Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G protein-coupled receptor L3

Gene

ADGRL3

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Plays a role in cell-cell adhesion and neuron guidance via its interactions with FLRT2 and FLRT3 that are expressed at the surface of adjacent cells. Plays a role in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi332CalciumBy similarity1
Metal bindingi380CalciumBy similarity1
Metal bindingi381Calcium; via carbonyl oxygenBy similarity1
Metal bindingi435Calcium; via carbonyl oxygenBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Lectin, Metal-binding

Protein family/group databases

MEROPSiP02.011.

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L3By similarity
Alternative name(s):
Latrophilin-31 Publication
Gene namesi
Name:ADGRL3By similarity
Synonyms:LPH31 Publication, LPHN3By similarity
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Unplaced

Subcellular locationi

  • Cell membrane By similarity; Multi-pass membrane protein By similarity
  • Cell projectionaxon By similarity
  • Cell junction By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 949ExtracellularSequence analysisAdd BLAST930
Transmembranei950 – 970Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini971 – 978CytoplasmicSequence analysis8
Transmembranei979 – 999Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini1000 – 1007ExtracellularSequence analysis8
Transmembranei1008 – 1028Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini1029 – 1050CytoplasmicSequence analysisAdd BLAST22
Transmembranei1051 – 1071Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini1072 – 1088ExtracellularSequence analysisAdd BLAST17
Transmembranei1089 – 1109Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini1110 – 1142CytoplasmicSequence analysisAdd BLAST33
Transmembranei1143 – 1163Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini1164 – 1169ExtracellularSequence analysis6
Transmembranei1170 – 1190Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini1191 – 1580CytoplasmicSequence analysisAdd BLAST390

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000001291220 – 1580Adhesion G protein-coupled receptor L3Add BLAST1561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi104 ↔ 134By similarity
Disulfide bondi113 ↔ 191By similarity
Disulfide bondi146 ↔ 178By similarity
Disulfide bondi159 ↔ 165By similarity
Glycosylationi161N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi203 ↔ 385PROSITE-ProRule annotation
Glycosylationi532N-linked (GlcNAc...)Sequence analysis1
Glycosylationi617N-linked (GlcNAc...)Sequence analysis1
Glycosylationi827N-linked (GlcNAc...)Sequence analysis1
Glycosylationi840N-linked (GlcNAc...)Sequence analysis1
Glycosylationi885N-linked (GlcNAc...)Sequence analysis1
Glycosylationi911N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1000N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1166N-linked (GlcNAc...)Sequence analysis1
Modified residuei1254PhosphoserineBy similarity1

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity
O-glycosylated (major) and N-glycosylated.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei922 – 923CleavageBy similarity2

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiO97827.
PRIDEiO97827.

Expressioni

Tissue specificityi

Brain-specific distribution but low levels are also detected in lung and spleen.1 Publication

Gene expression databases

BgeeiENSBTAG00000013918.

Interactioni

Subunit structurei

Interacts (via olfactomedin-like domain) with FLRT3 (via extracellular domain); the interaction is direct. Identified in a complex with FLRT3 and UNC5B; does not interact with UNC5B by itself. Identified in a complex with FLRT3 and UNC5D; does not interact with UNC5D by itself (By similarity). Interacts (via olfactomedin-like domain) with FLRT1 (via extracellular domain). Interacts (via olfactomedin-like domain) with FLRT2 (via extracellular domain). Interacts (via extracellular domain) with TENM1. Interacts (via extracellular domain) with TENM3 (By similarity).By similarity

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000039471.

Structurei

3D structure databases

ProteinModelPortaliO97827.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini103 – 192SUEL-type lectinPROSITE-ProRule annotationAdd BLAST90
Domaini202 – 461Olfactomedin-likePROSITE-ProRule annotationAdd BLAST260
Domaini883 – 934GPSPROSITE-ProRule annotationAdd BLAST52

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni317 – 347Interaction with FLRT3By similarityAdd BLAST31

Domaini

The Olfactomedin-like domain is required for the synapse-promoting function and the interaction with FLRT3. The Olfactomedin-like and the SUEL-type lectin domains are required for the interaction with TENM1 (By similarity).By similarity

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation
Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation
Contains 1 SUEL-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3545. Eukaryota.
KOG4193. Eukaryota.
ENOG410XSD2. LUCA.
HOVERGENiHBG052337.
InParanoidiO97827.
KOiK04594.

