P00338 (LDHA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 152.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: L-lactate dehydrogenase A chain Short name=LDH-A EC=1.1.1.27 Alternative name(s): Cell proliferation-inducing gene 19 protein LDH muscle subunit Short name=LDH-M Renal carcinoma antigen NY-REN-59 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 332 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | (S)-lactate + NAD+ = pyruvate + NADH. |
| Pathway | Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1. |
| Subunit structure | Homotetramer. Ref.22 |
| Subcellular location | |
| Post-translational modification | ISGylated. Ref.15 |
| Involvement in disease | Defects in LDHA are the cause of glycogen storage disease type 11 (GSD11) [MIM:612933]. A metabolic disorder that results in exertional myoglobinuria, pain, cramps and easy fatigue. Ref.13 |
| Sequence similarities | Belongs to the LDH/MDH superfamily. LDH family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Glycolysis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Glycogen storage disease |
| Ligand | NAD |
| Molecular function | Oxidoreductase |
| PTM | Acetylation Phosphoprotein Ubl conjugation |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | glycolysis Non-traceable author statement Ref.11. Source: UniProtKB pyruvate metabolic processTraceable author statement. Source: Reactome |
| Cellular component | cytosol Traceable author statement. Source: Reactome |
| Molecular function | L-lactate dehydrogenase activity Non-traceable author statement Ref.11. Source: UniProtKB nucleotide bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P00338-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P00338-2) The sequence of this isoform differs from the canonical sequence as follows: 230-274: VHKQVVESAY...KNLRRVHPVS → CRYTLGDPKG...ACCPFYLICD | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P00338-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGEPSGGYTYTQTSIFLFHAKIPFGSKSNM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 332 | 331 | L-lactate dehydrogenase A chain | PRO_0000168411 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 29 – 57 | 29 | NAD | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 193 | 1 | Proton acceptor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 99 | 1 | NAD | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 106 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 138 | 1 | NAD or substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 169 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 248 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.9 Ref.18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 5 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 10 | 1 | Phosphotyrosine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 14 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 57 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 81 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 118 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 126 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 222 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 239 | 1 | Phosphotyrosine Ref.16 Ref.17 Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 278 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 318 | 1 | N6-acetyllysine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MGEPSGGYTYTQTSIFLFHA KIPFGSKSNM in isoform 3. | VSP_042206 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 230 – 274 | 45 | VHKQV…VHPVS → CRYTLGDPKGAAILKSSDVI SFHCLGYNRILGGGCACCPF YLICD in isoform 2. | VSP_014261 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 161 | 1 | S → R. Corresponds to variant rs5030621 [ dbSNP | Ensembl ]. | VAR_059374 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 222 | 1 | K → E. Ref.6 Ref.24 | VAR_004180 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 315 | 1 | R → C. Ref.23 | VAR_004181 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 4 – 8 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 9 – 13 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 20 – 26 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 30 – 41 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 46 – 51 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 55 – 66 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 67 – 71 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 76 – 79 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 83 – 86 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 94 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 106 – 109 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 110 – 127 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 132 – 135 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 137 – 139 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 140 – 151 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 155 – 157 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 158 – 160 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 164 – 178 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 184 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 189 – 191 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 201 – 203 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 211 – 214 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 216 – 219 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 220 – 222 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 228 – 245 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 264 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 269 – 276 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 288 – 296 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 299 – 304 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 310 – 327 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nucleotide sequences of the cDNA and an intronless pseudogene for human lactate dehydrogenase-A isozyme." Tsujibo H., Tiano H.F., Li S.S.-L. Eur. J. Biochem. 147:9-15(1985) [PubMed: 3838278] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Genomic organization of human lactate dehydrogenase-A gene." Chung F.Z., Tsujibo H., Bhattacharyya U., Sharief F.S., Li S.S.-L. Biochem. J. 231:537-541(1985) [PubMed: 3000353] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Identification of a human proliferation-inducing gene." Kim J.W. Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). |
| [5] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLU-222. Tissue: Gastric carcinoma. |
| [7] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [10] | Bienvenut W.V. Submitted (MAR-2005) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-14; 43-57; 60-73; 77-112; 133-149; 158-169; 233-243; 306-315 AND 319-328, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: B-cell lymphoma. |
| [11] | "Analysis of genetic mutations in human lactate dehydrogenase-A(M) deficiency using DNA conformation polymorphism in combination with polyacrylamide gradient gel and silver staining." Maekawa M., Sudo K., Li S.S., Kanno T. Biochem. Biophys. Res. Commun. 180:1083-1090(1991) [PubMed: 1953713] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 112-121 AND 160-175. |
| [12] | "Genotypic analysis of families with lactate dehydrogenase A (M) deficiency by selective DNA amplification." Maekawa M., Sudo K., Li S.S., Kanno T. Hum. Genet. 88:34-38(1991) [PubMed: 1959923] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 250-254. |
| [13] | "Molecular characterization of genetic mutation in human lactate dehydrogenase-A (M) deficiency." Maekawa M., Sudo K., Kanno T., Li S.S. Biochem. Biophys. Res. Commun. 168:677-682(1990) [PubMed: 2334430] [Abstract] Cited for: INVOLVEMENT IN GSD11. |
| [14] | "Antigens recognized by autologous antibody in patients with renal-cell carcinoma." Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464(1999) [PubMed: 10508479] [Abstract] Cited for: IDENTIFICATION AS A RENAL CANCER ANTIGEN. Tissue: Renal cell carcinoma. |
| [15] | "Proteomic identification of proteins conjugated to ISG15 in mouse and human cells." Giannakopoulos N.V., Luo J.K., Papov V., Zou W., Lenschow D.J., Jacobs B.S., Borden E.C., Li J., Virgin H.W., Zhang D.E. Biochem. Biophys. Res. Commun. 336:496-506(2005) [PubMed: 16139798] [Abstract] Cited for: ISGYLATION. |
| [16] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-239, MASS SPECTROMETRY. |
| [17] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-239, MASS SPECTROMETRY. Tissue: Lung carcinoma. |
| [18] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [19] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-10 AND TYR-239, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [20] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-5; LYS-14; LYS-57; LYS-81; LYS-118; LYS-126; LYS-222; LYS-278 AND LYS-318, MASS SPECTROMETRY. |
| [21] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [22] | "Structural basis for altered activity of M- and H-isozyme forms of human lactate dehydrogenase." Read J.A., Winter V.J., Eszes C.M., Sessions R.B., Brady R.L. Proteins 43:175-185(2001) [PubMed: 11276087] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) IN COMPLEX WITH NADH AND SUBSTRATE ANALOG, HOMOTETRAMERIZATION. |
