P00973 (OAS1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 2'-5'-oligoadenylate synthase 1 Short name=(2-5')oligo(A) synthase 1 Short name=2-5A synthase 1 EC=2.7.7.- Alternative name(s): E18/E16 p46/p42 OAS | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 400 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in mediating resistance to virus infection, control of cell growth, differentiation, and apoptosis. |
| Catalytic activity | Binds double-stranded RNA and polymerizes ATP into PPP(A2'P5'A)N oligomers, which activate the latent RNase L that, when activated, cleaves single-stranded RNAs. |
| Subunit structure | Homotetramer. |
| Subcellular location | Mitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Note: Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions. |
| Induction | By interferons. Ref.16 |
| Sequence similarities | Belongs to the 2-5A synthase family. |
| Caution | Ref.4 sequence was originally thought to originate from mouse. |
| Sequence caution | The sequence AAA39857.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAA39858.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAA59955.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAD96726.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAA26497.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAA30164.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform p46 (identifier: P00973-1) Also known as: 46 kDa; E18; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform p41 (identifier: P00973-2) Also known as: 41 kDa; E16; 3-9; The sequence of this isoform differs from the canonical sequence as follows: 347-364: AESNSADDETDDPRRYQK → VRPPASSLPFIPAPLHEA 365-400: Missing. | |||||||||
| Isoform p48 (identifier: P00973-3) Also known as: 9-2; The sequence of this isoform differs from the canonical sequence as follows: 347-400: AESNSADDET...AEEDWTCTIL → TQHTPGSIHP...CIIQDRTQVS | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 397 | 1 | G → R in AAA39858. Ref.4 | ||||||
| Sequence conflict | 397 | 1 | G → R in AAW63050. Ref.6 | ||||||
| Sequence conflict | 397 | 1 | G → R in CAA26497. Ref.16 | ||||||
| Isoform p44 (identifier: P00973-4) The sequence of this isoform differs from the canonical sequence as follows: 347-382: AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPST → VNLTLVGRRNYPIISEHAVNLQQTRRASLSYSFQVA 383-400: Missing. | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 400 | 400 | 2'-5'-oligoadenylate synthase 1 | PRO_0000160259 | |||||
Regions | |||||||||
| Region | 105 – 158 | 54 | Necessary for binding to dsRNA | ||||||
Natural variations | |||||||||
| Alternative sequence | 347 – 400 | 54 | AESNS…TCTIL → TQHTPGSIHPTGRRGLDLHH PLNASASWGKGLQCYLDQFL HFQVGLLIQRGQSSSVSWCI IQDRTQVS in isoform p48. | VSP_003740 | |||||
| Alternative sequence | 347 – 382 | 36 | AESNS…HRPST → VNLTLVGRRNYPIISEHAVN LQQTRRASLSYSFQVA in isoform p44. | VSP_027804 | |||||
| Alternative sequence | 347 – 364 | 18 | AESNS…RRYQK → VRPPASSLPFIPAPLHEA in isoform p41. | VSP_003738 | |||||
| Alternative sequence | 365 – 400 | 36 | Missing in isoform p41. | VSP_003739 | |||||
| Alternative sequence | 383 – 400 | 18 | Missing in isoform p44. | VSP_027805 | |||||
| Natural variant | 31 | 1 | N → D. Ref.1 Corresponds to variant rs1050994 [ dbSNP | Ensembl ]. | VAR_060471 | |||||
| Natural variant | 127 | 1 | G → R. Corresponds to variant rs4767022 [ dbSNP | Ensembl ]. | VAR_060472 | |||||
| Natural variant | 162 | 1 | G → S. Ref.1 Ref.2 Ref.3 Ref.4 Ref.6 Ref.8 Ref.9 Ref.10 Ref.12 Corresponds to variant rs1131454 [ dbSNP | Ensembl ]. | VAR_034872 | |||||
| Natural variant | 352 | 1 | A → T. Ref.1 Ref.6 Ref.7 Corresponds to variant rs1131476 [ dbSNP | Ensembl ]. | VAR_060473 | |||||
| Natural variant | 354 | 1 | D → G. Corresponds to variant rs35919998 [ dbSNP | Ensembl ]. | VAR_057658 | |||||
| Natural variant | 361 | 1 | R → T. Ref.1 Ref.6 Ref.7 Corresponds to variant rs1051042 [ dbSNP | Ensembl ]. | VAR_057659 | |||||
Experimental info | |||||||||
| Mutagenesis | 75 | 1 | D → A: Loss of activity; when associated with A-77. Ref.19 | ||||||
| Mutagenesis | 77 | 1 | D → A: Loss of activity; when associated with A-75. Ref.19 | ||||||
| Mutagenesis | 331 | 1 | C → A: Loss of activity; when associated with A-332 and A-333. Ref.18 | ||||||
