ASN-107 AND ASN-271, STRUCTURE OF CARBOHYDRATES, CYSTEINE-BINDING, MASS SPECTROMETRY. |
| [20] | "Sequencing of a urinary stone protein, identical to alpha-one antitrypsin, which lacks 22 amino acids." Umekawa T., Kohri K., Amasaki N., Yamate T., Yoshida K., Yamamoto K., Suzuki Y., Sinohara H., Kurita T. Biochem. Biophys. Res. Commun. 193:1049-1053(1993) [PubMed: 8323530] [Abstract] Cited for: PROTEIN SEQUENCE OF 47-66. Tissue: Urine. |
| [21] | Lubec G., Afjehi-Sadat L. Submitted (MAR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 50-63 AND 161-178 (ISOFORMS 1/2/3), MASS SPECTROMETRY. Tissue: Brain and Cajal-Retzius cell. |
| [22] | "Alpha 1-antitrypsin and serum albumin mRNA accumulation in normal, acute phase and ZZ human liver." Riley J.H., Bathurst I.C., Edbrooke M.R., Carrell R.W., Craig R.K. FEBS Lett. 189:361-366(1985) [PubMed: 3876243] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 292-418 (ISOFORM 1). |
| [23] | "Cloning and sequence of cDNA coding for alpha 1-antitrypsin." Kurachi K., Chandra T., Friezner Degen S.J., White T.T., Marchioro T.L., Woo S.L.C., Davie E.W. Proc. Natl. Acad. Sci. U.S.A. 78:6826-6830(1981) [PubMed: 7031661] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 350-418 (ISOFORM 1). |
| [24] | "Isolation and serine protease inhibitory activity of the 44-residue, C-terminal fragment of alpha 1-antitrypsin from human placenta." Niemann M.A., Narkates A.J., Miller E.J. Matrix 12:233-241(1992) [PubMed: 1406456] [Abstract] Cited for: PROTEIN SEQUENCE OF 375-414, IDENTIFICATION OF SPAAT, FUNCTION, SUBCELLULAR LOCATION. Tissue: Placenta. |
| [25] | "Construction and partial characterization of a human liver cDNA library." Coutelle C., Speer A., Rogers J., Kalsheker N., Humphries S., Williamson R. Biomed. Biochim. Acta 44:421-431(1985) [PubMed: 3873938] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 387-418 (ISOFORM 1). |
| [26] | "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." Zhang H., Li X.-J., Martin D.B., Aebersold R. Nat. Biotechnol. 21:660-666(2003) [PubMed: 12754519] [Abstract] Cited for: GLYCOSYLATION AT ASN-70 AND ASN-271. |
| [27] | "A proteomic analysis of human bile." Kristiansen T.Z., Bunkenborg J., Gronborg M., Molina H., Thuluvath P.J., Argani P., Goggins M.G., Maitra A., Pandey A. Mol. Cell. Proteomics 3:715-728(2004) [PubMed: 15084671] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70 AND ASN-271, MASS SPECTROMETRY. Tissue: Bile. |
| [28] | "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry." Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. Proteomics 4:454-465(2004) [PubMed: 14760718] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70 AND ASN-271, MASS SPECTROMETRY. Tissue: Plasma. |
| [29] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70; ASN-107 AND ASN-271, MASS SPECTROMETRY. Tissue: Plasma. |
| [30] | "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach." Lewandrowski U., Moebius J., Walter U., Sickmann A. Mol. Cell. Proteomics 5:226-233(2006) [PubMed: 16263699] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70, MASS SPECTROMETRY. Tissue: Platelet. |
| [31] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70; ASN-107 AND ASN-271, MASS SPECTROMETRY. Tissue: Liver. |
| [32] | "Enrichment of glycopeptides for glycan structure and attachment site identification." Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E., Brinkmalm G., Larson G. Nat. Methods 6:809-811(2009) [PubMed: 19838169] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-70; ASN-107 AND ASN-271, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. Tissue: Cerebrospinal fluid. |
| [33] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [34] | "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD." Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. Mol. Cell. Proteomics 0:0-0(2011) [PubMed: 22171320] [Abstract] Cited for: GLYCOSYLATION AT ASN-70 AND ASN-271, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. |
