Reviewed,
UniProtKB/Swiss-Prot P00750 (TPA_HUMAN)
Last modified
January 19, 2010.
Version 152.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tissue-type plasminogen activator Short name=t-plasminogen activator Short name=t-PA Short name=tPA EC=3.4.21.68 Alternative name(s): INN=Alteplase INN=Reteplase Cleaved into the following 2 chains: 1- Recommended name: Tissue-type plasminogen activator chain A 2- Recommended name: Tissue-type plasminogen activator chain B | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 562 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events. Play a direct role in facilitating neuronal migration. |
| Catalytic activity | Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin. |
| Subunit structure | Heterodimer of chain A and chain B held by a disulfide bond. Binds to fibrin with high affinity. This interaction leads to an increase in the catalytic efficiency of the enzyme between 100-fold and 1000-fold, due to an increase in affinity for plasminogen. Similarly, binding to heparin increases the activation of plasminogen. Binds to annexin A2, cytokeratin-8, fibronectin and laminin. Binds to mannose receptor and the low-density lipoprotein receptor-related protein (LRP1); these proteins are involved in TPA clearance. Yet unidentified interactions on endothelial cells and vascular smooth muscle cells (VSMC) lead to a 100-fold stimulation of plasminogen activation. In addition, binding to VSMC reduces TPA inhibition by PAI-1 by 30-fold. Binds LRP1B; binding is followed by internalization and degradation. Ref.24 |
| Subcellular location | |
| Tissue specificity | Synthesized in numerous tissues (including tumors) and secreted into most extracellular body fluids, such as plasma, uterine fluid, saliva, gingival crevicular fluid, tears, seminal fluid, and milk. |
| Domain | Both FN1 and one of the kringle domains are required for binding to fibrin. Ref.32 Ref.33 Both FN1 and EGF-like domains are important for binding to LRP1. Ref.32 Ref.33 The FN1 domain mediates binding to annexin A2. Ref.32 Ref.33 The second kringle domain is implicated in binding to cytokeratin-8 and to the endothelial cell surface binding site. Ref.32 Ref.33 |
| Post-translational modification | The single chain, almost fully active enzyme, can be further processed into a two-chain fully active form by a cleavage after Arg-310 catalyzed by plasmin, tissue kallikrein or factor Xa. Differential cell-specific N-linked glycosylation gives rise to two glycoforms, type I (glycosylated at Asn-219) and type II (not glycosylated at Asn-219). The single chain type I glycoform is less readily converted into the two-chain form by plasmin, and the two-chain type I glycoform has a lower activity than the two-chain type II glycoform in the presence of fibrin. Ref.21 Ref.22 N-glycosylation of Asn-152; the bound oligomannosidic glycan is involved in the interaction with the mannose receptor. Characterization of O-linked glycan was studied in Bowes melanoma cell line. |
| Involvement in disease | Increased activity of TPA is the cause of hyperfibrinolysis [MIM:173370]. Hyperfibrinolysis leads to excessive bleeding. Defective release of TPA causes hypofibrinolysis, leading to thrombosis or embolism. |
| Pharmaceutical use | Available under the names Activase (Genentech) and Retavase (Centocor and Roche) [Retavase is a fragment of TPA that contains kringle 2 and the protease domain; it was also known as BM 06.022]. Used in Acute Myocardial Infarction (AMI), in Acute Ischemic Stroke (AIS) and Pulmonary Embolism (PE) to initiate fibrinolysis. |
| Sequence similarities | Belongs to the peptidase S1 family. Contains 1 EGF-like domain. Contains 1 fibronectin type-I domain. Contains 2 kringle domains. Contains 1 peptidase S1 domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Plasminogen activation |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | EGF-like domain Kringle Repeat Signal |
| Molecular function | Hydrolase Protease Serine protease |
| PTM | Cleavage on pair of basic residues Disulfide bond Glycoprotein Zymogen |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Pharmaceutical |
| Gene Ontology (GO) | |
| Biological process | blood coagulation Traceable author statement. Source: ProtInc protein modification processTraceable author statement. Source: ProtInc proteolysisTraceable author statement. Source: ProtInc |