| Mutagenesis | 332 | 1 | F → A: Loss of activity; when associated with A-331 and A-333. Ref.18 | ||||||
| Mutagenesis | 333 | 1 | K → A: Loss of activity; when associated with A-331 and A-332. Ref.18 | ||||||
| Sequence conflict | 18 | 1 | D → E in AAA39857. Ref.4 | ||||||
| Sequence conflict | 111 | 1 | R → S in AAH71981. Ref.12 | ||||||
| Sequence conflict | 115 | 1 | F → L in AAB59552. Ref.1 | ||||||
| Sequence conflict | 115 | 1 | F → L in AAB59553. Ref.1 | ||||||
| Sequence conflict | 115 | 1 | F → L in CAA26633. Ref.1 | ||||||
| Sequence conflict | 120 | 1 | E → V in BAD96726. Ref.10 | ||||||
| Sequence conflict | 122 | 1 | Q → QE in AAA39858. Ref.4 | ||||||
| Sequence conflict | 157 | 1 | G → D in AAA39857. Ref.4 | ||||||
| Sequence conflict | 176 | 1 | E → D in AAA39858. Ref.4 | ||||||
| Sequence conflict | 295 | 1 | R → T in CAB51602. Ref.2 | ||||||
| Sequence conflict | 315 | 1 | G → R in CAB51602. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure of two forms of the interferon-induced (2'-5') oligo A synthetase of human cells based on cDNAs and gene sequences." Benech P., Mory Y., Revel M., Chebath J. EMBO J. 4:2249-2256(1985) [PubMed: 2416561] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS P41 AND P46), VARIANTS ASP-31; SER-162; THR-352 AND THR-361. Tissue: Fetal blood. |
| [2] | "Full-length sequence and expression of the 42 kDa 2-5A synthetase induced by human interferon." Wathelet M.G., Moutschen S., Cravador A., Dewit L., Defilippi P., Huez G.A., Content J. FEBS Lett. 196:113-120(1986) [PubMed: 3753689] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P41), VARIANT SER-162. |
| [3] | "Structure and expression of a cloned cDNA for human (2'-5')oligoadenylate synthetase." Shiojiri S., Fukunaga R., Ichii Y., Sokawa Y. J. Biochem. 99:1455-1464(1986) [PubMed: 3754863] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P41), VARIANT SER-162. |
| [4] | "Cloning, sequencing, and expression of two murine 2'-5'-oligoadenylate synthetases. Structure-function relationships." Ghosh S.K., Kusari J., Bandyopadhyay S.K., Samanta H., Kumar R., Sen G.C. J. Biol. Chem. 266:15293-15299(1991) [PubMed: 1651324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS P48 AND P41), VARIANT SER-162. |
| [5] | "OAS1p44, a splice variant of the interferon induced human 2'-5' oligoadenylate synthetase." Andersen J.B., Strandbygaard D.J., Larsen S.E., Justesen J. Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P44). |
| [6] | "The mammalian 2'-5' oligoadenylate synthetase gene family: evidence for concerted evolution of paralogous Oas1 genes in Rodentia and Artiodactyla." Perelygin A.A., Zharkikh A.A., Scherbik S.V., Brinton M.A. J. Mol. Evol. 63:562-576(2006) [PubMed: 17024523] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P48), VARIANTS SER-162; THR-352 AND THR-361. |
| [7] | "Susceptibility to infection by West Nile Virus: OAS1 (OAS1 2'-5' oligoadenylate synthetase gene) stop codon detected in exon 1 of a normal individual heterozygous for the gene." Lee M.-K., Morshed M.G., Jorgensen D.R., Hasselback P., Goh S.-H. Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM P46), VARIANTS THR-352 AND THR-361. |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P41), VARIANT SER-162. |
| [9] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P41), VARIANT SER-162. |
| [10] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P41), VARIANT SER-162. Tissue: Small intestine. |
| [11] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P41), VARIANT SER-162. Tissue: Brain and Uterus. |
| [13] | "New inducers revealed by the promoter sequence analysis of two interferon-activated human genes." Wathelet M.G., Clauss I.M., Nols C.B., Content J., Huez G.A. Eur. J. Biochem. 169:313-321(1987) [PubMed: 3121313] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28. |
| [14] | "Interferon-responsive regulatory elements in the promoter of the human 2',5'-oligo(A) synthetase gene." Benech P., Vigneron M., Peretz D., Revel M., Chebath J. Mol. Cell. Biol. 7:4498-4504(1987) [PubMed: 2830497] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28. Tissue: Liver. |
| [15] | "Interferon-induced binding of nuclear factors to promoter elements of the 2-5A synthetase gene." Rutherford M.N., Hannigan G.E., Williams B.R.G. EMBO J. 7:751-759(1988) [PubMed: 2456211] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28. Tissue: Liver. |
