Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

2'-5'-oligoadenylate synthase 1

Gene

OAS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.4 Publications

Catalytic activityi

3 ATP = pppA2'p5'A2'p5'A + 2 diphosphate.2 Publications

Cofactori

Mg2+1 Publication

Enzyme regulationi

Produced as a latent enzyme which is activated by dsRNA generated during the course of viral infection. The dsRNA activator must be at least 15 nucleotides long, and no modification of the 2'-hydroxyl group is tolerated. ssRNA or dsDNA do not act as activators.2 Publications

Kineticsi

  1. KM=0.31 mM for ATP1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Binding sitei63ATP1 Publication1
    Metal bindingi75Magnesium; catalytic1
    Metal bindingi77Magnesium; catalytic1
    Metal bindingi148Magnesium; catalytic1
    Binding sitei213ATP1 Publication1
    Binding sitei229ATP1 Publication1

    GO - Molecular functioni

    • 2'-5'-oligoadenylate synthetase activity Source: UniProtKB
    • ATP binding Source: UniProtKB
    • double-stranded RNA binding Source: UniProtKB
    • metal ion binding Source: UniProtKB-KW
    • zinc ion binding Source: UniProtKB

    GO - Biological processi

    • cellular response to interferon-alpha Source: UniProtKB
    • defense response to virus Source: UniProtKB
    • glucose homeostasis Source: UniProtKB
    • glucose metabolic process Source: UniProtKB
    • interferon-gamma-mediated signaling pathway Source: Reactome
    • negative regulation of viral genome replication Source: UniProtKB
    • protein oligomerization Source: UniProtKB
    • purine nucleotide biosynthetic process Source: UniProtKB
    • regulation of ribonuclease activity Source: UniProtKB
    • response to virus Source: UniProtKB
    • type I interferon signaling pathway Source: Reactome
    Complete GO annotation...

    Keywords - Molecular functioni

    Nucleotidyltransferase, Transferase

    Keywords - Biological processi

    Antiviral defense, Immunity, Innate immunity

    Keywords - Ligandi

    ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, RNA-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:ENSG00000089127-MONOMER.
    ZFISH:ENSG00000089127-MONOMER.
    ReactomeiR-HSA-877300. Interferon gamma signaling.
    R-HSA-909733. Interferon alpha/beta signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    2'-5'-oligoadenylate synthase 1 (EC:2.7.7.84)
    Short name:
    (2-5')oligo(A) synthase 1
    Short name:
    2-5A synthase 1
    Alternative name(s):
    E18/E16
    p46/p42 OAS
    Gene namesi
    Name:OAS1
    Synonyms:OIAS
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:8086. OAS1.

    Subcellular locationi

    GO - Cellular componenti

    • cytoplasm Source: UniProtKB
    • cytosol Source: Reactome
    • endoplasmic reticulum Source: UniProtKB-SubCell
    • extracellular region Source: UniProtKB-SubCell
    • mitochondrion Source: UniProtKB-SubCell
    • nucleus Source: UniProtKB
    Complete GO annotation...

    Keywords - Cellular componenti

    Cytoplasm, Endoplasmic reticulum, Microsome, Mitochondrion, Nucleus, Secreted

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Mutagenesisi66K → A: Decreased enzyme activity. 1 Publication1
    Mutagenesisi75D → A: Loss of activity; when associated with A-77. 1 Publication1
    Mutagenesisi77D → A: Loss of activity; when associated with A-75. 1 Publication1
    Mutagenesisi148D → A: Strongly reduced enzyme activity. 1 Publication1
    Mutagenesisi233E → A: Loss of enzyme activity. 1 Publication1
    Mutagenesisi331C → A: Loss of activity; when associated with A-332 and A-333. 1 Publication1
    Mutagenesisi332F → A: Loss of activity; when associated with A-331 and A-333. 1 Publication1
    Mutagenesisi333K → A: Loss of activity; when associated with A-331 and A-332. 1 Publication1

    Organism-specific databases

    DisGeNETi4938.
    MalaCardsiOAS1.
    OpenTargetsiENSG00000089127.
    PharmGKBiPA31875.

    Polymorphism and mutation databases

    BioMutaiOAS1.
    DMDMi296439492.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00001602591 – 4002'-5'-oligoadenylate synthase 1Add BLAST400

    Proteomic databases

    MaxQBiP00973.
    PaxDbiP00973.
    PeptideAtlasiP00973.
    PRIDEiP00973.

    PTM databases

    iPTMnetiP00973.
    PhosphoSitePlusiP00973.