| Cellular component | extracellular space Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | serine-type endopeptidase activity Inferred from Experiment. Source: Reactome |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P00750-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P00750-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 269-291: NPDGDAKPWCHVLKNRRLTWEYC → TGRSVSSPATASMRPCPLSIRSG 292-562: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: P00750-3) The sequence of this isoform differs from the canonical sequence as follows: 39-85: VICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS → G | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P00750-4) Also known as: Neonatal; The sequence of this isoform differs from the canonical sequence as follows: 1-40: MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVI → MAS 79-208: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | 23 – 32 | 10 | PRO_0000028348 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | 33 – 35 | 3 | Removed by plasmin | PRO_0000028349 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 36 – 562 | 527 | Tissue-type plasminogen activator | PRO_0000028350 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 36 – 310 | 275 | Tissue-type plasminogen activator chain A | PRO_0000028351 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 311 – 562 | 252 | Tissue-type plasminogen activator chain B | PRO_0000028352 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 39 – 81 | 43 | Fibronectin type-I | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 82 – 120 | 39 | EGF-like | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 127 – 208 | 82 | Kringle 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 215 – 296 | 82 | Kringle 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 311 – 561 | 251 | Peptidase S1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 42 – 52 | 11 | Important for binding to annexin A2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 357 | 1 | Charge relay system | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 406 | 1 | Charge relay system | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 513 | 1 | Charge relay system | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 102 | 1 | Important for binding to LRP1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 253 | 1 | Not glycosylated | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 464 | 1 | Important for single-chain activity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 512 | 1 | Important for single-chain activity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 96 | 1 | O-linked (Fuc) Ref.22 | CAR_000029 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 152 | 1 | N-linked (GlcNAc...) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 219 | 1 | N-linked (GlcNAc...); partial | CAR_000030 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 483 | 1 | N-linked (GlcNAc...) | CAR_000031 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 41 ↔ 71 | Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 69 ↔ 78 | Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 86 ↔ 97 | Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 91 ↔ 108 | Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 110 ↔ 119 | Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 127 ↔ 208 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 148 ↔ 190 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 179 ↔ 203 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 215 ↔ 296 | Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 236 ↔ 278 | Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 267 ↔ 291 | Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 299 ↔ 430 | Interchain (between A and B chains) Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 342 ↔ 358 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 350 ↔ 419 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 444 ↔ 519 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 476 ↔ 492 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 509 ↔ 537 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 40 | 40 | MDAMK…SYQVI → MAS in isoform 4. | VSP_028029 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 39 – 85 | 47 | VICRD…VPVKS → G in isoform 3. | VSP_015957 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 79 – 208 | 130 | Missing in isoform 4. | VSP_028030 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 269 – 291 | 23 | NPDGD…TWEYC → TGRSVSSPATASMRPCPLSI RSG in isoform 2. | VSP_005411 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 292 – 562 | 271 | Missing in isoform 2. | VSP_005412 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 34 | 1 | A → D: dbSNP rs8178733. Ref.12 | VAR_020181 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 136 | 1 | R → S: dbSNP rs8178747. Ref.12 | VAR_038732 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 146 | 1 | A → T: dbSNP rs8178748. Ref.12 | VAR_038733 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 164 | 1 | R → W: dbSNP rs2020921. Ref.12 | VAR_011783 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 93 | 1 | N → T in AAB59510. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 159 – 160 | 2 | KP → NA in CAA31489. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 247 | 1 | K → N in AAO34406. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 283 | 1 | N → S in AAH95403. Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 333 – 334 | 2 | RR → EE in AAK11956. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 389 | 1 | V → C in AAK11956. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 44 – 46 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 55 – 59 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 61 – 64 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 66 – 70 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 72 – 74 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 85 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 96 – 104 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 106 – 109 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 118 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 242 – 244 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 248 – 250 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 256 – 259 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 262 – 264 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 277 – 282 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 285 – 291 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 312 – 316 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 319 – 321 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 331 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 338 – 346 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 348 – 354 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 356 – 359 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 365 – 367 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 368 – 373 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 375 – 379 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 385 – 394 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 400 – 402 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 408 – 412 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 415 – 417 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 443 – 449 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 464 – 470 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 473 – 475 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 478 – 483 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 490 – 494 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 516 – 521 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 524 – 533 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 535 – 538 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 544 – 548 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 549 – 552 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 553 – 559 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of human tissue-type plasminogen activator cDNA in E. coli." Pennica D., Holmes W.E., Kohr W.J., Harkins R.N., Vehar G.A., Ward C.A., Bennett W.F., Yelverton E., Seeburg P.H., Heyneker H.L., Goeddel D.V., Collen D. Nature 301:214-221(1983) [PubMed: 6337343] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Melanoma. |
| [2] | "The structure of the human tissue-type plasminogen activator gene: correlation of intron and exon structures to functional and structural domains." Ny T., Elgh F., Lund B. Proc. Natl. Acad. Sci. U.S.A. 81:5355-5359(1984) [PubMed: 6089198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "The human tissue plasminogen activator gene." Friezner Degen S.J., Rajput B., Reich E. J. Biol. Chem. 261:6972-6985(1986) [PubMed: 3009482] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Cloning of cDNA coding for human tissue-type plasminogen activator and its expression in Escherichia coli." Harris T.J., Patel T., Marston F.A., Little S., Emtage J.S., Opdenakker G., Volckaert G., Rombauts W., Billiau A., Somer P. Mol. Biol. Med. 3:279-292(1986) [PubMed: 3090401] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "Expression of human uterine tissue-type plasminogen activator in mouse cells using BPV vectors." Reddy V.B., Garramone A.J., Sasak H., Wei C.-M., Watkins P., Galli J., Hsiung N. DNA 6:461-472(1987) [PubMed: 2824147] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "Nucleotide sequence of the tissue-type plasminogen activator cDNA from human fetal lung cells." Sasaki H., Saito Y., Hayashi M., Otsuka K., Niwa M. Nucleic Acids Res. 16:5695-5695(1988) [PubMed: 3133640] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fetal lung. |
| [7] | "Variant tissue-type plasminogen activator (PLAT) cDNA obtained from human endothelial cells." Siebert P.D., Fong K. Nucleic Acids Res. 18:1086-1086(1990) [PubMed: 2107528] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Umbilical vein. |
| [8] | "A brain-type plasminogen activator." Dou D. Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [9] | "cDNA of tissue plasminogen activator." Liu Y., Xu L., Zeng Y., He X. Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Testis. |
| [11] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [12] | SeattleSNPs variation discovery resource Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ASP-34; SER-136; THR-146 AND TRP-164. |
| [13] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [14] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain, Placenta and Skin. |
