Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Haptoglobin-related protein

Gene

HPR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Primate-specific plasma protein associated with apolipoprotein L-I (apoL-I)-containing high-density lipoprotein (HDL). This HDL particle, termed trypanosome lytic factor-1 (TLF-1), mediates human innate immune protection against many species of African trypanosomes. Binds hemoglobin with high affinity and may contribute to the clearance of cell-free hemoglobin to allow hepatic recycling of heme iron.1 Publication

GO - Molecular functioni

  • hemoglobin binding Source: UniProtKB

GO - Biological processi

  • mitophagy in response to mitochondrial depolarization Source: ParkinsonsUK-UCL
  • positive regulation of defense response to virus by host Source: ParkinsonsUK-UCL
  • receptor-mediated endocytosis Source: Reactome
  • xenophagy Source: ParkinsonsUK-UCL
Complete GO annotation...

Keywords - Molecular functioni

Serine protease homolog

Keywords - Ligandi

Hemoglobin-binding

Enzyme and pathway databases

ReactomeiR-HSA-2168880. Scavenging of heme from plasma.

Protein family/group databases

MEROPSiS01.974.

Names & Taxonomyi

Protein namesi
Recommended name:
Haptoglobin-related protein
Gene namesi
Name:HPR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:5156. HPR.

Subcellular locationi

GO - Cellular componenti

  • blood microparticle Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • extracellular region Source: Reactome
  • spherical high-density lipoprotein particle Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29426.

Polymorphism and mutation databases

BioMutaiHPR.
DMDMi262527547.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 348348Haptoglobin-related proteinPRO_0000028486Add
BLAST
Signal peptidei1 – 1818Not cleaved1 PublicationAdd
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi251 ↔ 282PROSITE-ProRule annotation
Disulfide bondi293 ↔ 323PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiP00739.
PeptideAtlasiP00739.
PRIDEiP00739.

2D gel databases

DOSAC-COBS-2DPAGEP00739.

PTM databases

iPTMnetiP00739.
PhosphoSiteiP00739.

Expressioni

Tissue specificityi

In adult liver the amount of HPR mRNA is at the lower limit of detection, therefore the extent of its expression is at most less than 1000-fold that of the HP1F gene. No HPR mRNA can be detected in fetal liver. Expressed in Hep-G2 and leukemia MOLT-4 cell lines.1 Publication

Gene expression databases

BgeeiENSG00000261701.
CleanExiHS_HPR.
ExpressionAtlasiP00739. baseline and differential.
GenevisibleiP00739. HS.

Organism-specific databases

HPAiHPA047750.

Interactioni

GO - Molecular functioni

  • hemoglobin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi109487. 3 interactions.
STRINGi9606.ENSP00000441828.

Structurei

3D structure databases

ProteinModelPortaliP00739.
SMRiP00739. Positions 35-348.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini34 – 8754SushiAdd
BLAST
Domaini104 – 346243Peptidase S1PROSITE-ProRule annotationAdd
BLAST

Domaini

The uncleaved signal sequence interacts with HDL fluid lipids and mediates incorporation into the HDL particle.1 Publication

Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation
Contains 1 peptidase S1 domain.PROSITE-ProRule annotation
Contains 1 Sushi (CCP/SCR) domain.Curated

Keywords - Domaini

Signal, Sushi

Phylogenomic databases

eggNOGiKOG3627. Eukaryota.
COG5640. LUCA.
GeneTreeiENSGT00760000118890.
HOGENOMiHOG000112945.
HOVERGENiHBG005989.
InParanoidiP00739.
KOiK14477.
OMAiSYLPWIH.
OrthoDBiEOG091G099M.
PhylomeDBiP00739.
TreeFamiTF334326.

Family and domain databases

CDDicd00190. Tryp_SPc. 1 hit.
InterProiIPR008292. Haptoglobin.
IPR009003. Peptidase_S1_PA.
IPR001314. Peptidase_S1A.
IPR000436. Sushi_SCR_CCP_dom.
IPR001254. Trypsin_dom.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PIRSFiPIRSF001137. Haptoglobin. 1 hit.
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
SSF57535. SSF57535. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P00739-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDLGAVISL LLWGRQLFAL YSGNDVTDIS DDRFPKPPEI ANGYVEHLFR
60 70 80 90 100
YQCKNYYRLR TEGDGVYTLN DKKQWINKAV GDKLPECEAV CGKPKNPANP
110 120 130 140 150
VQRILGGHLD AKGSFPWQAK MVSHHNLTTG ATLINEQWLL TTAKNLFLNH
160 170 180 190 200
SENATAKDIA PTLTLYVGKK QLVEIEKVVL HPNYHQVDIG LIKLKQKVLV
210 220 230 240 250
NERVMPICLP SKNYAEVGRV GYVSGWGQSD NFKLTDHLKY VMLPVADQYD
260 270 280 290 300
CITHYEGSTC PKWKAPKSPV GVQPILNEHT FCVGMSKYQE DTCYGDAGSA
310 320 330 340
FAVHDLEEDT WYAAGILSFD KSCAVAEYGV YVKVTSIQHW VQKTIAEN
Length:348
Mass (Da):39,030
Last modified:November 3, 2009 - v2
Checksum:iCF9EC3352B8182FA
GO
Isoform 2 (identifier: P00739-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHVCVCVCVCVYMPVCVDACMCCEAGRPAFRSFLFSLC