Family and domain databases

InterProiIPR032471. GAIN_dom_N.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR015630. Latrophilin-3.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like_dom.
[Graphical view]
PANTHERiPTHR12011:SF60. PTHR12011:SF60. 2 hits.
PfamiPF00002. 7tm_2. 1 hit.
PF16489. GAIN. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O97827-1) [UniParc]FASTAAdd to basket
Also known as: bbbf

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWPSQLLVFM MLLAPIIHGG KHSERHPALA SPLRHAERGP GGALPPRHLL
60 70 80 90 100
QQPAAERATA HRGPGPRGAT RGVRGPGAHG AQISAQAFSR APIPMAVVRR
110 120 130 140 150
ELSCESYPIE LRCPGTDVIM IESANYGRTD DKICDSDPAQ MENIRCYLPD
160 170 180 190 200
AYKIMSQRCN NRTQCAVVAG PDVFPDPCPG TYKYLEVQYE CVPYKVEQKV
210 220 230 240 250
FLCPGLLKGV YQSEHLFESD HQSGAWCKDP LQASDKIYYM PWTPYRTDTL
260 270 280 290 300
TEYSSKDDFI AGRPTTTYKL PHRVDGTGFV VYDGALFFNK ERTRNIVKFD
310 320 330 340 350
LRTRIKSGEA IIANANYHDT SPYRWGGKSD IDLAVDENGL WVIYATEQNN
360 370 380 390 400
GKIVISQLNP YTLRIEGTWD TAYDKRSASN AFMICGILYV VKSVYEDDDN
410 420 430 440 450
EATGNKIDYI YNTDQSKDSL VDVPFPNSYQ YIAAVDYNPR DNLLYVWNNY
460 470 480 490 500
HVVKYSLDFG PLDSRSGQAH HGQVSYISPP IHLDSDLERP PVREISTTGP
510 520 530 540 550
LGTGSTTTST TLRTTTWSPG RSTTPSVSGR RNRSTSTPSP AIEVLNDITT
560 570 580 590 600
HVPSASPQIP ALEESCEAVE AREIMWFKTR QGQMAKQPCP AGTIGVSTYL
610 620 630 640 650
CLAPDGIWDP QGPDLSNCSS PWVNHITQKL KSGETAANIA RELAEQTRNH
660 670 680 690 700
LNAGDITYSV RAMDQLVGLL DVQLRNLTPG GKDSAARSLN KLQKRERSCR
710 720 730 740 750
AYVQAMVETV NNLLQPQALN AWRDLTTSDQ LRAATMLLDT VEESAFVLAD
760 770 780 790 800
NLLKTDIVRE NTDNIQLEVA RLSTEGNLED LKFPENTGHG STIQLSANTL
810 820 830 840 850
KQNGRNGEIR VAFVLYNNLG PYLSTENASM KLGTEAMSTN HSVIVNSPVI
860 870 880 890 900
TAAINKEFSN KVYLADPVVF TVKHIKQSEE NFNPNCSFWS YSKRTMTGYW
910 920 930 940 950
STQGCRLLTT NKTHTTCSCN HLTNFAVLMA HVEVKHSDAV HDLLLDVITW
960 970 980 990 1000
VGILLSLVCL LICIFTFCFF RGLQSDRNTI HKNLCISLFV AELLFLIGIN
1010 1020 1030 1040 1050
RTDQPIACAV FAALLHFFFL AAFTWMFLEG VQLYIMLVEV FESEHSRRKY
1060 1070 1080 1090 1100
FYLVGYGMPA LIVAVSAAVD YRSYGTDKVC WLRLDTYFIW SFIGPATLII
1110 1120 1130 1140 1150
MLNVIFLGIA LYKMFHHTAI LKPESGCLDN INYEDNRPFI KSWVIGAIAL
1160 1170 1180 1190 1200
LCLLGLTWAF GLMYINESTV IMAYLFTIFN SLQGMFIFIF HCVLQKKVRK
1210 1220 1230 1240 1250
EYGKCLRTHC CSGRSTESSI GSGKTSGSRT PGRYSTGSQS RIRRMWNDTV
1260 1270 1280 1290 1300
RKQSESSFIT GDINSSASLN RGAMANHLIS NALLRPHGTN NPYNTLLGEP
1310 1320 1330 1340 1350
AVCNNPSVSM YNAQEGLLNN ARDTSVMDTL PLNGNHGNSY SIASGEYLSN
1360 1370 1380 1390 1400
CVQIIDRGYN HNETALEKKI LKELTSNYIP SYLNNHERSS EQNRNLMNKL
1410 1420 1430 1440 1450
VNNLGSGSED DAIVLDDATS FNHEESLGLE LIHEESDAPL LPPRVYSTEN
1460 1470 1480 1490 1500
HQLHHYTRRR IPQDHSESFF PLLTNEHTED LQSPHRDSLY TSMPALAGVP
1510 1520 1530 1540 1550
TAESVTTSTQ TEPPPAKCGD AEDVYYKSMP NLGSRNHVHQ LHTYYQLGRG
1560 1570 1580
SSDGFIVPPN KDGTPPEGSS KGPAHLVTSL
Length:1,580
Mass (Da):176,051
Last modified:May 1, 1999 - v1
Checksum:iD527CBF4B937DA8D
GO
Isoform 2 (identifier: O97827-2) [UniParc]FASTAAdd to basket
Also known as: abbf

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.