    Expressioni

    Inductioni

    By type I interferon (IFN) and viruses.2 Publications

    Gene expression databases

    BgeeiENSG00000089127.
    ExpressionAtlasiP00973. baseline and differential.
    GenevisibleiP00973. HS.

    Organism-specific databases

    HPAiCAB021104.
    HPA003657.

    Interactioni

    Subunit structurei

    Monomer (By similarity). Homotetramer.By similarity1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sitei158Interaction with dsRNA1

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ACTN1P128143EBI-3932815,EBI-351710
    EXOC5Q8IW243EBI-3932815,EBI-10171392
    PRMT6Q96LA82EBI-3932815,EBI-912440
    TRIM27P143733EBI-3932815,EBI-719493

    Protein-protein interaction databases

    BioGridi110992. 7 interactors.
    IntActiP00973. 11 interactors.
    MINTiMINT-7003225.
    STRINGi9606.ENSP00000388001.

    Structurei

    Secondary structure

    1400
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Turni4 – 6Combined sources3
    Helixi9 – 11Combined sources3
    Helixi12 – 19Combined sources8
    Helixi24 – 43Combined sources20
    Turni44 – 46Combined sources3
    Beta strandi55 – 61Combined sources7
    Helixi62 – 66Combined sources5
    Turni71 – 73Combined sources3
    Beta strandi76 – 84Combined sources9
    Helixi88 – 111Combined sources24
    Turni112 – 114Combined sources3
    Beta strandi116 – 118Combined sources3
    Beta strandi132 – 137Combined sources6
    Turni139 – 141Combined sources3
    Beta strandi145 – 152Combined sources8
    Beta strandi161 – 163Combined sources3
    Helixi167 – 179Combined sources13
    Turni183 – 186Combined sources4
    Helixi187 – 190Combined sources4
    Helixi191 – 195Combined sources5
    Turni196 – 200Combined sources5
    Helixi203 – 223Combined sources21
    Helixi229 – 243Combined sources15
    Helixi251 – 263Combined sources13
    Helixi265 – 267Combined sources3
    Beta strandi278 – 280Combined sources3
    Helixi281 – 290Combined sources10
    Beta strandi293 – 295Combined sources3
    Beta strandi297 – 300Combined sources4
    Beta strandi303 – 308Combined sources6
    Helixi313 – 326Combined sources14
    Helixi330 – 332Combined sources3

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    4IG8X-ray2.70A1-347[»]
    ProteinModelPortaliP00973.
    SMRiP00973.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Regioni13 – 60Interaction with dsRNAAdd BLAST48
    Regioni200 – 210Interaction with dsRNAAdd BLAST11

    Sequence similaritiesi

    Belongs to the 2-5A synthase family.Curated

    Phylogenomic databases

    eggNOGiKOG0001. Eukaryota.
    COG5272. LUCA.
    GeneTreeiENSGT00510000046406.
    HOVERGENiHBG000994.
    KOiK14216.
    OMAiNCKKKLG.
    OrthoDBiEOG091G0160.
    PhylomeDBiP00973.
    TreeFamiTF329749.

    Family and domain databases

    Gene3Di1.10.1410.20. 1 hit.
    InterProiIPR006117. 2-5-oligoadenylate_synth_CS.
    IPR006116. 2-5-oligoadenylate_synth_N.
    IPR018952. 2-5-oligoAdlate_synth_1_dom2/C.
    IPR026774. 2-5A_synthase.
    IPR002934. Polymerase_NTP_transf_dom.
    [Graphical view]
    PANTHERiPTHR11258. PTHR11258. 1 hit.
    PfamiPF01909. NTP_transf_2. 1 hit.
    PF10421. OAS1_C. 1 hit.
    [Graphical view]
    PROSITEiPS00832. 25A_SYNTH_1. 1 hit.
    PS00833. 25A_SYNTH_2. 1 hit.
    PS50152. 25A_SYNTH_3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform p46 (identifier: P00973-1) [UniParc]FASTAAdd to basket
    Also known as: 46 kDa, E18