| [15] | "Isolation and characterization of the human tissue-type plasminogen activator structural gene including its 5' flanking region." Fisher R., Waller E.K., Grossi G., Thompson D., Tizard R., Schleuning W.-D. J. Biol. Chem. 260:11223-11230(1985) [PubMed: 3161893] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-36. |
| [16] | "Purification and characterization of tissue plasminogen activator secreted by human embryonic lung diploid fibroblasts, IMR-90 cells." Itagaki Y., Yasuda H., Morinaga T., Mitsuda S., Higashio K. Agric. Biol. Chem. 55:1225-1232(1991) [PubMed: 1368681] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 31-562. |
| [17] | "Purification and characterization of a melanoma cell plasminogen activator." Wallen P., Pohl G., Bergsdorf N., Raanby M., Ny T., Joernvall H. Eur. J. Biochem. 132:681-686(1983) [PubMed: 6682760] [Abstract] Cited for: PROTEIN SEQUENCE OF 33-52 AND 311-330. Tissue: Melanoma. |
| [18] | "Tissue plasminogen activator: peptide analyses confirm an indirectly derived amino acid sequence, identify the active site serine residue, establish glycosylation sites, and localize variant differences." Pohl G., Kaellstroem M., Bergsdorf N., Wallen P., Joernvall H. Biochemistry 23:3701-3707(1984) [PubMed: 6433976] [Abstract] Cited for: PROTEIN SEQUENCE OF 36-562. Tissue: Melanoma. |
| [19] | "Isolation of cDNA sequences coding for a part of human tissue plasminogen activator." Edlund T., Ny T., Raanby M., Heden L.-O., Palm G., Holmgren E., Josephson S. Proc. Natl. Acad. Sci. U.S.A. 80:349-352(1983) [PubMed: 6572897] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 251-358. |
| [20] | Jalah R., Pavlakis G.N., Felber B.J. Submitted (JUL-2007) to UniProtKB Cited for: PARTIAL PROTEIN SEQUENCE, SIGNAL SEQUENCE CLEAVAGE SITE. |
| [21] | "Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells." Pfeiffer G., Schmidt M., Strube K.-H., Geyer R. Eur. J. Biochem. 186:273-286(1989) [PubMed: 2513186] [Abstract] Cited for: STRUCTURE OF CARBOHYDRATES. |
| [22] | "Tissue plasminogen activator has an O-linked fucose attached to threonine-61 in the epidermal growth factor domain." Harris R.J., Leonard C.K., Guzzetta A.W., Spellman M.W. Biochemistry 30:2311-2314(1991) [PubMed: 1900431] [Abstract] Cited for: GLYCOSYLATION AT THR-96. |
| [23] | "Disulfide pairing of the recombinant kringle-2 domain of tissue plasminogen activator produced in Escherichia coli." Vlahos C.J., Wilhelm O.G., Hassell T., Jaskunas S.R., Bang N.U. J. Biol. Chem. 266:10070-10072(1991) [PubMed: 1645336] [Abstract] Cited for: DISULFIDE BONDS IN KRINGLE 2. |
| [24] | "The putative tumor suppressor LRP1B, a novel member of the low density lipoprotein (LDL) receptor family, exhibits both overlapping and distinct properties with the LDL receptor-related protein." Liu C.-X., Li Y., Obermoeller-McCormick L.M., Schwartz A.L., Bu G. J. Biol. Chem. 276:28889-28896(2001) [PubMed: 11384978] [Abstract] Cited for: INTERACTION WITH LRP1B. |
| [25] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [26] | "1H NMR structural characterization of a recombinant kringle 2 domain from human tissue-type plasminogen activator." Byeon I.-J.L., Kelley R.F., Llinas M. Biochemistry 28:9350-9360(1989) [PubMed: 2558718] [Abstract] Cited for: STRUCTURE BY NMR OF KRINGLE 2. |
| [27] | "Kringle-2 domain of the tissue-type plasminogen activator. 1H-NMR assignments and secondary structure." Byeon I.-J.L., Kelley R.F., Llinas M. Eur. J. Biochem. 197:155-165(1991) [PubMed: 1901789] [Abstract] Cited for: STRUCTURE BY NMR OF KRINGLE 2. |
| [28] | "Solution structure of the tissue-type plasminogen activator kringle 2 domain complexed to 6-aminohexanoic acid an antifibrinolytic drug." Byeon I.-J.L., Llinas M. J. Mol. Biol. 222:1035-1051(1991) [PubMed: 1762144] [Abstract] Cited for: STRUCTURE BY NMR OF KRINGLE 2. |
| [29] | "Crystal structure of the kringle 2 domain of tissue plasminogen activator at 2.4-A resolution." de Vos A., Ultsch M.H., Kelley R.F., Padmanabhan K., Tulinskly A., Westbrook M.L., Kossiakof A.A. Biochemistry 31:270-279(1992) [PubMed: 1310033] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF KRINGLE 2. |
| [30] | "Solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1H nuclear magnetic resonance." Downing A.K., Driscoll P.C., Harvey T.S., Dudgeon T.J., Smith B.O., Baron M., Campbell I.D. J. Mol. Biol. 225:821-833(1992) [PubMed: 1602484] [Abstract] Cited for: STRUCTURE BY NMR OF 38-85. |
| [31] | "The solution structure and backbone dynamics of the fibronectin type I and epidermal growth factor-like pair of modules of tissue-type plasminogen activator." Smith B.O., Downing A.K., Driscoll P.C., Dudgeon T.J., Campbell I.D. Structure 3:823-833(1995) [PubMed: 7582899] [Abstract] Cited for: STRUCTURE BY NMR OF 36-126. |
| [32] | "The 2.3 A crystal structure of the catalytic domain of recombinant two-chain human tissue-type plasminogen activator." Lamba D., Bauer M., Huber R., Fischer S., Rudolph R., Kohnert U., Bode W. J. Mol. Biol. 258:117-135(1996) [PubMed: 8613982] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF CATALYTIC DOMAIN. |
