Reviewed,
UniProtKB/Swiss-Prot P00973 (OAS1_HUMAN)
Last modified
June 16, 2009.
Version 105.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 2'-5'-oligoadenylate synthetase 1 Short name=(2-5')oligo(A) synthetase 1 Short name=2-5A synthetase 1 EC=2.7.7.- Alternative name(s): p46/p42 OAS E18/E16 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 400 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May play a role in mediating resistance to virus infection, control of cell growth, differentiation, and apoptosis. |
| Catalytic activity | Binds double-stranded RNA and polymerizes ATP into PPP(A2'P5'A)N oligomers, which activate the latent RNase L that, when activated, cleaves single-stranded RNAs. |
| Subunit structure | Homotetramer. |
| Subcellular location | Mitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Note: Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions. |
| Induction | By interferons. Ref.16 |
| Sequence similarities | Belongs to the 2-5A synthetase family. |
| Caution | Ref.4 sequence was originally thought to originate from mouse. |
| Sequence caution | The sequence CAA26497.1 differs from that shown. Reason: Frameshift at position 400. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform p46 (identifier: P00973-1) Also known as: 46 kDa; E18; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform p41 (identifier: P00973-2) Also known as: 41 kDa; E16; 3-9; The sequence of this isoform differs from the canonical sequence as follows: 347-364: AESNSADDETDDPRRYQK → VRPPASSLPFIPAPLHEA 365-400: Missing. | ||||||
| Isoform p48 (identifier: P00973-3) Also known as: 9-2; The sequence of this isoform differs from the canonical sequence as follows: 347-400: AESNSADDET...AEEDWTCTIL → TQHTPGSIHP...CIIQDRTQVS | ||||||
| Isoform p44 (identifier: P00973-4) The sequence of this isoform differs from the canonical sequence as follows: 347-382: AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPST → VNLTLVGRRNYPIISEHAVNLQQTRRASLSYSFQVA 383-400: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 400 | 400 | 2'-5'-oligoadenylate synthetase 1 | PRO_0000160259 | |||||
Regions | |||||||||
| Region | 105 – 158 | 54 | Necessary for binding to dsRNA | ||||||
Natural variations | |||||||||
| Alternative sequence | 347 – 400 | 54 | AESNS…TCTIL → TQHTPGSIHPTGRRGLDLHH PLNASASWGKGLQCYLDQFL HFQVGLLIQRRQSSSVSWCI IQDRTQVS in isoform p48. | VSP_003740 | |||||
| Alternative sequence | 347 – 382 | 36 | AESNS…HRPST → VNLTLVGRRNYPIISEHAVN LQQTRRASLSYSFQVA in isoform p44. | VSP_027804 | |||||
| Alternative sequence | 347 – 364 | 18 | AESNS…RRYQK → VRPPASSLPFIPAPLHEA in isoform p41. | VSP_003738 | |||||
| Alternative sequence | 365 – 400 | 36 | Missing in isoform p41. | VSP_003739 | |||||
| Alternative sequence | 383 – 400 | 18 | Missing in isoform p44. | VSP_027805 | |||||
| Natural variant | 162 | 1 | S → G: dbSNP rs1131454. Ref.5 Ref.6 Ref.9 | VAR_034872 | |||||
| Natural variant | 354 | 1 | D → G: dbSNP rs35919998. | VAR_057658 | |||||
| Natural variant | 361 | 1 | R → T: dbSNP rs1051042. | VAR_057659 | |||||
Experimental info | |||||||||
| Mutagenesis | 75 | 1 | D → A: Loss of activity; when associated with A-77. Ref.19 | ||||||
| Mutagenesis | 77 | 1 | D → A: Loss of activity; when associated with A-75. Ref.19 | ||||||
| Mutagenesis | 331 | 1 | C → A: Loss of activity; when associated with A-332 and A-333. Ref.18 | ||||||
| Mutagenesis | 332 | 1 | F → A: Loss of activity; when associated with A-331 and A-333. Ref.18 | ||||||
| Mutagenesis | 333 | 1 | K → A: Loss of activity; when associated with A-331 and A-332. Ref.18 | ||||||
| Sequence conflict | 18 | 1 | D → E in AAA39857. Ref.4 | ||||||
| Sequence conflict | 31 | 1 | N → D in AAB59552. Ref.1 | ||||||
| Sequence conflict | 31 | 1 | N → D in AAB59553. Ref.1 | ||||||
| Sequence conflict | 31 | 1 | N → D in CAA26633. Ref.1 | ||||||
