Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

L-lactate dehydrogenase A chain

Gene

LDHA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

(S)-lactate + NAD+ = pyruvate + NADH.

Pathwayi: pyruvate fermentation to lactate

This protein is involved in step 1 of the subpathway that synthesizes (S)-lactate from pyruvate.
Proteins known to be involved in this subpathway in this organism are:
  1. L-lactate dehydrogenase A-like 6A (LDHAL6A), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase, L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase, L-lactate dehydrogenase A-like 6B (LDHAL6B), L-lactate dehydrogenase (HEL-S-133P), L-lactate dehydrogenase (LDHAL6A), L-lactate dehydrogenase (LDHAL6A), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase (LDHB), L-lactate dehydrogenase A chain (LDHA), L-lactate dehydrogenase B chain (LDHB), L-lactate dehydrogenase (LDHB), L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase, L-lactate dehydrogenase (LDHC), L-lactate dehydrogenase C chain (LDHC)
This subpathway is part of the pathway pyruvate fermentation to lactate, which is itself part of Fermentation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes (S)-lactate from pyruvate, the pathway pyruvate fermentation to lactate and in Fermentation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei99NAD1 Publication1
Binding sitei106Substrate1
Binding sitei138NAD or substrate1 Publication1
Binding sitei169Substrate1
Active sitei193Proton acceptor1
Binding sitei248Substrate1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi29 – 57NAD1 PublicationAdd BLAST29

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • L-lactate dehydrogenase activity Source: UniProtKB
  • NAD binding Source: Ensembl

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

NAD

Enzyme and pathway databases

BioCyciZFISH:HS05858-MONOMER.
ReactomeiR-HSA-70268. Pyruvate metabolism.
SABIO-RKP00338.
SIGNORiP00338.
UniPathwayiUPA00554; UER00611.

Names & Taxonomyi

Protein namesi
Recommended name:
L-lactate dehydrogenase A chain (EC:1.1.1.27)
Short name:
LDH-A
Alternative name(s):
Cell proliferation-inducing gene 19 protein
LDH muscle subunit
Short name:
LDH-M
Renal carcinoma antigen NY-REN-59
Gene namesi
Name:LDHA
ORF Names:PIG19
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:6535. LDHA.

Subcellular locationi

GO - Cellular componenti

  • cell-cell adherens junction Source: BHF-UCL
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • membrane Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Glycogen storage disease 11 (GSD11)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA metabolic disorder that results in exertional myoglobinuria, pain, cramps and easy fatigue.
See also OMIM:612933

Keywords - Diseasei

Disease mutation, Glycogen storage disease

Organism-specific databases

DisGeNETi3939.
MalaCardsiLDHA.
MIMi612933. phenotype.
OpenTargetsiENSG00000134333.
Orphaneti284426. Glycogen storage disease due to lactate dehydrogenase M-subunit deficiency.
PharmGKBiPA30319.

Chemistry databases

ChEMBLiCHEMBL4835.
DrugBankiDB02701. Nicotinamide.

Polymorphism and mutation databases

BioMutaiLDHA.
DMDMi126047.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00001684112 – 332L-lactate dehydrogenase A chainAdd BLAST331

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei5N6-acetyllysine; alternateCombined sources1
Modified residuei5N6-succinyllysine; alternateBy similarity1
Modified residuei10PhosphotyrosineCombined sources1
Modified residuei14N6-acetyllysineCombined sources1
Modified residuei18PhosphothreonineCombined sources1
Modified residuei57N6-acetyllysineCombined sources1
Modified residuei81N6-acetyllysineCombined sources1
Modified residuei118N6-acetyllysine; alternateCombined sources1
Modified residuei118N6-succinyllysine; alternateBy similarity1
Modified residuei126N6-acetyllysineCombined sources1
Modified residuei224N6-acetyllysineBy similarity1
Modified residuei232N6-acetyllysineBy similarity1
Modified residuei239PhosphotyrosineBy similarity1
Modified residuei243N6-acetyllysineBy similarity1
Modified residuei309PhosphothreonineBy similarity1
Modified residuei310PhosphoserineCombined sources1
Modified residuei318N6-acetyllysine; alternateCombined sources1
Modified residuei318N6-succinyllysine; alternateBy similarity1
Modified residuei322PhosphothreonineBy similarity1

Post-translational modificationi

ISGylated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP00338.
PaxDbiP00338.
PeptideAtlasiP00338.
PRIDEiP00338.
TopDownProteomicsiP00338-1. [P00338-1]
P00338-4. [P00338-4]
P00338-5. [P00338-5]

2D gel databases

DOSAC-COBS-2DPAGEP00338.
OGPiP00338.
REPRODUCTION-2DPAGEIPI00217966.