Show »
Length:1,512
Mass (Da):169,141
Checksum:i792CDD8790C4AA9B
GO
Isoform 3 (identifier: O97827-3) [UniParc]FASTAAdd to basket
Also known as: abah

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.

Show »
Length:1,503
Mass (Da):167,992
Checksum:iF4C8345D7F988218
GO
Isoform 4 (identifier: O97827-4) [UniParc]FASTAAdd to basket
Also known as: abah

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1316-1351: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1352-1580: Missing.

Show »
Length:1,274
Mass (Da):142,749
Checksum:i147C1B5FC160037F
GO
Isoform 5 (identifier: O97827-5) [UniParc]FASTAAdd to basket
Also known as: abag

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1272-1308: GAMANHLISNALLRPHGTNNPYNTLLGEPAVCNNPSV → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1309-1580: Missing.

Show »
Length:1,231
Mass (Da):138,201
Checksum:i1258A8A05D64325D
GO
Isoform 6 (identifier: O97827-6) [UniParc]FASTAAdd to basket
Also known as: abbg

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1272-1308: GAMANHLISNALLRPHGTNNPYNTLLGEPAVCNNPSV → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1309-1580: Missing.

Show »
Length:1,240
Mass (Da):139,350
Checksum:i23E8B26E48F88131
GO
Isoform 7 (identifier: O97827-7) [UniParc]FASTAAdd to basket
Also known as: bbaf

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.

Show »
Length:1,571
Mass (Da):174,902
Checksum:i2185D5ADCB5F8607
GO
Isoform 8 (identifier: O97827-8) [UniParc]FASTAAdd to basket
Also known as: abbh

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1316-1351: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1352-1580: Missing.

Show »
Length:1,283
Mass (Da):143,898
Checksum:i9D87F15DD6D01EC0
GO
Isoform 9 (identifier: O97827-9) [UniParc]FASTAAdd to basket
Also known as: bbah

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1316-1351: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1352-1580: Missing.

Show »
Length:1,342
Mass (Da):149,658
Checksum:i51FBC79F37FF5B4B
GO
Isoform 10 (identifier: O97827-10) [UniParc]FASTAAdd to basket
Also known as: bbbh

The sequence of this isoform differs from the canonical sequence as follows:
     1316-1351: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1352-1580: Missing.

Show »
Length:1,351
Mass (Da):150,808
Checksum:i7C085DE9224C742A
GO
Isoform 11 (identifier: O97827-11) [UniParc]FASTAAdd to basket
Also known as: bbag

The sequence of this isoform differs from the canonical sequence as follows:
     1132-1140: Missing.
     1272-1308: GAMANHLISNALLRPHGTNNPYNTLLGEPAVCNNPSV → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1309-1580: Missing.

Show »
Length:1,299
Mass (Da):145,110
Checksum:i9D83D9258D7FA821
GO
Isoform 12 (identifier: O97827-12) [UniParc]FASTAAdd to basket
Also known as: bbbg

The sequence of this isoform differs from the canonical sequence as follows:
     1272-1308: GAMANHLISNALLRPHGTNNPYNTLLGEPAVCNNPSV → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1309-1580: Missing.

Show »
Length:1,308
Mass (Da):146,259
Checksum:iC3B5827E272795AC
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01011319 – 86Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0101141131 – 1139Missing in isoform 3, isoform 4, isoform 5, isoform 7 and isoform 9. 1 Publication9
Alternative sequenceiVSP_0101151132 – 1140Missing in isoform 11. 1 Publication9
Alternative sequenceiVSP_0101161272 – 1308GAMAN…NNPSV → EPYRETSMGVKLNIAYQIGA SEQCQGYKCHGYSTTEW in isoform 5, isoform 6, isoform 11 and isoform 12. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0101171309 – 1580Missing in isoform 5, isoform 6, isoform 11 and isoform 12. 1 PublicationAdd BLAST272
Alternative sequenceiVSP_0101191316 – 1351GLLNN…YLSNC → PYRETSMGVKLNIAYQIGAS EQCQGYKCHGYSTTEW in isoform 4, isoform 8, isoform 9 and isoform 10. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0101201352 – 1580Missing in isoform 4, isoform 8, isoform 9 and isoform 10. 1 PublicationAdd BLAST229