| Sequence conflict | 111 | 1 | R → S in AAH71981. Ref.12 | ||||||
| Sequence conflict | 115 | 1 | F → L in AAB59552. Ref.1 | ||||||
| Sequence conflict | 115 | 1 | F → L in AAB59553. Ref.1 | ||||||
| Sequence conflict | 115 | 1 | F → L in CAA26633. Ref.1 | ||||||
| Sequence conflict | 120 | 1 | E → V in BAD96726. Ref.4 | ||||||
| Sequence conflict | 122 | 1 | Q → QE in AAA39858. Ref.4 | ||||||
| Sequence conflict | 157 | 1 | G → D in AAA39857. Ref.4 | ||||||
| Sequence conflict | 176 | 1 | E → D in AAA39858. Ref.4 | ||||||
| Sequence conflict | 295 | 1 | R → T in CAB51602. Ref.2 | ||||||
| Sequence conflict | 315 | 1 | G → R in CAB51602. Ref.2 | ||||||
| Sequence conflict | 352 | 1 | A → T in AAB59553. Ref.1 | ||||||
| Sequence conflict | 352 | 1 | A → T in CAA26634. Ref.1 | ||||||
| Sequence conflict | 352 | 1 | A → T in ABE27977. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure of two forms of the interferon-induced (2'-5') oligo A synthetase of human cells based on cDNAs and gene sequences." Benech P., Mory Y., Revel M., Chebath J. EMBO J. 4:2249-2256(1985) [PubMed: 2416561] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS P41 AND P46), VARIANT THR-361. Tissue: Fetal blood. |
| [2] | "Full-length sequence and expression of the 42 kDa 2-5A synthetase induced by human interferon." Wathelet M.G., Moutschen S., Cravador A., Dewit L., Defilippi P., Huez G.A., Content J. FEBS Lett. 196:113-120(1986) [PubMed: 3753689] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P41). |
| [3] | "Structure and expression of a cloned cDNA for human (2'-5')oligoadenylate synthetase." Shiojiri S., Fukunaga R., Ichii Y., Sokawa Y. J. Biochem. 99:1455-1464(1986) [PubMed: 3754863] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P41). |
| [4] | "Cloning, sequencing, and expression of two murine 2'-5'-oligoadenylate synthetases. Structure-function relationships." Ghosh S.K., Kusari J., Bandyopadhyay S.K., Samanta H., Kumar R., Sen G.C. J. Biol. Chem. 266:15293-15299(1991) [PubMed: 1651324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS P48 AND P41). |
| [5] | "OAS1p44, a splice variant of the interferon induced human 2'-5' oligoadenylate synthetase." Andersen J.B., Strandbygaard D.J., Larsen S.E., Justesen J. Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P44), VARIANT GLY-162. |
| [6] | "The mammalian 2'-5' oligoadenylate synthetase gene family: evidence for concerted evolution of paralogous Oas1 genes in Rodentia and Artiodactyla." Perelygin A.A., Zharkikh A.A., Scherbik S.V., Brinton M.A. J. Mol. Evol. 63:562-576(2006) [PubMed: 17024523] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P48), VARIANT THR-361. |
| [7] | "Susceptibility to infection by West Nile Virus: OAS1 (OAS1 2'-5' oligoadenylate synthetase gene) stop codon detected in exon 1 of a normal individual heterozygous for the gene." Lee M.-K., Morshed M.G., Jorgensen D.R., Hasselback P., Goh S.-H. Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM P46), VARIANT GLY-162. |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P41). |
| [9] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P41). |
| [10] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P41), VARIANT GLY-162. Tissue: Small intestine. |
| [11] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P41). Tissue: Brain and Uterus. |
| [13] | "New inducers revealed by the promoter sequence analysis of two interferon-activated human genes." Wathelet M.G., Clauss I.M., Nols C.B., Content J., Huez G.A. Eur. J. Biochem. 169:313-321(1987) [PubMed: 3121313] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28. |
| [14] | "Interferon-responsive regulatory elements in the promoter of the human 2',5'-oligo(A) synthetase gene." Benech P., Vigneron M., Peretz D., Revel M., Chebath J. Mol. Cell. Biol. 7:4498-4504(1987) [PubMed: 2830497] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-27. Tissue: Liver. |
