P00257 (ADX_BOVIN) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Adrenodoxin, mitochondrial Alternative name(s): Adrenal ferredoxin Ferredoxin-1 Hepato-ferredoxin | ||||
| Gene names |
| ||||
| Organism | Bos taurus (Bovine) | ||||
| Taxonomic identifier | 9913 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Cetartiodactyla › Ruminantia › Pecora › Bovidae › Bovinae › Bos |
Protein attributes
| Sequence length | 186 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adrenodoxin transfer electrons from adrenodoxin reductase to the cholesterol side chain cleavage cytochrome P450. |
| Cofactor | Binds 1 2Fe-2S cluster. |
| Subcellular location | |
| Sequence similarities | Belongs to the adrenodoxin/putidaredoxin family. Contains 1 2Fe-2S ferredoxin-type domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| FDXR | P08165 | 2 | EBI-593992,EBI-593948 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P00257-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P00257-2) The sequence of this isoform differs from the canonical sequence as follows: 24-60: ARPRAGAGGLRGSRGPGLGGGAVATRTLSVSGRAQSS → LKSSQFIKVSCSGSWISAAQRAFICYSKSGNITCFLR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 58 | 58 | Mitochondrion Ref.8 | ||||||||||||||||||||||||||||||
| Chain | 59 – 186 | 128 | Adrenodoxin, mitochondrial | PRO_0000000986 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Domain | 65 – 169 | 105 | 2Fe-2S ferredoxin-type | ||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||
| Metal binding | 104 | 1 | Iron-sulfur (2Fe-2S) | ||||||||||||||||||||||||||||||
| Metal binding | 110 | 1 | Iron-sulfur (2Fe-2S) | ||||||||||||||||||||||||||||||
| Metal binding | 113 | 1 | Iron-sulfur (2Fe-2S) | ||||||||||||||||||||||||||||||
| Metal binding | 150 | 1 | Iron-sulfur (2Fe-2S) | ||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 24 – 60 | 37 | ARPRA…RAQSS → LKSSQFIKVSCSGSWISAAQ RAFICYSKSGNITCFLR in isoform 2. | VSP_016558 | |||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||
| Sequence conflict | 6 | 1 | L → M in AAI09850. Ref.6 | ||||||||||||||||||||||||||||||
| Sequence conflict | 24 | 1 | A → V in AAA30357. Ref.1 | ||||||||||||||||||||||||||||||
| Sequence conflict | 62 | 1 | E → Q AA sequence Ref.8 | ||||||||||||||||||||||||||||||
| Sequence conflict | 130 | 1 | D → N AA sequence Ref.8 | ||||||||||||||||||||||||||||||
| Sequence conflict | 134 | 1 | D → N AA sequence Ref.8 | ||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Beta strand | 65 – 70 | 6 | |||||||||||||||||||||||||||||||
| Beta strand | 76 – 81 | 6 | |||||||||||||||||||||||||||||||
| Helix | 87 – 93 | 7 | |||||||||||||||||||||||||||||||
| Turn | 99 – 104 | 6 | |||||||||||||||||||||||||||||||
| Beta strand | 105 – 109 | 5 | |||||||||||||||||||||||||||||||
| Beta strand | 114 – 116 | 3 | |||||||||||||||||||||||||||||||
| Helix | 119 – 122 | 4 | |||||||||||||||||||||||||||||||
| Helix | 130 – 136 | 7 | |||||||||||||||||||||||||||||||
| Beta strand | 146 – 148 | 3 | |||||||||||||||||||||||||||||||
| Helix | 149 – 151 | 3 | |||||||||||||||||||||||||||||||
| Helix | 156 – 158 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 161 – 164 | 4 | |||||||||||||||||||||||||||||||
| Helix | 171 – 173 | 3 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and amino acid sequence of the precursor form of bovine adrenodoxin: evidence for a previously unidentified COOH-terminal peptide." Okamura T., John M.E., Zuber M.X., Simpson E.R., Waterman M.R. Proc. Natl. Acad. Sci. U.S.A. 82:5705-5709(1985) [PubMed: 2994043] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Multiple species of bovine adrenodoxin mRNA. Occurrence of two different mitochondrial precursor sequences associated with the same mature sequence." Okamura T., Kagimoto M., Simpson E.R., Waterman M.R. J. Biol. Chem. 262:10335-10338(1987) [PubMed: 2440863] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Structural organization of the bovine adrenodoxin gene." Sagara Y., Sawae H., Kimura A., Sagara-Nakano Y., Morohashi K., Miyoshi K., Horiuchi T. J. Biochem. 107:77-83(1990) [PubMed: 2332422] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. |
| [4] | "Molecular cloning and nucleotide sequences of bovine hepato-ferredoxin cDNA; identical primary structures of hepato- and adreno-ferredoxins." Matsuo Y., Tomita S., Tsuneoka Y., Furukawa A., Ichikawa Y. Int. J. Biochem. 24:289-295(1992) [PubMed: 1733795] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [5] | "Characterization of 954 bovine full-CDS cDNA sequences." Harhay G.P., Sonstegard T.S., Keele J.W., Heaton M.P., Clawson M.L., Snelling W.M., Wiedmann R.T., Van Tassell C.P., Smith T.P.L. BMC Genomics 6:166-166(2005) [PubMed: 16305752] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | NIH - Mammalian Gene Collection (MGC) project Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: Crossbred X Angus. Tissue: Liver. |