PTM databases

iPTMnetiP00338.
PhosphoSitePlusiP00338.
SwissPalmiP00338.

Expressioni

Gene expression databases

BgeeiENSG00000134333.
CleanExiHS_LDHA.
ExpressionAtlasiP00338. baseline and differential.
GenevisibleiP00338. HS.

Organism-specific databases

HPAiCAB015336.

Interactioni

Subunit structurei

Homotetramer.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
HSPA8P111424EBI-372327,EBI-351896
LDHBP071955EBI-10195200,EBI-358748
MAPK10Q499Y85EBI-10195200,EBI-10241715

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL

Protein-protein interaction databases

BioGridi110131. 143 interactors.
IntActiP00338. 33 interactors.
MINTiMINT-4998672.
STRINGi9606.ENSP00000445175.

Chemistry databases

BindingDBiP00338.

Structurei

Secondary structure

1332
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi4 – 8Combined sources5
Beta strandi9 – 12Combined sources4
Beta strandi20 – 26Combined sources7
Helixi30 – 41Combined sources12
Beta strandi46 – 51Combined sources6
Helixi55 – 67Combined sources13
Helixi68 – 71Combined sources4
Beta strandi77 – 79Combined sources3
Helixi83 – 86Combined sources4
Beta strandi90 – 94Combined sources5
Helixi107 – 127Combined sources21
Beta strandi132 – 135Combined sources4
Beta strandi137 – 139Combined sources3
Helixi140 – 151Combined sources12
Helixi155 – 157Combined sources3
Beta strandi158 – 160Combined sources3
Helixi164 – 178Combined sources15
Helixi182 – 184Combined sources3
Beta strandi189 – 193Combined sources5
Helixi194 – 196Combined sources3
Beta strandi197 – 199Combined sources3
Helixi201 – 203Combined sources3
Helixi211 – 214Combined sources4
Turni216 – 219Combined sources4
Beta strandi220 – 222Combined sources3
Helixi228 – 245Combined sources18
Helixi250 – 264Combined sources15
Beta strandi269 – 276Combined sources8
Beta strandi288 – 296Combined sources9
Beta strandi299 – 304Combined sources6
Helixi310 – 327Combined sources18

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1I10X-ray2.30A/B/C/D/E/F/G/H2-332[»]
4AJPX-ray2.38A/B/C/D2-332[»]
4JNKX-ray1.90A/B/C/D2-332[»]
4L4RX-ray2.10A/H2-332[»]
4L4SX-ray2.90A/H2-332[»]
4M49X-ray2.05A/B/C/D2-332[»]
4OJNX-ray2.40A/B/C/D/E/F/G/H2-332[»]
4OKNX-ray2.10A/B/C/D/E/F/G/H2-332[»]
4QO7X-ray2.14A/B/C/D2-332[»]
4QO8X-ray2.00A/B/C/D2-332[»]
4QSMX-ray3.00A/B/C/D/E/F/G/H2-332[»]
4QT0X-ray3.20A/B/C/D/E/F/G/H2-332[»]
4R68X-ray2.11A/B/C/D2-332[»]
4R69X-ray3.19A/B/C/D2-332[»]
4RLSX-ray1.91A/B/C/D2-332[»]
4ZVVX-ray2.20A/B/C/D1-332[»]
5IXSX-ray2.05A/B/C/D2-332[»]
5IXYX-ray3.00A/B/C/D2-332[»]
ProteinModelPortaliP00338.
SMRiP00338.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP00338.