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MMDLRNTPAK SLDKFIEDYL LPDTCFRMQI NHAIDIICGF LKERCFRGSS
    60 70 80 90 100
    YPVCVSKVVK GGSSGKGTTL RGRSDADLVV FLSPLTTFQD QLNRRGEFIQ
    110 120 130 140 150
    EIRRQLEACQ RERAFSVKFE VQAPRWGNPR ALSFVLSSLQ LGEGVEFDVL
    160 170 180 190 200
    PAFDALGQLT GGYKPNPQIY VKLIEECTDL QKEGEFSTCF TELQRDFLKQ
    210 220 230 240 250
    RPTKLKSLIR LVKHWYQNCK KKLGKLPPQY ALELLTVYAW ERGSMKTHFN
    260 270 280 290 300
    TAQGFRTVLE LVINYQQLCI YWTKYYDFKN PIIEKYLRRQ LTKPRPVILD
    310 320 330 340 350
    PADPTGNLGG GDPKGWRQLA QEAEAWLNYP CFKNWDGSPV SSWILLAESN
    360 370 380 390 400
    SADDETDDPR RYQKYGYIGT HEYPHFSHRP STLQAASTPQ AEEDWTCTIL
    Length:400
    Mass (Da):46,029
    Last modified:May 18, 2010 - v4
    Checksum:i03F0A3AA17DAD4E4
    GO
    Isoform p41 (identifier: P00973-2) [UniParc]FASTAAdd to basket
    Also known as: 41 kDa, E16, 3-9

    The sequence of this isoform differs from the canonical sequence as follows:
         347-364: AESNSADDETDDPRRYQK → VRPPASSLPFIPAPLHEA
         365-400: Missing.

    Show »
    Length:364
    Mass (Da):41,740
    Checksum:i2FC9CA8944EC5901
    GO
    Isoform p48 (identifier: P00973-3) [UniParc]FASTAAdd to basket
    Also known as: 9-2

    The sequence of this isoform differs from the canonical sequence as follows:
         347-400: AESNSADDET...AEEDWTCTIL → TQHTPGSIHP...CIIQDRTQVS

    Show »
    Length:414
    Mass (Da):47,408
    Checksum:iE17B28ECAE185399
    GO
    Isoform p44 (identifier: P00973-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         347-382: AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPST → VNLTLVGRRNYPIISEHAVNLQQTRRASLSYSFQVA
         383-400: Missing.

    Show »
    Length:382
    Mass (Da):43,944
    Checksum:i89654CF4DFFD195C
    GO

    Sequence cautioni

    The sequence AAA39857 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAA39858 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAA59955 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence BAD96726 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
    The sequence CAA26497 differs from that shown. Reason: Erroneous gene model prediction.Curated
    The sequence CAA30164 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti18D → E in AAA39857 (PubMed:1651324).Curated1
    Sequence conflicti111R → S in AAH71981 (PubMed:15489334).Curated1
    Sequence conflicti115F → L in AAB59552 (PubMed:2416561).Curated1
    Sequence conflicti115F → L in AAB59553 (PubMed:2416561).Curated1
    Sequence conflicti115F → L in CAA26633 (PubMed:2416561).Curated1
    Sequence conflicti120E → V in BAD96726 (Ref. 10) Curated1
    Sequence conflicti122Q → QE in AAA39858 (PubMed:1651324).Curated1
    Sequence conflicti157G → D in AAA39857 (PubMed:1651324).Curated1
    Sequence conflicti176E → D in AAA39858 (PubMed:1651324).Curated1
    Sequence conflicti295R → T in CAB51602 (PubMed:3753689).Curated1
    Sequence conflicti315G → R in CAB51602 (PubMed:3753689).Curated1
    Isoform p48 (identifier: P00973-3)
    Sequence conflicti397G → R in AAA39858 (PubMed:1651324).Curated1
    Sequence conflicti397G → R in AAW63050 (PubMed:17024523).Curated1
    Sequence conflicti397G → R in CAA26497 (PubMed:2411547).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_06047131N → D.1 PublicationCorresponds to variant rs1050994dbSNPEnsembl.1
    Natural variantiVAR_060472127G → R.Corresponds to variant rs4767022dbSNPEnsembl.1
    Natural variantiVAR_034872162G → S.9 PublicationsCorresponds to variant rs1131454dbSNPEnsembl.1
    Natural variantiVAR_060473352A → T.3 PublicationsCorresponds to variant rs1131476dbSNPEnsembl.1
    Natural variantiVAR_057658354D → G.Corresponds to variant rs35919998dbSNPEnsembl.1
    Natural variantiVAR_057659361R → T.3 PublicationsCorresponds to variant rs1051042dbSNPEnsembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_003740347 – 400AESNS…TCTIL → TQHTPGSIHPTGRRGLDLHH PLNASASWGKGLQCYLDQFL HFQVGLLIQRGQSSSVSWCI IQDRTQVS in isoform p48. 2 PublicationsAdd BLAST54
    Alternative sequenceiVSP_027804347 – 382AESNS…HRPST → VNLTLVGRRNYPIISEHAVN LQQTRRASLSYSFQVA in isoform p44. 1 PublicationAdd BLAST36
    Alternative sequenceiVSP_003738347 – 364AESNS…RRYQK → VRPPASSLPFIPAPLHEA in isoform p41. 8 PublicationsAdd BLAST18
    Alternative sequenceiVSP_003739365 – 400Missing in isoform p41. 8 PublicationsAdd BLAST36
    Alternative sequenceiVSP_027805383 – 400Missing in isoform p44. 1 PublicationAdd BLAST18