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF111085 mRNA. Translation: AAD05321.1.
AF111086 mRNA. Translation: AAD05322.1.
AF111087 mRNA. Translation: AAD05323.1.
AF111088 mRNA. Translation: AAD05324.1.
AF111089 mRNA. Translation: AAD05325.1.
AF111090 mRNA. Translation: AAD05326.1.
AF111091 mRNA. Translation: AAD05327.1.
AF111092 mRNA. Translation: AAD05328.1.
AF111095 mRNA. Translation: AAD05331.1.
AF111093 mRNA. Translation: AAD05329.1.
AF111094 mRNA. Translation: AAD05330.1.
AF111096 mRNA. Translation: AAD05332.1.
PIRiT18389.
T18390.
T18391.
T18392.
T18393.
T18394.
T18395.
T18398.
T18405.
T18407.
T18408.
T18409.
RefSeqiNP_851376.1. NM_181033.2. [O97827-1]
XP_005208058.1. XM_005208001.3. [O97827-1]
XP_005208068.1. XM_005208011.3. [O97827-3]
XP_015327119.1. XM_015471633.1. [O97827-7]
XP_015327122.1. XM_015471636.1. [O97827-2]
XP_015327123.1. XM_015471637.1. [O97827-10]
XP_015327124.1. XM_015471638.1. [O97827-9]
XP_015327125.1. XM_015471639.1. [O97827-12]
XP_015327126.1. XM_015471640.1. [O97827-11]
XP_015327127.1. XM_015471641.1. [O97827-8]
XP_015327128.1. XM_015471642.1. [O97827-4]
XP_015327129.1. XM_015471643.1. [O97827-6]
XP_015327130.1. XM_015471644.1. [O97827-5]
UniGeneiBt.13181.

Genome annotation databases

GeneIDi282651.
KEGGibta:282651.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF111085 mRNA. Translation: AAD05321.1.
AF111086 mRNA. Translation: AAD05322.1.
AF111087 mRNA. Translation: AAD05323.1.
AF111088 mRNA. Translation: AAD05324.1.
AF111089 mRNA. Translation: AAD05325.1.
AF111090 mRNA. Translation: AAD05326.1.
AF111091 mRNA. Translation: AAD05327.1.
AF111092 mRNA. Translation: AAD05328.1.
AF111095 mRNA. Translation: AAD05331.1.
AF111093 mRNA. Translation: AAD05329.1.
AF111094 mRNA. Translation: AAD05330.1.
AF111096 mRNA. Translation: AAD05332.1.
PIRiT18389.
T18390.
T18391.
T18392.
T18393.
T18394.
T18395.
T18398.
T18405.
T18407.
T18408.
T18409.
RefSeqiNP_851376.1. NM_181033.2. [O97827-1]
XP_005208058.1. XM_005208001.3. [O97827-1]
XP_005208068.1. XM_005208011.3. [O97827-3]
XP_015327119.1. XM_015471633.1. [O97827-7]
XP_015327122.1. XM_015471636.1. [O97827-2]
XP_015327123.1. XM_015471637.1. [O97827-10]
XP_015327124.1. XM_015471638.1. [O97827-9]
XP_015327125.1. XM_015471639.1. [O97827-12]
XP_015327126.1. XM_015471640.1. [O97827-11]
XP_015327127.1. XM_015471641.1. [O97827-8]
XP_015327128.1. XM_015471642.1. [O97827-4]
XP_015327129.1. XM_015471643.1. [O97827-6]
XP_015327130.1. XM_015471644.1. [O97827-5]
UniGeneiBt.13181.

3D structure databases

ProteinModelPortaliO97827.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000039471.

Protein family/group databases

MEROPSiP02.011.
GPCRDBiSearch...

Proteomic databases

PaxDbiO97827.
PRIDEiO97827.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi282651.
KEGGibta:282651.

Organism-specific databases

CTDi23284.

Phylogenomic databases

eggNOGiKOG3545. Eukaryota.
KOG4193. Eukaryota.
ENOG410XSD2. LUCA.
HOVERGENiHBG052337.
InParanoidiO97827.
KOiK04594.

Gene expression databases

BgeeiENSBTAG00000013918.

Family and domain databases

InterProiIPR032471. GAIN_dom_N.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR015630. Latrophilin-3.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like_dom.
[Graphical view]
PANTHERiPTHR12011:SF60. PTHR12011:SF60. 2 hits.
PfamiPF00002. 7tm_2. 1 hit.
PF16489. GAIN. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAGRL3_BOVIN
AccessioniPrimary (citable) accession number: O97827
Secondary accession number(s): O97818
, O97819, O97820, O97821, O97822, O97823, O97824, O97825, O97826, O97828, O97829
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: May 1, 1999
Last modified: October 5, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.