Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Aromatic-L-amino-acid decarboxylase

Gene

Ddc

Organism
Drosophila simulans (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Protein inferred from homologyi

Functioni

Catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Variation in the synthesis of bioamines may be a factor contributing to natural variation in individual life span.1 Publication

Catalytic activityi

L-dopa = dopamine + CO2.
5-hydroxy-L-tryptophan = 5-hydroxytryptamine + CO2.

Cofactori

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei117SubstrateBy similarity1
Binding sitei183Pyridoxal phosphate; via amide nitrogenBy similarity1
Binding sitei184Pyridoxal phosphateBy similarity1
Binding sitei227SubstrateBy similarity1
Binding sitei280Pyridoxal phosphate; via carbonyl oxygenBy similarity1
Binding sitei334Pyridoxal phosphateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDecarboxylase, Lyase
Biological processCatecholamine biosynthesis
LigandPyridoxal phosphate

Names & Taxonomyi

Protein namesi
Recommended name:
Aromatic-L-amino-acid decarboxylase (EC:4.1.1.28)
Short name:
AADC
Alternative name(s):
DOPA decarboxylase
Short name:
DDC
Gene namesi
Name:Ddc
OrganismiDrosophila simulans (Fruit fly)
Taxonomic identifieri7240 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora

Organism-specific databases

FlyBaseiFBgn0016334. Dsim\Ddc.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001469471 – 510Aromatic-L-amino-acid decarboxylaseAdd BLAST510

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei337N6-(pyridoxal phosphate)lysineBy similarity1

Interactioni

Subunit structurei

Homodimer.By similarity

Structurei

3D structure databases

ProteinModelPortaliO96567.
SMRiO96567.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the group II decarboxylase family.Curated

Phylogenomic databases

OrthoDBiEOG091G03KI.

Family and domain databases

Gene3Di3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProiView protein in InterPro
IPR010977. Aromatic_deC.
IPR002129. PyrdxlP-dep_de-COase.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_sub2.
IPR021115. Pyridoxal-P_BS.
PfamiView protein in Pfam
PF00282. Pyridoxal_deC. 1 hit.
PRINTSiPR00800. YHDCRBOXLASE.
SUPFAMiSSF53383. SSF53383. 1 hit.
PROSITEiView protein in PROSITE
PS00392. DDC_GAD_HDC_YDC. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O96567-1) [UniParc]FASTAAdd to basket
Also known as: Brain, 56.7 kDa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSHIPISNTI PPKQTDGNGK ANISPDKLDP KVSIDMEAPE FKDFAKTMVD
60 70 80 90 100
FIAEYLENIR DRRVLPEVKP GYLKPLIPDA APEKPEKWQD VMQDIERVIM
110 120 130 140 150
PGVTHWHSPK FHAYFPTANS YPAIVADMLS GAIACIGFTW IASPACTELE
160 170 180 190 200
VVMMDWLGKM LELPAEFLVC SGGKGGGVIQ GTASESTLVA LLGAKAKKLK
210 220 230 240 250
EVKELHPEWD EHTILGKLVG YCSDQAHSSV ERAGLLGGVK LRSVQSENHR
260 270 280 290 300
MRGAALEKAI EQDLAEGLIP FYAVVTLGTT NSCAFDYLDE CGPVGNKHNL
310 320 330 340 350
WIHVDAAYAG SAFICPEYRH LMKGIESADS FNFNPHKWML VNFDCSAMWL
360 370 380 390 400
KDPSWVVNAF NVDPLYLKHD MQGSAPDYRH WQIPLGRRFR ALKLWFVLRL
410 420 430 440 450
YGVENLQAHI RRHCNFAKQF GDLCVADSRF ELAAEINMGL VCFRLKGSNE
460 470 480 490 500
RNEALLKRIN GRGHIHLVPA KIKDVYFLRM AICSRFTQSE DMEYSWKEVS
510
AAADEMEQEQ
Length:510
Mass (Da):57,312
Last modified:March 29, 2004 - v2
Checksum:i46EFB646F1E5B116
GO
Isoform 2 (identifier: O96567-2) [UniParc]FASTAAdd to basket
Also known as: Hypoderm, 56.2 kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSHIPISNTIPPKQTDGNGKANISPDKLDPKVS → MSIGLGTHIGVDNYARMLTKYFCIHIK

Show »
Length:504
Mass (Da):56,894
Checksum:iEBBC19B9990F2768
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti169V → A in AAC67580 (PubMed:10231575).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0097231 – 33MSHIP…DPKVS → MSIGLGTHIGVDNYARMLTK YFCIHIK in isoform 2. CuratedAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY197770 Genomic DNA. Translation: AAO16859.1.
AY197770 Genomic DNA. Translation: AAO16860.1.
AF091327 Genomic DNA. Translation: AAC67580.1.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDDC_DROSI
AccessioniPrimary (citable) accession number: O96567
Secondary accession number(s): Q7Z0D9, Q7Z0E0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: March 29, 2004
Last modified: October 25, 2017
This is version 87 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families