| [7] | "Transcription of the bovine adrenodoxin gene produces two species of mRNA of which only one is translated into adrenodoxin." Kagimoto M., Kagimoto K., Simpson E.R., Waterman M.R. J. Biol. Chem. 263:8925-8928(1988) [PubMed: 2454231] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-102. |
| [8] | "The amino acid sequence of bovine adrenodoxin." Tanaka M., Haniu M., Yasunobu K.T., Kimura T. J. Biol. Chem. 248:1141-1157(1973) [PubMed: 4686920] [Abstract] Cited for: PROTEIN SEQUENCE OF 59-172 (ISOFORM 1). |
| [9] | "Isolation and purification of mature bovine adrenocortical ferredoxin with an elongated carboxyl end." Sakihama N., Hiwatashi A., Miyatake A., Shin M., Ichikawa Y. Arch. Biochem. Biophys. 264:23-29(1988) [PubMed: 3395121] [Abstract] Cited for: PROTEIN SEQUENCE OF 171-185. |
| [10] | "Adrenodoxin reductase-adrenodoxin complex structure suggests electron transfer path in steroid biosynthesis." Mueller J.J., Lapko A., Bourenkov G., Ruckpaul K., Heinemann U. J. Biol. Chem. 276:2786-2789(2001) [PubMed: 11053423] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 59-186 IN COMPLEX WITH ADRENODOXIN REDUCTASE. |
| [11] | "1H NMR spectra of vertebrate [2Fe-2S] ferredoxins. Hyperfine resonances suggest different electron delocalization patterns from plant ferredoxins." Skjeldal L., Markley J.L., Coghlan V.M., Vickery L.E. Biochemistry 30:9078-9083(1991) [PubMed: 1909889] [Abstract] Cited for: STRUCTURE BY NMR OF 59-186. |
| [12] | "A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin." Beilke D., Weiss R., Loehr F., Pristovsek P., Hannemann F., Bernhardt R., Rueterjans H. Biochemistry 41:7969-7978(2002) [PubMed: 12069587] [Abstract] Cited for: STRUCTURE BY NMR OF 59-186. |
| [13] | "New aspects of electron transfer revealed by the crystal structure of a truncated bovine adrenodoxin, Adx(4-108)." Mueller A., Mueller J.J., Muller Y.A., Uhlmann H., Bernhardt R., Heinemann U. Structure 6:269-280(1998) [PubMed: 9551550] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 63-166. |
| [14] | "The tertiary structure of full-length bovine adrenodoxin suggests functional dimers." Pikuleva I.A., Tesh K., Waterman M.R., Kim Y. Arch. Biochem. Biophys. 373:44-55(2000) [PubMed: 10620322] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M11746 mRNA. Translation: AAA30357.1. M16934 mRNA. Translation: AAA30358.1. D00467 mRNA. Translation: BAA00362.1. D00471 Genomic DNA. Translation: BAA00363.1. M19656, M19474 Genomic DNA. Translation: AAA78950.1. BT030601 mRNA. Translation: ABQ13041.1. BC109849 mRNA. Translation: AAI09850.1. S78831 mRNA. Translation: AAB21264.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00702556. IPI00716618. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | AXBO. JX0094. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_851354.1. NM_181011.2. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Bt.1573. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P00257. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P00257. Positions 63-175. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P00257. 2 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P00257. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSBTAT00000015660; ENSBTAP00000015660; ENSBTAG00000011793. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 281157. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | bta:281157. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 2230. | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | maNOG19611. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00530000063577. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000092. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P00257. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P00257. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001055. Adrenodoxin. IPR018298. Adrenodoxin_Fe-S_BS. IPR012675. Beta-grasp_ferredoxin-type. IPR001041. Ferredoxin. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.10.20.30. Ferredoxin_fold. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00111. Fer2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00355. ADRENODOXIN. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF54292. Ferredoxin. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS51085. 2FE2S_FER_2. 1 hit. PS00814. ADX. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ADX_BOVIN | ||||||||
| Accession | Primary (citable) accession number: P00257 Secondary accession number(s): A5D9I2 Q32KZ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with