| [33] | "Lysine 156 promotes the anomalous proenzyme activity of tPA: X-ray crystal structure of single-chain human tPA." Renatus M., Engh R.A., Stubbs M.T., Huber R., Fischer S., Kohnert U., Bode W. EMBO J. 16:4797-4805(1997) [PubMed: 9305622] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.1 ANGSTROMS) OF CATALYTIC DOMAIN. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Tissue plasminogen activator entry |
| SeattleSNPs |
| SHMPD The Singapore human mutation and polymorphism database |
| Activase Clinical information on Activase |
| Retavase Clinical information on Retavase |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L00153 L00151 Genomic DNA. Translation: AAB59510.1. K03021 Genomic DNA. Translation: AAA98809.1. M15518 mRNA. Translation: AAA60111.1. M18182 mRNA. Translation: AAA36800.1. X07393 mRNA. Translation: CAA30302.1. X13097 mRNA. Translation: CAA31489.1. AF260825 mRNA. Translation: AAK11956.1. AY221101 mRNA. Translation: AAO34406.1. AK289387 mRNA. Translation: BAF82076.1. AK290575 mRNA. Translation: BAF83264.1. AK313342 mRNA. Translation: BAG36145.1. BT007060 mRNA. Translation: AAP35709.1. AY291060 Genomic DNA. Translation: AAP34246.1. CH471080 Genomic DNA. Translation: EAW63235.1. CH471080 Genomic DNA. Translation: EAW63233.1. BC002795 mRNA. Translation: AAH02795.3. BC007231 mRNA. Translation: AAH07231.1. BC013968 mRNA. Translation: AAH13968.3. BC018636 mRNA. Translation: AAH18636.3. BC095403 mRNA. Translation: AAH95403.1. M11890, M11889 Genomic DNA. Translation: AAA61213.1. D01096 mRNA. Translation: BAA00881.1. V00570 mRNA. Translation: CAA23833.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00019590. IPI00479511. IPI00910450. IPI00953228. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | UKHUT. A94004. I38098. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000921.1. NP_127509.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.491582 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P00750. Positions 126-210, 174-299, 212-334. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GlycoSuiteDB | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000220809; ENSP00000220809; ENSG00000104368; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5327. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5327. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003xos.2. human. uc003xot.2. human. uc010lxf.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5327. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M042151. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0007476. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9051. PLAT. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB009335. HPA003412. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 173370. gene+phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33381. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG16610. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | TCGLRQY. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG9TQPVK. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 3.4.21.68. 247. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | amb2_neutrophils_pathway. amb2 Integrin signaling. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_16888. Signaling by PDGF. REACT_604. Hemostasis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000104368. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR016060. Complement_control_module. IPR006209. EGF. IPR006210. EGF-like. IPR013032. EGF-like_reg_CS. IPR000742. EGF_3. IPR000083. Fibrnctn1. IPR000001. Kringle. IPR013806. Kringle-like. IPR018056. Kringle_CS. IPR018059. Kringle_sub. IPR018114. Peptidase_S1/S6_AS. IPR001254. Peptidase_S1_S6. IPR001314. Peptidase_S1A. IPR009003. Ser/Cys_Pept_Trypsin-like. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.10.70.10. Complement_control_module. 1 hit. G3DSA:2.40.20.10. Kringle. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00008. EGF. 1 hit. PF00039. fn1. 1 hit. PF00051. Kringle. 2 hits. PF00089. Trypsin. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00722. CHYMOTRYPSIN. PR00018. KRINGLE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00181. EGF. 1 hit. SM00058. FN1. 1 hit. SM00130. KR. 2 hits. SM00020. Tryp_SPc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00022. EGF_1. 1 hit. PS01186. EGF_2. 1 hit. PS50026. EGF_3. 1 hit. PS01253. FN1_1. 1 hit. PS51091. FN1_2. 1 hit. PS00021. KRINGLE_1. 2 hits. PS50070. KRINGLE_2. 2 hits. PS50240. TRYPSIN_DOM. 1 hit. PS00134. TRYPSIN_HIS. 1 hit. PS00135. TRYPSIN_SER. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00009. Alteplase. DB00513. Aminocaproic Acid. DB00029. Anistreplase. DB01088. Iloprost. DB00015. Reteplase. DB00031. Tenecteplase. DB00302. Tranexamic Acid. DB00013. Urokinase. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 20622. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P00750. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | TPA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P00750 Secondary accession number(s): A8K022 Q9BZW1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