| [35] | "Human alpha 1-proteinase inhibitor. Crystal structure analysis of two crystal modifications, molecular model and preliminary analysis of the implications for function." Loebermann H., Tokuoka R., Deisenhofer J., Huber R. J. Mol. Biol. 177:531-556(1984) [PubMed: 6332197] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS). |
| [36] | "The S variant of human alpha 1-antitrypsin, structure and implications for function and metabolism." Engh R., Loebermann H., Schneider M., Wiegand G., Huber R., Laurell C.-B. Protein Eng. 2:407-415(1989) [PubMed: 2785270] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS). |
| [37] | "Crystal structure of an uncleaved alpha 1-antitrypsin reveals the conformation of its inhibitory reactive loop." Song H.K., Lee K.N., Kwon K.-S., Yu M.-H., Suh S.W. FEBS Lett. 377:150-154(1995) [PubMed: 8543039] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.46 ANGSTROMS) OF 25-418. |
| [38] | "Inhibitory conformation of the reactive loop of alpha 1-antitrypsin." Elliott P.R., Lomas D.A., Carrell R.W., Abrahams J.P. Nat. Struct. Biol. 3:676-681(1996) [PubMed: 8756325] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 26-418. |
| [39] | "The native strains in the hydrophobic core and flexible reactive loop of a serine protease inhibitor: crystal structure of an uncleaved alpha1-antitrypsin at 2.7 A." Ryu S.-E., Choi H.-J., Kwon K.-S., Lee K.N., Yu M.-H. Structure 4:1181-1192(1996) [PubMed: 8939743] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 45-418. |
| [40] | "Wild-type alpha 1-antitrypsin is in the canonical inhibitory conformation." Elliott P.R., Abrahams J.P., Lomas D.A. J. Mol. Biol. 275:419-425(1998) [PubMed: 9466920] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 26-418. |
| [41] | "Structure of a serpin-protease complex shows inhibition by deformation." Huntington J.A., Read R.J., Carrell R.W. Nature 407:923-926(2000) [PubMed: 11057674] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 48-418 IN COMPLEX WITH BOVINE TRYPSIN. |
| [42] | "Cleaved antitrypsin polymers at atomic resolution." Dunstone M.A., Dai W., Whisstock J.C., Rossjohn J., Pike R.N., Feil S.C., Le Bonniec B.F., Parker M.W., Bottomley S.P. Protein Sci. 9:417-420(2000) [PubMed: 10716194] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 44-418. |
| [43] | "Topography of a 2.0 A structure of alpha1-antitrypsin reveals targets for rational drug design to prevent conformational disease." Elliott P.R., Pei X.Y., Dafforn T.R., Lomas D.A. Protein Sci. 9:1274-1281(2000) [PubMed: 10933492] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS). |
| [44] | "A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops." Kim S.-J., Woo J.-R., Seo E.J., Yu M.-H., Ryu S.-E. J. Mol. Biol. 306:109-119(2001) [PubMed: 11178897] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 25-418. |
| [45] | "Interactions causing the kinetic trap in serpin protein folding." Im H., Woo M.-S., Hwang K.Y., Yu M.-H. J. Biol. Chem. 277:46347-46354(2002) [PubMed: 12244055] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 25-418. |
| [46] | "Canonical inhibitor-like interactions explain reactivity of alpha1-proteinase inhibitor Pittsburgh and antithrombin with proteinases." Dementiev A., Simonovic M., Volz K., Gettins P.G. J. Biol. Chem. 278:37881-37887(2003) [PubMed: 12860985] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 26-418 OF VARIANT PITTSBURGH ARG-382. |
| [47] | "Alpha 1-antitrypsin: structure, function and molecular biology of the gene." Kalsheker N. Biosci. Rep. 9:129-138(1989) [PubMed: 2669992] [Abstract] Cited for: REVIEW. |
| [48] | "The molecular genetics of alpha 1 antitrypsin deficiency." Wu Y., Foreman R.C. Bioessays 13:163-169(1991) [PubMed: 1859394] [Abstract] Cited for: REVIEW. |
| [49] | "Characterization of the gene and protein of the common alpha 1-antitrypsin normal M2 allele." Nukiwa T., Brantly M.L., Ogushi F., Fells G.A., Crystal R.G. Am. J. Hum. Genet. 43:322-330(1988) [PubMed: 2901226] [Abstract] Cited for: CHARACTERIZATION OF VARIANT M2. |
