Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adrenodoxin, mitochondrial

Gene

FDX1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (By similarity).By similarity

Cofactori

[2Fe-2S] clusterNote: Binds 1 [2Fe-2S] cluster.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi104Iron-sulfur (2Fe-2S)1
Metal bindingi110Iron-sulfur (2Fe-2S)1
Metal bindingi113Iron-sulfur (2Fe-2S)1
Metal bindingi150Iron-sulfur (2Fe-2S)1

GO - Molecular functioni

  • 2 iron, 2 sulfur cluster binding Source: UniProtKB
  • electron carrier activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • protein C-terminus binding Source: AgBase
  • protein homodimerization activity Source: AgBase

GO - Biological processi

  • cholesterol metabolic process Source: UniProtKB
  • hormone biosynthetic process Source: UniProtKB
  • oxidation-reduction process Source: UniProtKB
  • steroid biosynthetic process Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cholesterol metabolism, Electron transport, Lipid metabolism, Steroid metabolism, Steroidogenesis, Sterol metabolism, Transport

Keywords - Ligandi

2Fe-2S, Iron, Iron-sulfur, Metal-binding

Enzyme and pathway databases

ReactomeiR-BTA-1362409. Mitochondrial iron-sulfur cluster biogenesis.
R-BTA-196108. Pregnenolone biosynthesis.
R-BTA-211976. Endogenous sterols.
R-BTA-2395516. Electron transport from NADPH to Ferredoxin.

Names & Taxonomyi

Protein namesi
Recommended name:
Adrenodoxin, mitochondrial
Alternative name(s):
Adrenal ferredoxin
Ferredoxin-1
Hepato-ferredoxin
Gene namesi
Name:FDX1
Synonyms:ADX
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 15

Subcellular locationi

GO - Cellular componenti

  • mitochondrial matrix Source: UniProtKB-SubCell
  • mitochondrion Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 58MitochondrionAdd BLAST58
ChainiPRO_000000098659 – 186Adrenodoxin, mitochondrialAdd BLAST128

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei61PhosphoserineBy similarity1
Modified residuei64N6-acetyllysine; alternateBy similarity1
Modified residuei64N6-succinyllysine; alternateBy similarity1
Modified residuei156N6-succinyllysineBy similarity1
Modified residuei175PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP00257.
PRIDEiP00257.

PTM databases

iPTMnetiP00257.

Expressioni

Gene expression databases

BgeeiENSBTAG00000011793.
ExpressionAtlasiP00257. baseline and differential.

Interactioni

Subunit structurei

Interacts with CYP11A1.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
FDXRP081652EBI-593992,EBI-593948

GO - Molecular functioni

  • protein C-terminus binding Source: AgBase
  • protein homodimerization activity Source: AgBase

Protein-protein interaction databases

IntActiP00257. 2 interactors.
STRINGi9913.ENSBTAP00000015660.

Structurei

Secondary structure

1186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi64 – 70Combined sources7
Beta strandi72 – 74Combined sources3
Beta strandi76 – 82Combined sources7
Helixi87 – 93Combined sources7
Turni99 – 104Combined sources6
Beta strandi105 – 111Combined sources7
Beta strandi114 – 116Combined sources3
Helixi119 – 122Combined sources4
Helixi130 – 136Combined sources7
Beta strandi143 – 145Combined sources3
Beta strandi146 – 148Combined sources3
Helixi149 – 151Combined sources3
Helixi156 – 158Combined sources3
Beta strandi161 – 164Combined sources4
Helixi171 – 173Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AYFX-ray1.85A/B62-166[»]
1CJEX-ray2.50A/B/C/D60-186[»]
1E6EX-ray2.30B/D59-186[»]
1L6UNMR-A59-186[»]
1L6VNMR-A59-186[»]
2BT6X-ray1.50A/B63-166[»]
2JQRNMR-B62-166[»]
ProteinModelPortaliP00257.
SMRiP00257.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP00257.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini65 – 1692Fe-2S ferredoxin-typePROSITE-ProRule annotationAdd BLAST105

Sequence similaritiesi

Belongs to the adrenodoxin/putidaredoxin family.Curated
Contains 1 2Fe-2S ferredoxin-type domain.PROSITE-ProRule annotation

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3309. Eukaryota.
COG0633. LUCA.
GeneTreeiENSGT00530000063577.
HOGENOMiHOG000244518.
HOVERGENiHBG000092.
InParanoidiP00257.
OrthoDBiEOG091G0MJ2.
TreeFamiTF319845.

Family and domain databases

CDDicd00207. fer2. 1 hit.
Gene3Di3.10.20.30. 1 hit.
InterProiIPR001041. 2Fe-2S_ferredoxin-type.
IPR001055. Adrenodoxin.
IPR018298. Adrenodoxin_Fe-S_BS.
IPR012675. Beta-grasp_dom.
[Graphical view]
PfamiPF00111. Fer2. 1 hit.
[Graphical view]
PRINTSiPR00355. ADRENODOXIN.
SUPFAMiSSF54292. SSF54292. 1 hit.
PROSITEiPS51085. 2FE2S_FER_2. 1 hit.
PS00814. ADX. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P00257-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAARLLRVAS AALGDTAGRW RLLARPRAGA GGLRGSRGPG LGGGAVATRT
60 70 80 90 100
LSVSGRAQSS SEDKITVHFI NRDGETLTTK GKIGDSLLDV VVQNNLDIDG
110 120 130 140 150
FGACEGTLAC STCHLIFEQH IFEKLEAITD EENDMLDLAY GLTDRSRLGC
160 170 180
QICLTKAMDN MTVRVPDAVS DARESIDMGM NSSKIE
Length:186
Mass (Da):19,756
Last modified:July 1, 1989 - v2
Checksum:iF0F2EE027BFAC371
GO
Isoform 2 (identifier: P00257-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-60: ARPRAGAGGLRGSRGPGLGGGAVATRTLSVSGRAQSS → LKSSQFIKVSCSGSWISAAQRAFICYSKSGNITCFLR