| [16] | "Human 2-5A synthetase: characterization of a novel cDNA and corresponding gene structure." Saunders M.E., Gewert D.R., Tugwell M.E., McMahon M., Williams B.R.G. EMBO J. 4:1761-1768(1985) [PubMed: 2411547] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 231-400 (ISOFORM P48), INDUCTION. Tissue: Lymphoblast. |
| [17] | "Molecular cloning and sequence of partial cDNA for interferon-induced (2'-5')oligo(A) synthetase mRNA from human cells." Merlin G., Chebath J., Benech P., Metz R., Revel M. Proc. Natl. Acad. Sci. U.S.A. 80:4904-4908(1983) [PubMed: 6348777] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 255-364 (ISOFORM P41). |
| [18] | "Enzymatic activity of 2'-5'-oligoadenylate synthetase is impaired by specific mutations that affect oligomerization of the protein." Ghosh A., Sarkar S.N., Guo W., Bandyopadhyay S., Sen G.C. J. Biol. Chem. 272:33220-33226(1997) [PubMed: 9407111] [Abstract] Cited for: MUTAGENESIS OF CYS-331; PHE-332 AND LYS-333. |
| [19] | "The nature of the catalytic domain of 2'-5'-oligoadenylate synthetases." Sarkar S.N., Ghosh A., Wang H.W., Sung S.S., Sen G.C. J. Biol. Chem. 274:25535-25542(1999) [PubMed: 10464285] [Abstract] Cited for: MUTAGENESIS OF ASP-75 AND ASP-77. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M11809 M11808 Genomic DNA. Translation: AAB59552.1.M11810 Genomic DNA. Translation: AAB59553.1. X02874 mRNA. Translation: CAA26633.1. X02875 mRNA. Translation: CAA26634.1. X04371 mRNA. Translation: CAB51602.1. D00068 mRNA. Translation: BAA00047.1. M63849 Genomic DNA. Translation: AAA39857.1. Different initiation. M63850 Genomic DNA. Translation: AAA39858.1. Different initiation. AJ629455 mRNA. Translation: CAF33358.1. AY730628 mRNA. Translation: AAW63050.1. DQ445949 Genomic DNA. Translation: ABE27977.1. AK291003 mRNA. Translation: BAF83692.1. BT006785 mRNA. Translation: AAP35431.1. AK223006 mRNA. Translation: BAD96726.1. Different initiation. AC004551 Genomic DNA. No translation available. BC000562 mRNA. Translation: AAH00562.4. BC061587 mRNA. Translation: AAH61587.1. BC071981 mRNA. Translation: AAH71981.3. X06560 Genomic DNA. Translation: CAA29803.1. M18099 Genomic DNA. Translation: AAA59955.1. Different initiation. X07179 Genomic DNA. Translation: CAA30164.1. Different initiation. X02661 mRNA. Translation: CAA26497.1. Sequence problems. |
| IPI | IPI00220806. IPI00305585. IPI00513823. IPI00790698. |
| PIR | SYMSO2. A39417. SYHU16. A91013. SYHU18. B24359. SYMSO3. B39417. |
| RefSeq | NP_001027581.1. NM_001032409.1. NP_002525.2. NM_002534.2. NP_058132.2. NM_016816.2. |
| UniGene | Hs.524760. |
3D structure databases | |
| ProteinModelPortal | P00973. |
| SMR | P00973. Positions 2-346. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P00973. 2 interactions. |
| STRING | P00973. |
PTM databases | |
| PhosphoSite | P00973. |
Polymorphism databases | |
| DMDM | 296439492. |
Proteomic databases | |
| PRIDE | P00973. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000202917; ENSP00000202917; ENSG00000089127. |
| GeneID | 4938. |
| KEGG | hsa:4938. |
| UCSC | uc001tub.1. human. uc001tud.1. human. |
Organism-specific databases | |
| CTD | 4938. |
| GeneCards | GC12P113344. |
| HGNC | HGNC:8086. OAS1. |
| HPA | CAB021104. HPA003657. |
| MIM | 164350. gene. |
| neXtProt | NX_P00973. |
| PharmGKB | PA31875. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG000994. |
| PhylomeDB | P00973. |
Enzyme and pathway databases | |
| Reactome | REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | P00973. |
| Bgee | P00973. |
| Genevestigator | P00973. |
Family and domain databases | |
| InterPro | IPR006117. 2-5-oligoadenylate_synth_CS. IPR006116. 2-5-oligoadenylate_synth_N. IPR018952. 2-5-oligoAdlate_synth_1_dom2/C. IPR002934. Nucleotidyltransferase. [Graphical view] |
| Gene3D | G3DSA:1.10.1410.20. 2-5-oligoAdlate_synth_1_dom2/C. 1 hit. |
| KO | K14216. |
| Pfam | PF01909. NTP_transf_2. 1 hit. PF10421. OAS1_C. 1 hit. [Graphical view] |
| PROSITE | PS00832. 25A_SYNTH_1. 1 hit. PS00833. 25A_SYNTH_2. 1 hit. PS50152. 25A_SYNTH_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 19019. |
| SOURCE | Search... |
Entry information
| Entry name | OAS1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P00973 Secondary accession number(s): A8K4N8 Q96J61 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with