| [50] | "Characterisation of the alpha-1-antitrypsin M3 gene, a normal variant." Graham A., Hayes K., Weidinger S., Newton C.R., Markham A.F., Kalsheker N.A. Hum. Genet. 85:381-382(1990) [PubMed: 2394452] [Abstract] Cited for: VARIANT M3 ASP-400. |
| [51] | "Characterization of the molecular basis of the alpha 1-antitrypsin F allele." Okayama H., Brantly M., Holmes M., Crystal R.G. Am. J. Hum. Genet. 48:1154-1158(1991) [PubMed: 2035534] [Abstract] Cited for: VARIANT F CYS-247. |
| [52] | "A Pro-->Leu substitution in codon 369 of the alpha-1-antitrypsin deficiency variant PI M-Heerlen." Hofker M.H., Nukiwa T., van Paassen H.M.B., Nelen M., Kramps J.A., Klasen E.C., Frants R.R., Crystal R.G. Hum. Genet. 81:264-268(1989) [PubMed: 2784123] [Abstract] Cited for: VARIANT M-HEERLEN LEU-393. |
| [53] | "In-frame single codon deletion in the M-Malton deficiency allele of alpha 1-antitrypsin." Fraizer G.C., Harrold T.R., Hofker M.H., Cox D.W. Am. J. Hum. Genet. 44:894-902(1989) [PubMed: 2786335] [Abstract] Cited for: VARIANT M-MALTON PHE-75 DEL. |
| [54] | "Molecular basis of alpha 1-antitrypsin deficiency and emphysema associated with the alpha 1-antitrypsin M-Mineral springs allele." Curiel D.T., Vogelmeier C., Hubbard R.C., Stier L.E., Crystal R.G. Mol. Cell. Biol. 10:47-56(1990) [PubMed: 1967187] [Abstract] Cited for: VARIANT M-MINERAL SPRINGS GLU-91. |
| [55] | "Molecular analysis of the gene of the alpha 1-antitrypsin deficiency variant, M-Nichinan." Matsunaga E., Shiokawa S., Nakamura H., Maruyama T., Tsuda K., Fukumaki Y. Am. J. Hum. Genet. 46:602-612(1990) [PubMed: 2309708] [Abstract] Cited for: VARIANT M-NICHINAN PHE-75 DEL. |
| [56] | "Characterization of the gene and protein of the alpha 1-antitrypsin 'deficiency' allele M-Procida." Takahashi H., Nukiwa T., Satoh K., Ogushi F., Brantly M., Fells G., Stier L., Courtney M., Crystal R.G. J. Biol. Chem. 263:15528-15534(1988) [PubMed: 3262617] [Abstract] Cited for: VARIANT M-PROCIDA PRO-65. |
| [57] | "Genetic diversity from a limited repertoire of mutations on different common allelic backgrounds: alpha 1-antitrypsin deficiency variant P-Duarte." Hildesheim J., Kinsley G., Bissell M., Pierce J., Brantly M. Hum. Mutat. 2:221-228(1993) [PubMed: 8364590] [Abstract] Cited for: VARIANT P-DUARTE VAL-280. |
| [58] | "Mutation of antitrypsin to antithrombin. Alpha 1-antitrypsin Pittsburgh (358 Met leads to Arg), a fatal bleeding disorder." Owen M.C., Brennan S.O., Lewis J.H., Carrell R.W. N. Engl. J. Med. 309:694-698(1983) [PubMed: 6604220] [Abstract] Cited for: INVOLVEMENT OF VARIANT PITTSBURGH ARG-382 IN BLEEDING DIATHESIS. |
| [59] | "Siiyama (serine 53 (TCC) to phenylalanine 53 (TTC)). A new alpha 1-antitrypsin-deficient variant with mutation on a predicted conserved residue of the serpin backbone." Seyama K., Nukiwa T., Takabe K., Takahashi H., Miyake K., Kira S. J. Biol. Chem. 266:12627-12632(1991) [PubMed: 1905728] [Abstract] Cited for: INVOLVEMENT IN A1ATD, VARIANT S-IIYAMA PHE-77. |
| [60] | "Characterization of the normal alpha 1-antitrypsin allele V-Munich: a variant associated with a unique protein isoelectric focusing pattern." Holmes M.D., Brantly M.L., Curiel D.T., Weidinger S., Crystal R.G. Am. J. Hum. Genet. 46:810-816(1990) [PubMed: 2316526] [Abstract] Cited for: VARIANT V-MUNICH ALA-26. |
| [61] | "Alpha 1-antitrypsin W-Bethesda: molecular basis of an unusual alpha 1-antitrypsin deficiency variant." Holmes M.D., Brantly M.L., Fells G.A., Crystal R.G. Biochem. Biophys. Res. Commun. 170:1013-1020(1990) [PubMed: 2390072] [Abstract] Cited for: INVOLVEMENT IN A1ATD, VARIANT W-BETHESDA THR-360. |
| [62] | "Sequence data of the rare deficient alpha 1-antitrypsin variant PI Zaugsburg." Faber J.-P., Weidinger S., Olek K. Am. J. Hum. Genet. 46:1158-1162(1990) [PubMed: 2339709] [Abstract] Cited for: VARIANT Z-AUGSBURG LYS-366. |