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    M11809
    , M11805, M11806, M11807, M11808 Genomic DNA. Translation: AAB59552.1.
    M11810 Genomic DNA. Translation: AAB59553.1.
    X02874 mRNA. Translation: CAA26633.1.
    X02875 mRNA. Translation: CAA26634.1.
    X04371 mRNA. Translation: CAB51602.1.
    D00068 mRNA. Translation: BAA00047.1.
    M63849 Genomic DNA. Translation: AAA39857.1. Different initiation.
    M63850 Genomic DNA. Translation: AAA39858.1. Different initiation.
    AJ629455 mRNA. Translation: CAF33358.1.
    AY730628 mRNA. Translation: AAW63050.1.
    DQ445949 Genomic DNA. Translation: ABE27977.1.
    AK291003 mRNA. Translation: BAF83692.1.
    BT006785 mRNA. Translation: AAP35431.1.
    AK223006 mRNA. Translation: BAD96726.1. Different initiation.
    AC004551 Genomic DNA. No translation available.
    BC000562 mRNA. Translation: AAH00562.4.
    BC061587 mRNA. Translation: AAH61587.1.
    BC071981 mRNA. Translation: AAH71981.3.
    X06560 Genomic DNA. Translation: CAA29803.1.
    M18099 Genomic DNA. Translation: AAA59955.1. Different initiation.
    X07179 Genomic DNA. Translation: CAA30164.1. Different initiation.
    X02661 mRNA. Translation: CAA26497.1. Sequence problems.
    CCDSiCCDS31905.1. [P00973-3]
    CCDS41838.1. [P00973-1]
    CCDS44980.1. [P00973-2]
    PIRiA39417. SYMSO2.
    A91013. SYHU16.
    B24359. SYHU18.
    B39417. SYMSO3.
    RefSeqiNP_001027581.1. NM_001032409.2. [P00973-3]
    NP_001307080.1. NM_001320151.1.
    NP_002525.2. NM_002534.3. [P00973-2]
    NP_058132.2. NM_016816.3. [P00973-1]
    UniGeneiHs.524760.

    Genome annotation databases

    EnsembliENST00000202917; ENSP00000202917; ENSG00000089127. [P00973-1]
    ENST00000445409; ENSP00000388001; ENSG00000089127. [P00973-3]
    ENST00000452357; ENSP00000415721; ENSG00000089127. [P00973-2]
    GeneIDi4938.
    KEGGihsa:4938.
    UCSCiuc001tub.4. human. [P00973-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    M11809
    , M11805, M11806, M11807, M11808 Genomic DNA. Translation: AAB59552.1.
    M11810 Genomic DNA. Translation: AAB59553.1.
    X02874 mRNA. Translation: CAA26633.1.
    X02875 mRNA. Translation: CAA26634.1.
    X04371 mRNA. Translation: CAB51602.1.
    D00068 mRNA. Translation: BAA00047.1.
    M63849 Genomic DNA. Translation: AAA39857.1. Different initiation.
    M63850 Genomic DNA. Translation: AAA39858.1. Different initiation.
    AJ629455 mRNA. Translation: CAF33358.1.
    AY730628 mRNA. Translation: AAW63050.1.
    DQ445949 Genomic DNA. Translation: ABE27977.1.
    AK291003 mRNA. Translation: BAF83692.1.
    BT006785 mRNA. Translation: AAP35431.1.
    AK223006 mRNA. Translation: BAD96726.1. Different initiation.
    AC004551 Genomic DNA. No translation available.
    BC000562 mRNA. Translation: AAH00562.4.
    BC061587 mRNA. Translation: AAH61587.1.
    BC071981 mRNA. Translation: AAH71981.3.
    X06560 Genomic DNA. Translation: CAA29803.1.
    M18099 Genomic DNA. Translation: AAA59955.1. Different initiation.
    X07179 Genomic DNA. Translation: CAA30164.1. Different initiation.
    X02661 mRNA. Translation: CAA26497.1. Sequence problems.
    CCDSiCCDS31905.1. [P00973-3]
    CCDS41838.1. [P00973-1]
    CCDS44980.1. [P00973-2]
    PIRiA39417. SYMSO2.
    A91013. SYHU16.
    B24359. SYHU18.
    B39417. SYMSO3.
    RefSeqiNP_001027581.1. NM_001032409.2. [P00973-3]
    NP_001307080.1. NM_001320151.1.
    NP_002525.2. NM_002534.3. [P00973-2]
    NP_058132.2. NM_016816.3. [P00973-1]
    UniGeneiHs.524760.