Family & Domainsi

Sequence similaritiesi

Belongs to the LDH/MDH superfamily. LDH family.Curated

Phylogenomic databases

eggNOGiKOG1495. Eukaryota.
COG0039. LUCA.
GeneTreeiENSGT00550000074541.
HOGENOMiHOG000213793.
HOVERGENiHBG000462.
InParanoidiP00338.
KOiK00016.
OMAiNNEHRVL.
OrthoDBiEOG091G0HME.
PhylomeDBiP00338.
TreeFamiTF314963.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
3.90.110.10. 1 hit.
HAMAPiMF_00488. Lactate_dehydrog. 1 hit.
InterProiIPR001557. L-lactate/malate_DH.
IPR011304. L-lactate_DH.
IPR018177. L-lactate_DH_AS.
IPR022383. Lactate/malate_DH_C.
IPR001236. Lactate/malate_DH_N.
IPR015955. Lactate_DH/Glyco_Ohase_4_C.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PANTHERiPTHR11540. PTHR11540. 1 hit.
PfamiPF02866. Ldh_1_C. 1 hit.
PF00056. Ldh_1_N. 1 hit.
[Graphical view]
PIRSFiPIRSF000102. Lac_mal_DH. 1 hit.
PRINTSiPR00086. LLDHDRGNASE.
SUPFAMiSSF51735. SSF51735. 1 hit.
SSF56327. SSF56327. 1 hit.
TIGRFAMsiTIGR01771. L-LDH-NAD. 1 hit.
PROSITEiPS00064. L_LDH. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P00338-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATLKDQLIY NLLKEEQTPQ NKITVVGVGA VGMACAISIL MKDLADELAL
60 70 80 90 100
VDVIEDKLKG EMMDLQHGSL FLRTPKIVSG KDYNVTANSK LVIITAGARQ
110 120 130 140 150
QEGESRLNLV QRNVNIFKFI IPNVVKYSPN CKLLIVSNPV DILTYVAWKI
160 170 180 190 200
SGFPKNRVIG SGCNLDSARF RYLMGERLGV HPLSCHGWVL GEHGDSSVPV
210 220 230 240 250
WSGMNVAGVS LKTLHPDLGT DKDKEQWKEV HKQVVESAYE VIKLKGYTSW
260 270 280 290 300
AIGLSVADLA ESIMKNLRRV HPVSTMIKGL YGIKDDVFLS VPCILGQNGI
310 320 330
SDLVKVTLTS EEEARLKKSA DTLWGIQKEL QF
Length:332
Mass (Da):36,689
Last modified:January 23, 2007 - v2
Checksum:i401E8604CEB7F908
GO
Isoform 2 (identifier: P00338-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-274: VHKQVVESAY...KNLRRVHPVS → CRYTLGDPKG...ACCPFYLICD
     275-332: Missing.

Note: No experimental confirmation available.
Show »
Length:274
Mass (Da):30,057
Checksum:iD43CB4ACB426D6F0
GO
Isoform 3 (identifier: P00338-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGEPSGGYTYTQTSIFLFHAKIPFGSKSNM

Show »
Length:361
Mass (Da):39,837
Checksum:iD47D88F7C90BF11D
GO
Isoform 4 (identifier: P00338-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     82-139: Missing.

Show »
Length:274
Mass (Da):30,205
Checksum:i1EB83D11978134AD
GO
Isoform 5 (identifier: P00338-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-241: SAYEV → RVFTE
     242-332: Missing.

Show »
Length:241
Mass (Da):26,712
Checksum:i20B4A3E33A1ED002
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059374161S → R.Corresponds to variant rs5030621dbSNPEnsembl.1
Natural variantiVAR_004180222K → E.2 PublicationsCorresponds to variant rs748436361dbSNPEnsembl.1
Natural variantiVAR_004181315R → C.1 PublicationCorresponds to variant rs200093825dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0422061M → MGEPSGGYTYTQTSIFLFHA KIPFGSKSNM in isoform 3. 1 Publication1
Alternative sequenceiVSP_04278682 – 139Missing in isoform 4. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_014261230 – 274VHKQV…VHPVS → CRYTLGDPKGAAILKSSDVI SFHCLGYNRILGGGCACCPF YLICD in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_042788237 – 241SAYEV → RVFTE in isoform 5. Curated5
Alternative sequenceiVSP_042789242 – 332Missing in isoform 5. CuratedAdd BLAST91
Alternative sequenceiVSP_042787275 – 332Missing in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X02152 mRNA. Translation: CAA26088.1.
X03077
, X03078, X03079, X03080, X03081, X03082, X03083 Genomic DNA. Translation: CAA26879.1.
AY423727 mRNA. Translation: AAS00490.1.
AK130587 mRNA. Translation: BAC85389.1.
AK296667 mRNA. Translation: BAG59264.1.
AK298834 mRNA. Translation: BAH12879.1.
CR456775 mRNA. Translation: CAG33056.1.
CR541714 mRNA. Translation: CAG46515.1.
AK223078 mRNA. Translation: BAD96798.1.
AC084117 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68395.1.
CH471064 Genomic DNA. Translation: EAW68396.1.
BC067223 mRNA. Translation: AAH67223.1.
S66853 Genomic DNA. Translation: AAB20418.1.
CCDSiCCDS44549.1. [P00338-4]
CCDS53609.1. [P00338-3]
CCDS53610.1. [P00338-2]
CCDS53611.1. [P00338-5]
CCDS7839.1. [P00338-1]
PIRiA00347. DEHULM.
RefSeqiNP_001128711.1. NM_001135239.1. [P00338-4]
NP_001158886.1. NM_001165414.1. [P00338-3]
NP_001158887.1. NM_001165415.1. [P00338-2]
NP_001158888.1. NM_001165416.1. [P00338-5]
NP_005557.1. NM_005566.3. [P00338-1]
UniGeneiHs.2795.