| [63] | "Molecular characterisation of two alpha-1-antitrypsin deficiency variants: proteinase inhibitor (Pi) Null(Newport) (Gly115-->Ser) and (Pi) Z Wrexham (Ser-19-->Leu)." Graham A., Kalsheker N.A., Bamforth F.J., Newton C.R., Markham A.F. Hum. Genet. 85:537-540(1990) [PubMed: 2227940] [Abstract] Cited for: INVOLVEMENT IN A1ATD, VARIANTS Z-WREXHAM LEU-4 AND Q0-NEWPORT SER-139. |
| [64] | "Molecular characterisation of three alpha-1-antitrypsin deficiency variants: proteinase inhibitor (Pi) nullcardiff (Asp256-->Val); PiM-Malton (Phe51-->deletion) and PiI (Arg39-->Cys)." Graham A., Kalsheker N.A., Newton C.R., Bamforth F.J., Powell S.J., Markham A.F. Hum. Genet. 84:55-58(1989) [PubMed: 2606478] [Abstract] Cited for: VARIANTS P-CARDIFF VAL-280; I CYS-63 AND M-MALTON PHE-75 DEL. |
| [65] | "A null deficiency allele of alpha 1-antitrypsin, QO-Ludwigshafen, with altered tertiary structure." Fraizer G.C., Siewertsen M.A., Hofker M.H., Brubacher M.G., Cox D.W. J. Clin. Invest. 86:1878-1884(1990) [PubMed: 2254451] [Abstract] Cited for: VARIANT QO-LUDWIGSHAFEN ASN-116. |
| [66] | "Identification and DNA sequence analysis of 15 new alpha 1-antitrypsin variants, including two PI*Q0 alleles and one deficient PI*M allele." Faber J.-P., Poller W., Weidinger S., Kirchgesser M., Schwaab R., Bidlingmaier F., Olek K. Am. J. Hum. Genet. 55:1113-1121(1994) [PubMed: 7977369] [Abstract] Cited for: VARIANTS. |
| [67] | "A new alpha 1-antitrypsin mutation, Thr-Met 85, (PI ZBristol) associated with novel electrophoretic properties." Lovegrove J.U., Jeremiah S., Gillett G.T., Temple I.K., Povey S., Whitehouse D.B. Ann. Hum. Genet. 61:385-391(1997) [PubMed: 9459000] [Abstract] Cited for: VARIANT Z-BRISTOL MET-109. |
| [68] | "Identification and molecular charaterization of the new alpha-1-antitrypsin deficient allele PI YBarcelona (Asp256Val and Pro391His)." Jardi R., Rodriguez F., Miravitlles M., Vidal R., Cotrina M., Quer J., Pascual C., Weidinger S. Hum. Mutat. 12:213-213(1998) [PubMed: 10651487] [Abstract] Cited for: VARIANTS Y-BARCELONA VAL-280 AND HIS-415. |
| [69] | "A novel alpha-1-antitrypsin P362H variant found in a population sample from Sao Tome e Principe (Gulf of Guinea, West Africa)." Seixas S., Trovoada M.J., Santos M.T., Rocha J. Hum. Mutat. 13:414-414(1999) Cited for: VARIANT SAO TOME HIS-386. |
| [70] | "A novel alpha-1-antitrypsin r281del variant found in a population sample from the Basque country." Seixas S., Garcia O., Amorim A., Rocha J. Hum. Mutat. 15:121-122(2000) [PubMed: 10612848] [Abstract] Cited for: VARIANT BASQUE ARG-305 DEL. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Wikipedia Alpha-1 antitrypsin entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | K01396 mRNA. Translation: AAB59375.1. K02212 Genomic DNA. Translation: AAB59495.1. X01683 mRNA. Translation: CAA25838.1. M11465 mRNA. Translation: AAA51546.1. J02619 Genomic DNA. Translation: AAA51547.1. DQ682455 mRNA. Translation: ABG73380.1. AM048838 Genomic DNA. Translation: CAJ15161.1. AF113676 mRNA. Translation: AAF29581.1. AF130068 mRNA. Translation: AAG35496.1. BX161449 mRNA. Translation: CAD61914.1. BX247968 mRNA. Translation: CAD62306.1. BX248002 mRNA. Translation: CAD62334.1. Different initiation. BX248257 mRNA. Translation: CAD62585.1. Different initiation. AK315637 mRNA. Translation: BAG38005.1. BT019455 mRNA. Translation: AAV38262.1. BC011991 mRNA. Translation: AAH11991.1. BC015642 mRNA. Translation: AAH15642.1. J00064 Genomic DNA. Translation: AAB59369.1. J00066, J00065 Genomic DNA. Translation: AAB59370.1. J00067 Genomic DNA. Translation: AAB59371.1. X02920 mRNA. Translation: CAA26677.1. V00496 mRNA. Translation: CAA23755.1. M26123 mRNA. Translation: AAA51545.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00553177. IPI00790784. IPI00869004. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | ITHU. A21853. A61391. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000286.3. NM_000295.4. NP_001002235.1. NM_001002235.2. NP_001002236.1. NM_001002236.2. NP_001121172.1. NM_001127700.1. NP_001121173.1. NM_001127701.1. NP_001121174.1. NM_001127702.1. NP_001121175.1. NM_001127703.1. NP_001121176.1. NM_001127704.1. NP_001121177.1. NM_001127705.1. NP_001121178.1. NM_001127706.1. NP_001121179.1. NM_001127707.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.525557. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P01009. Positions 48-417. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P01009. 15 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-365327. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MEROPS | I04.001. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GlycoSuiteDB | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 1703025. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cornea-2DPAGE | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DOSAC-COBS-2DPAGE | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OGP | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00553177. P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Siena-2DPAGE | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SWISS-2DPAGE | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCD-2DPAGE | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000355814; ENSP00000348068; ENSG00000197249. ENST00000393087; ENSP00000376802; ENSG00000197249. ENST00000393088; ENSP00000376803; ENSG00000197249. ENST00000404814; ENSP00000385960; ENSG00000197249. ENST00000426226; ENSP00000415603; ENSG00000197249. ENST00000437074; ENSP00000408878; ENSG00000197249. ENST00000437397; ENSP00000408474; ENSG00000197249. ENST00000440909; ENSP00000390299; ENSG00000197249. ENST00000448140; ENSP00000416462; ENSG00000197249. ENST00000448921; ENSP00000416066; ENSG00000197249. ENST00000449399; ENSP00000416354; ENSG00000197249. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001ycx.4. human. uc001yda.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC14M094843. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0011929. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:8941. SERPINA1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB013211. CAB016648. HPA000927. HPA001292. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 107400. gene. 613490. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 60. Alpha-1 antitrypsin deficiency. 178396. Hemorrhagic disease due to alpha-1 antitrypsin Pittsburgh mutation. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA35509. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG4826. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00560000076583. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG005957. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K03984. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | PMMNRLG. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4FR0S4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | hnf3apathway. FOXA1 transcription factor network. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_604. Hemostasis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000197249. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000215. Protease_inhib_I4_serpin. IPR023795. Protease_inhib_I4_serpin_CS. IPR023796. Sepin_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11461. Prot_inh_serpin. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00079. Serpin. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00093. SERPIN. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF56574. Prot_inh_serpin. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00284. SERPIN. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00058. Alpha-1-proteinase inhibitor. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 20336. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P01009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | A1AT_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P01009 Secondary accession number(s): A6PX14 Q9UCM3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with