| [15] | "Interferon-induced binding of nuclear factors to promoter elements of the 2-5A synthetase gene." Rutherford M.N., Hannigan G.E., Williams B.R.G. EMBO J. 7:751-759(1988) [PubMed: 2456211] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-27. Tissue: Liver. |
| [16] | "Human 2-5A synthetase: characterization of a novel cDNA and corresponding gene structure." Saunders M.E., Gewert D.R., Tugwell M.E., McMahon M., Williams B.R.G. EMBO J. 4:1761-1768(1985) [PubMed: 2411547] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 231-400 (ISOFORM P41), INDUCTION. Tissue: Lymphoblast. |
| [17] | "Molecular cloning and sequence of partial cDNA for interferon-induced (2'-5')oligo(A) synthetase mRNA from human cells." Merlin G., Chebath J., Benech P., Metz R., Revel M. Proc. Natl. Acad. Sci. U.S.A. 80:4904-4908(1983) [PubMed: 6348777] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 255-364 (ISOFORM P41). |
| [18] | "Enzymatic activity of 2'-5'-oligoadenylate synthetase is impaired by specific mutations that affect oligomerization of the protein." Ghosh A., Sarkar S.N., Guo W., Bandyopadhyay S., Sen G.C. J. Biol. Chem. 272:33220-33226(1997) [PubMed: 9407111] [Abstract] Cited for: MUTAGENESIS OF CYS-331; PHE-332 AND LYS-333. |
| [19] | "The nature of the catalytic domain of 2'-5'-oligoadenylate synthetases." Sarkar S.N., Ghosh A., Wang H.W., Sung S.S., Sen G.C. J. Biol. Chem. 274:25535-25542(1999) [PubMed: 10464285] [Abstract] Cited for: MUTAGENESIS OF ASP-75 AND ASP-77. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| X02874 mRNA. Translation: CAA26633.1. X02875 mRNA. Translation: CAA26634.1. M11809 M11808 Genomic DNA. Translation: AAB59552.1. M11810 Genomic DNA. Translation: AAB59553.1. X04371 mRNA. Translation: CAB51602.1. D00068 mRNA. Translation: BAA00047.1. M63850 Genomic DNA. Translation: AAA39858.1. Different initiation. M63849 Genomic DNA. Translation: AAA39857.1. Different initiation. AY730628 mRNA. Translation: AAW63050.1. AJ629455 mRNA. Translation: CAF33358.1. DQ445949 Genomic DNA. Translation: ABE27977.1. AK291003 mRNA. Translation: BAF83692.1. BT006785 mRNA. Translation: AAP35431.1. AK223006 mRNA. Translation: BAD96726.1. Different initiation. AC004551 Genomic DNA. No translation available. BC000562 mRNA. Translation: AAH00562.4. BC061587 mRNA. Translation: AAH61587.1. BC071981 mRNA. Translation: AAH71981.3. X06560 Genomic DNA. Translation: CAA29803.1. X07179 Genomic DNA. Translation: CAA30164.1. M18099 Genomic DNA. Translation: AAA59955.1. X02661 mRNA. Translation: CAA26497.1. Frameshift. | |
| IPI | IPI00220806. IPI00305585. IPI00513823. IPI00790698. |
| PIR | SYMSO2. A39417. SYHU16. A91013. SYHU18. B24359. SYMSO3. B39417. |
| RefSeq | NP_002525.2. |
| UniGene | Hs.524760 |
3D structure databases | |
| SMR | P00973. Positions 2-346. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P00973. |
Genome annotation databases | |
| Ensembl | ENSG00000089127. Homo sapiens. [Contig view] |
| GeneID | 4938. |
Organism-specific databases | |
| GeneCards | GC12P111807. |
| HGNC | HGNC:8086. OAS1. |
| HPA | HPA003657. |
| MIM | 164350. gene. |
| PharmGKB | PA31875. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | P00973. |
Gene expression databases | |
| ArrayExpress | P00973. |
| Bgee | P00973. |
Family and domain databases | |
| InterPro | IPR006117. 2-5-oligoadenylate_synth_CS. IPR006116. 2-5-oligoadenylate_synth_UB. IPR018952. 2-5-oligoAdlate_synth_1_dom2/C. [Graphical view] |
| Pfam | PF10421. OAS1_C. 1 hit. [Graphical view] |
| PROSITE | PS00832. 25A_SYNTH_1. 1 hit. PS00833. 25A_SYNTH_2. 1 hit. PS50152. 25A_SYNTH_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 19019. |
| SOURCE | Search... |
Entry information
| Entry name | OAS1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P00973 Secondary accession number(s): A8K4N8 Q96J61 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