Genome annotation databases

EnsembliENST00000227157; ENSP00000227157; ENSG00000134333. [P00338-5]
ENST00000379412; ENSP00000368722; ENSG00000134333. [P00338-1]
ENST00000396222; ENSP00000379524; ENSG00000134333. [P00338-2]
ENST00000422447; ENSP00000395337; ENSG00000134333. [P00338-1]
ENST00000430553; ENSP00000406172; ENSG00000134333. [P00338-4]
ENST00000540430; ENSP00000445175; ENSG00000134333. [P00338-3]
ENST00000542179; ENSP00000445331; ENSG00000134333. [P00338-1]
GeneIDi3939.
KEGGihsa:3939.
UCSCiuc001mol.4. human. [P00338-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Lactate dehydrogenase entry

Protein Spotlight

Another dark horse - Issue 109 of September 2009

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X02152 mRNA. Translation: CAA26088.1.
X03077
, X03078, X03079, X03080, X03081, X03082, X03083 Genomic DNA. Translation: CAA26879.1.
AY423727 mRNA. Translation: AAS00490.1.
AK130587 mRNA. Translation: BAC85389.1.
AK296667 mRNA. Translation: BAG59264.1.
AK298834 mRNA. Translation: BAH12879.1.
CR456775 mRNA. Translation: CAG33056.1.
CR541714 mRNA. Translation: CAG46515.1.
AK223078 mRNA. Translation: BAD96798.1.
AC084117 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68395.1.
CH471064 Genomic DNA. Translation: EAW68396.1.
BC067223 mRNA. Translation: AAH67223.1.
S66853 Genomic DNA. Translation: AAB20418.1.
CCDSiCCDS44549.1. [P00338-4]
CCDS53609.1. [P00338-3]
CCDS53610.1. [P00338-2]
CCDS53611.1. [P00338-5]
CCDS7839.1. [P00338-1]
PIRiA00347. DEHULM.
RefSeqiNP_001128711.1. NM_001135239.1. [P00338-4]
NP_001158886.1. NM_001165414.1. [P00338-3]
NP_001158887.1. NM_001165415.1. [P00338-2]
NP_001158888.1. NM_001165416.1. [P00338-5]
NP_005557.1. NM_005566.3. [P00338-1]
UniGeneiHs.2795.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1I10X-ray2.30A/B/C/D/E/F/G/H2-332[»]
4AJPX-ray2.38A/B/C/D2-332[»]
4JNKX-ray1.90A/B/C/D2-332[»]
4L4RX-ray2.10A/H2-332[»]
4L4SX-ray2.90A/H2-332[»]
4M49X-ray2.05A/B/C/D2-332[»]
4OJNX-ray2.40A/B/C/D/E/F/G/H2-332[»]
4OKNX-ray2.10A/B/C/D/E/F/G/H2-332[»]
4QO7X-ray2.14A/B/C/D2-332[»]
4QO8X-ray2.00A/B/C/D2-332[»]
4QSMX-ray3.00A/B/C/D/E/F/G/H2-332[»]
4QT0X-ray3.20A/B/C/D/E/F/G/H2-332[»]
4R68X-ray2.11A/B/C/D2-332[»]
4R69X-ray3.19A/B/C/D2-332[»]
4RLSX-ray1.91A/B/C/D2-332[»]
4ZVVX-ray2.20A/B/C/D1-332[»]
5IXSX-ray2.05A/B/C/D2-332[»]
5IXYX-ray3.00A/B/C/D2-332[»]
ProteinModelPortaliP00338.
SMRiP00338.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110131. 143 interactors.
IntActiP00338. 33 interactors.
MINTiMINT-4998672.
STRINGi9606.ENSP00000445175.