| [23] | "Molecular analysis of genetic mutation in electrophoretic variant of human lactate dehydrogenase-A(M) subunit." Sudo K., Maekawa M., Shioya M., Ikeda K., Takahashi N., Isogai Y., Li S.S.-L., Kanno T., Machida K., Toriumi J. Biochem. Int. 27:1051-1057(1992) [PubMed: 1445373] [Abstract] Cited for: VARIANT CYS-315. |
| [24] | "Fast-type electrophoretic variant of lactate dehydrogenase M(A) and comparison with other missense mutations in lactate dehydrogenase M(A) and H(B) genes." Maekawa M., Sudo K., Kobayashi A., Sugiyama E., Li S.S.-L., Kanno T. Clin. Chem. 40:665-668(1994) [PubMed: 7908613] [Abstract] Cited for: VARIANT GLU-222. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Wikipedia Lactate dehydrogenase entry |
| Protein Spotlight Another dark horse - Issue 109 of September 2009 |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X02152 mRNA. Translation: CAA26088.1. X03077 X03083 Genomic DNA. Translation: CAA26879.1.AY423727 mRNA. Translation: AAS00490.1. AK130587 mRNA. Translation: BAC85389.1. AK298834 mRNA. Translation: BAH12879.1. CR456775 mRNA. Translation: CAG33056.1. CR541714 mRNA. Translation: CAG46515.1. AK223078 mRNA. Translation: BAD96798.1. AC084117 Genomic DNA. No translation available. CH471064 Genomic DNA. Translation: EAW68395.1. CH471064 Genomic DNA. Translation: EAW68396.1. BC067223 mRNA. Translation: AAH67223.1. S66853 Genomic DNA. Translation: AAB20418.1. | ||||||||||||
| IPI | IPI00217966. IPI00607708. IPI00947127. | ||||||||||||
| PIR | DEHULM. A00347. | ||||||||||||
| RefSeq | NP_001158887.1. NM_001165415.1. NP_005557.1. NM_005566.3. | ||||||||||||
| UniGene | Hs.2795. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P00338. | ||||||||||||
| SMR | P00338. Positions 2-332. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P00338. 13 interactions. | ||||||||||||
| MINT | MINT-4998672. | ||||||||||||
| STRING | P00338. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P00338. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 126047. | ||||||||||||
2D gel databases | |||||||||||||
| Aarhus/Ghent-2DPAGE | 2207. NEPHGE. | ||||||||||||
| Cornea-2DPAGE | P00338. | ||||||||||||
| DOSAC-COBS-2DPAGE | P00338. | ||||||||||||
| OGP | P00338. | ||||||||||||
| REPRODUCTION-2DPAGE | IPI00217966. | ||||||||||||
Proteomic databases | |||||||||||||
| PeptideAtlas | P00338. | ||||||||||||
| PRIDE | P00338. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000422447; ENSP00000395337; ENSG00000134333. ENST00000540430; ENSP00000445175; ENSG00000134333. | ||||||||||||
| GeneID | 3939. | ||||||||||||
| KEGG | hsa:3939. | ||||||||||||
| NMPDR | fig|9606.3.peg.5346. | ||||||||||||
| UCSC | uc001mok.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 3939. | ||||||||||||
| GeneCards | GC11P018372. | ||||||||||||
| H-InvDB | HIX0009487. | ||||||||||||
| HGNC | HGNC:6535. LDHA. | ||||||||||||
| HPA | CAB015336. | ||||||||||||
| MIM | 150000. gene. 612933. phenotype. | ||||||||||||
| neXtProt | NX_P00338. | ||||||||||||
| Orphanet | 2364. Lactate dehydrogenase deficiency. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG08320. | ||||||||||||
| GeneTree | ENSGT00550000074541. | ||||||||||||
| HOVERGEN | HBG000462. | ||||||||||||
| InParanoid | P00338. | ||||||||||||
| OMA | IHPLSCH. | ||||||||||||
| OrthoDB | EOG4RR6HR. | ||||||||||||
| PhylomeDB | P00338. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | hif1_tfpathway. HIF-1-alpha transcription factor network. | ||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P00338. | ||||||||||||
| Bgee | P00338. | ||||||||||||
| CleanEx | HS_LDHA. | ||||||||||||
| Genevestigator | P00338. | ||||||||||||
| GermOnline | ENSG00000134333. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001557. L-lactate/malate_DH. IPR011304. L-lactate_DH. IPR018177. L-lactate_DH_AS. IPR022383. Lactate/malate_DH_C. IPR001236. Lactate/malate_DH_N. IPR015955. Lactate_DH/Glyco_Ohase_4_C. IPR016040. NAD(P)-bd_dom. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.90.110.10. lact_mal_DH. 1 hit. G3DSA:3.40.50.720. NAD(P)-bd. 1 hit. | ||||||||||||
| KO | K00016. | ||||||||||||
| Pfam | PF02866. Ldh_1_C. 1 hit. PF00056. Ldh_1_N. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF000102. Lac_mal_DH. 1 hit. | ||||||||||||
| PRINTS | PR00086. LLDHDRGNASE. | ||||||||||||
| SUPFAM | SSF56327. Lactate_DH/Glyco_hydro_4_C. 1 hit. | ||||||||||||
| TIGRFAMs | TIGR01771. L-LDH-NAD. 1 hit. | ||||||||||||
| PROSITE | PS00064. L_LDH. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| DrugBank | DB00157. NADH. | ||||||||||||
| NextBio | 15469. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | LDHA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P00338 Secondary accession number(s): B7Z5E3 Q9UDE9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |

Clusters with