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    4IG8X-ray2.70A1-347[»]
    ProteinModelPortaliP00973.
    SMRiP00973.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi110992. 7 interactors.
    IntActiP00973. 11 interactors.
    MINTiMINT-7003225.
    STRINGi9606.ENSP00000388001.

    PTM databases

    iPTMnetiP00973.
    PhosphoSitePlusiP00973.

    Polymorphism and mutation databases

    BioMutaiOAS1.
    DMDMi296439492.

    Proteomic databases

    MaxQBiP00973.
    PaxDbiP00973.
    PeptideAtlasiP00973.
    PRIDEiP00973.

    Protocols and materials databases

    DNASUi4938.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000202917; ENSP00000202917; ENSG00000089127. [P00973-1]
    ENST00000445409; ENSP00000388001; ENSG00000089127. [P00973-3]
    ENST00000452357; ENSP00000415721; ENSG00000089127. [P00973-2]
    GeneIDi4938.
    KEGGihsa:4938.
    UCSCiuc001tub.4. human. [P00973-1]

    Organism-specific databases

    CTDi4938.
    DisGeNETi4938.
    GeneCardsiOAS1.
    HGNCiHGNC:8086. OAS1.
    HPAiCAB021104.
    HPA003657.
    MalaCardsiOAS1.
    MIMi164350. gene.
    neXtProtiNX_P00973.
    OpenTargetsiENSG00000089127.
    PharmGKBiPA31875.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG0001. Eukaryota.
    COG5272. LUCA.
    GeneTreeiENSGT00510000046406.
    HOVERGENiHBG000994.
    KOiK14216.
    OMAiNCKKKLG.
    OrthoDBiEOG091G0160.
    PhylomeDBiP00973.
    TreeFamiTF329749.

    Enzyme and pathway databases

    BioCyciMetaCyc:ENSG00000089127-MONOMER.
    ZFISH:ENSG00000089127-MONOMER.
    ReactomeiR-HSA-877300. Interferon gamma signaling.
    R-HSA-909733. Interferon alpha/beta signaling.

    Miscellaneous databases

    ChiTaRSiOAS1. human.
    GeneWikiiOAS1.
    GenomeRNAii4938.
    PROiP00973.
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000089127.
    ExpressionAtlasiP00973. baseline and differential.
    GenevisibleiP00973. HS.

    Family and domain databases

    Gene3Di1.10.1410.20. 1 hit.
    InterProiIPR006117. 2-5-oligoadenylate_synth_CS.
    IPR006116. 2-5-oligoadenylate_synth_N.
    IPR018952. 2-5-oligoAdlate_synth_1_dom2/C.
    IPR026774. 2-5A_synthase.
    IPR002934. Polymerase_NTP_transf_dom.
    [Graphical view]
    PANTHERiPTHR11258. PTHR11258. 1 hit.
    PfamiPF01909. NTP_transf_2. 1 hit.
    PF10421. OAS1_C. 1 hit.
    [Graphical view]
    PROSITEiPS00832. 25A_SYNTH_1. 1 hit.
    PS00833. 25A_SYNTH_2. 1 hit.
    PS50152. 25A_SYNTH_3. 1 hit.
    [Graphical view]
    ProtoNetiSearch...

    Entry informationi

    Entry nameiOAS1_HUMAN
    AccessioniPrimary (citable) accession number: P00973
    Secondary accession number(s): A8K4N8
    , P04820, P29080, P29081, P78485, P78486, Q16700, Q16701, Q1PG42, Q3ZM01, Q53GC5, Q53YA4, Q6A1Z3, Q6IPC6, Q6P7N9, Q96J61
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 21, 1986
    Last sequence update: May 18, 2010
    Last modified: November 30, 2016
    This is version 180 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    PubMed:1651324 sequence was originally thought to originate from mouse.Curated

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.