Show »
Length:385
Mass (Da):43,078
Checksum:i8445DD27A496188B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti191 – 1911L → I in CAA25927 (PubMed:4018023).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti27 – 271T → M.
Corresponds to variant rs11642506 [ dbSNP | Ensembl ].
VAR_057161
Natural varianti42 – 421N → H.
Corresponds to variant rs152832 [ dbSNP | Ensembl ].
VAR_057162
Natural varianti58 – 581R → K.
Corresponds to variant rs152833 [ dbSNP | Ensembl ].
VAR_057163
Natural varianti156 – 1561A → V.
Corresponds to variant rs1049933 [ dbSNP | Ensembl ].
VAR_059789
Natural varianti203 – 2031R → K.
Corresponds to variant rs2021171 [ dbSNP | Ensembl ].
VAR_057164
Natural varianti283 – 2831V → A.
Corresponds to variant rs1065360 [ dbSNP | Ensembl ].
VAR_057165
Natural varianti339 – 3391H → D.3 Publications
Corresponds to variant rs12646 [ dbSNP | Ensembl ].
VAR_014571

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MHVCVCVCVCVYMPVCVDAC MCCEAGRPAFRSFLFSLC in isoform 2. 1 PublicationVSP_014529

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X01794
, X01787, X01788, X01790, X01792 Genomic DNA. Translation: CAA25927.1.
K03431, M10935 Genomic DNA. Translation: AAA88081.1.
M69197 Genomic DNA. Translation: AAA88079.1.
X89214 mRNA. Translation: CAA61501.1.
AC009087 Genomic DNA. No translation available.
AC004682 Genomic DNA. Translation: AAC27433.1.
CCDSiCCDS42193.1. [P00739-1]
PIRiA00919. HPHUR.
RefSeqiNP_066275.3. NM_020995.3. [P00739-1]
UniGeneiHs.655361.

Genome annotation databases

EnsembliENST00000540303; ENSP00000441828; ENSG00000261701. [P00739-1]
GeneIDi3250.
KEGGihsa:3250.
UCSCiuc002fby.4. human. [P00739-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X01794
, X01787, X01788, X01790, X01792 Genomic DNA. Translation: CAA25927.1.
K03431, M10935 Genomic DNA. Translation: AAA88081.1.
M69197 Genomic DNA. Translation: AAA88079.1.
X89214 mRNA. Translation: CAA61501.1.
AC009087 Genomic DNA. No translation available.
AC004682 Genomic DNA. Translation: AAC27433.1.
CCDSiCCDS42193.1. [P00739-1]
PIRiA00919. HPHUR.
RefSeqiNP_066275.3. NM_020995.3. [P00739-1]
UniGeneiHs.655361.

3D structure databases

ProteinModelPortaliP00739.
SMRiP00739. Positions 35-348.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109487. 3 interactions.
STRINGi9606.ENSP00000441828.

Protein family/group databases

MEROPSiS01.974.

PTM databases

iPTMnetiP00739.
PhosphoSiteiP00739.

Polymorphism and mutation databases

BioMutaiHPR.
DMDMi262527547.

2D gel databases

DOSAC-COBS-2DPAGEP00739.

Proteomic databases

PaxDbiP00739.
PeptideAtlasiP00739.
PRIDEiP00739.

Protocols and materials databases

DNASUi3250.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000540303; ENSP00000441828; ENSG00000261701. [P00739-1]
GeneIDi3250.
KEGGihsa:3250.
UCSCiuc002fby.4. human. [P00739-1]

Organism-specific databases

CTDi3250.
GeneCardsiHPR.
HGNCiHGNC:5156. HPR.
HPAiHPA047750.
MIMi140210. gene.
neXtProtiNX_P00739.
PharmGKBiPA29426.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3627. Eukaryota.
COG5640. LUCA.
GeneTreeiENSGT00760000118890.
HOGENOMiHOG000112945.
HOVERGENiHBG005989.
InParanoidiP00739.
KOiK14477.
OMAiSYLPWIH.
OrthoDBiEOG091G099M.
PhylomeDBiP00739.
TreeFamiTF334326.

Enzyme and pathway databases

ReactomeiR-HSA-2168880. Scavenging of heme from plasma.

Miscellaneous databases

GeneWikiiHPR_(gene).
GenomeRNAii3250.
PROiP00739.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000261701.
CleanExiHS_HPR.
ExpressionAtlasiP00739. baseline and differential.
GenevisibleiP00739. HS.

Family and domain databases

CDDicd00190. Tryp_SPc. 1 hit.
InterProiIPR008292. Haptoglobin.
IPR009003. Peptidase_S1_PA.
IPR001314. Peptidase_S1A.
IPR000436. Sushi_SCR_CCP_dom.
IPR001254. Trypsin_dom.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PIRSFiPIRSF001137. Haptoglobin. 1 hit.
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
SSF57535. SSF57535. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHPTR_HUMAN
AccessioniPrimary (citable) accession number: P00739
Secondary accession number(s): Q7LE20
, Q92658, Q92659, Q9ULB0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: November 3, 2009
Last modified: September 7, 2016
This is version 157 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Although homologous to serine proteases, it has lost all essential catalytic residues and has no enzymatic activity.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.