Chemistry databases

BindingDBiP00338.
ChEMBLiCHEMBL4835.
DrugBankiDB02701. Nicotinamide.

PTM databases

iPTMnetiP00338.
PhosphoSitePlusiP00338.
SwissPalmiP00338.

Polymorphism and mutation databases

BioMutaiLDHA.
DMDMi126047.

2D gel databases

DOSAC-COBS-2DPAGEP00338.
OGPiP00338.
REPRODUCTION-2DPAGEIPI00217966.

Proteomic databases

EPDiP00338.
PaxDbiP00338.
PeptideAtlasiP00338.
PRIDEiP00338.
TopDownProteomicsiP00338-1. [P00338-1]
P00338-4. [P00338-4]
P00338-5. [P00338-5]

Protocols and materials databases

DNASUi3939.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000227157; ENSP00000227157; ENSG00000134333. [P00338-5]
ENST00000379412; ENSP00000368722; ENSG00000134333. [P00338-1]
ENST00000396222; ENSP00000379524; ENSG00000134333. [P00338-2]
ENST00000422447; ENSP00000395337; ENSG00000134333. [P00338-1]
ENST00000430553; ENSP00000406172; ENSG00000134333. [P00338-4]
ENST00000540430; ENSP00000445175; ENSG00000134333. [P00338-3]
ENST00000542179; ENSP00000445331; ENSG00000134333. [P00338-1]
GeneIDi3939.
KEGGihsa:3939.
UCSCiuc001mol.4. human. [P00338-1]

Organism-specific databases

CTDi3939.
DisGeNETi3939.
GeneCardsiLDHA.
HGNCiHGNC:6535. LDHA.
HPAiCAB015336.
MalaCardsiLDHA.
MIMi150000. gene.
612933. phenotype.
neXtProtiNX_P00338.
OpenTargetsiENSG00000134333.
Orphaneti284426. Glycogen storage disease due to lactate dehydrogenase M-subunit deficiency.
PharmGKBiPA30319.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1495. Eukaryota.
COG0039. LUCA.
GeneTreeiENSGT00550000074541.
HOGENOMiHOG000213793.
HOVERGENiHBG000462.
InParanoidiP00338.
KOiK00016.
OMAiNNEHRVL.
OrthoDBiEOG091G0HME.
PhylomeDBiP00338.
TreeFamiTF314963.

Enzyme and pathway databases

UniPathwayiUPA00554; UER00611.
BioCyciZFISH:HS05858-MONOMER.
ReactomeiR-HSA-70268. Pyruvate metabolism.
SABIO-RKP00338.
SIGNORiP00338.

Miscellaneous databases

ChiTaRSiLDHA. human.
EvolutionaryTraceiP00338.
GeneWikiiLDHA.
GenomeRNAii3939.
PROiP00338.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000134333.
CleanExiHS_LDHA.
ExpressionAtlasiP00338. baseline and differential.
GenevisibleiP00338. HS.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
3.90.110.10. 1 hit.
HAMAPiMF_00488. Lactate_dehydrog. 1 hit.
InterProiIPR001557. L-lactate/malate_DH.
IPR011304. L-lactate_DH.
IPR018177. L-lactate_DH_AS.
IPR022383. Lactate/malate_DH_C.
IPR001236. Lactate/malate_DH_N.
IPR015955. Lactate_DH/Glyco_Ohase_4_C.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PANTHERiPTHR11540. PTHR11540. 1 hit.
PfamiPF02866. Ldh_1_C. 1 hit.
PF00056. Ldh_1_N. 1 hit.
[Graphical view]
PIRSFiPIRSF000102. Lac_mal_DH. 1 hit.
PRINTSiPR00086. LLDHDRGNASE.
SUPFAMiSSF51735. SSF51735. 1 hit.
SSF56327. SSF56327. 1 hit.
TIGRFAMsiTIGR01771. L-LDH-NAD. 1 hit.
PROSITEiPS00064. L_LDH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLDHA_HUMAN
AccessioniPrimary (citable) accession number: P00338
Secondary accession number(s): B4DKQ2
, B7Z5E3, D3DQY3, F8W819, Q53G53, Q6IBM7, Q6ZNV1, Q9UDE8, Q9UDE9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 206 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
  8. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.