Show »
Length:186
Mass (Da):20,395
Checksum:i7D3E98D62C9D12D3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti6L → M in AAI09850 (Ref. 6) Curated1
Sequence conflicti24A → V in AAA30357 (PubMed:2994043).Curated1
Sequence conflicti62E → Q AA sequence (PubMed:4686920).Curated1
Sequence conflicti130D → N AA sequence (PubMed:4686920).Curated1
Sequence conflicti134D → N AA sequence (PubMed:4686920).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01655824 – 60ARPRA…RAQSS → LKSSQFIKVSCSGSWISAAQ RAFICYSKSGNITCFLR in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M11746 mRNA. Translation: AAA30357.1.
M16934 mRNA. Translation: AAA30358.1.
D00467 mRNA. Translation: BAA00362.1.
D00471 Genomic DNA. Translation: BAA00363.1.
M19656, M19474 Genomic DNA. Translation: AAA78950.1.
BT030601 mRNA. Translation: ABQ13041.1.
BC109849 mRNA. Translation: AAI09850.1.
S78831 mRNA. Translation: AAB21264.1.
PIRiJX0094. AXBO.
RefSeqiNP_851354.1. NM_181011.2. [P00257-2]
UniGeneiBt.1573.

Genome annotation databases

EnsembliENSBTAT00000015660; ENSBTAP00000015660; ENSBTAG00000011793. [P00257-1]
GeneIDi281157.
KEGGibta:281157.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M11746 mRNA. Translation: AAA30357.1.
M16934 mRNA. Translation: AAA30358.1.
D00467 mRNA. Translation: BAA00362.1.
D00471 Genomic DNA. Translation: BAA00363.1.
M19656, M19474 Genomic DNA. Translation: AAA78950.1.
BT030601 mRNA. Translation: ABQ13041.1.
BC109849 mRNA. Translation: AAI09850.1.
S78831 mRNA. Translation: AAB21264.1.
PIRiJX0094. AXBO.
RefSeqiNP_851354.1. NM_181011.2. [P00257-2]
UniGeneiBt.1573.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AYFX-ray1.85A/B62-166[»]
1CJEX-ray2.50A/B/C/D60-186[»]
1E6EX-ray2.30B/D59-186[»]
1L6UNMR-A59-186[»]
1L6VNMR-A59-186[»]
2BT6X-ray1.50A/B63-166[»]
2JQRNMR-B62-166[»]
ProteinModelPortaliP00257.
SMRiP00257.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP00257. 2 interactors.
STRINGi9913.ENSBTAP00000015660.

PTM databases

iPTMnetiP00257.

Proteomic databases

PaxDbiP00257.
PRIDEiP00257.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000015660; ENSBTAP00000015660; ENSBTAG00000011793. [P00257-1]
GeneIDi281157.
KEGGibta:281157.

Organism-specific databases

CTDi2230.

Phylogenomic databases

eggNOGiKOG3309. Eukaryota.
COG0633. LUCA.
GeneTreeiENSGT00530000063577.
HOGENOMiHOG000244518.
HOVERGENiHBG000092.
InParanoidiP00257.
OrthoDBiEOG091G0MJ2.
TreeFamiTF319845.

Enzyme and pathway databases

ReactomeiR-BTA-1362409. Mitochondrial iron-sulfur cluster biogenesis.
R-BTA-196108. Pregnenolone biosynthesis.
R-BTA-211976. Endogenous sterols.
R-BTA-2395516. Electron transport from NADPH to Ferredoxin.

Miscellaneous databases

EvolutionaryTraceiP00257.

Gene expression databases

BgeeiENSBTAG00000011793.
ExpressionAtlasiP00257. baseline and differential.

Family and domain databases

CDDicd00207. fer2. 1 hit.
Gene3Di3.10.20.30. 1 hit.
InterProiIPR001041. 2Fe-2S_ferredoxin-type.
IPR001055. Adrenodoxin.
IPR018298. Adrenodoxin_Fe-S_BS.
IPR012675. Beta-grasp_dom.
[Graphical view]
PfamiPF00111. Fer2. 1 hit.
[Graphical view]
PRINTSiPR00355. ADRENODOXIN.
SUPFAMiSSF54292. SSF54292. 1 hit.
PROSITEiPS51085. 2FE2S_FER_2. 1 hit.
PS00814. ADX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiADX_BOVIN
AccessioniPrimary (citable) accession number: P00257
Secondary accession number(s): A5D9I2
, P08498, P12713, Q32KZ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 21, 1986
Last sequence update: July 1, 1989
Last modified: November 2, 2016
This is version 160 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.