Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95998 (I18BP_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Interleukin-18-binding protein

Short name=IL-18BP
Alternative name(s):
Tadekinig-alfa
Gene names
Name:IL18BP
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length194 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response. Ref.1 Ref.4

Subcellular location

Secreted Potential.

Tissue specificity

Strongly expressed in heart, lung, placenta and spleen. Ref.1 Ref.2

Post-translational modification

N- and O-glycosylated. O-glycosylated with core 1-like and core 2-like glycans. O-glycan heterogeneity at Ser-53: HexHexNAc (major) and Hex2HexNAc2 (minor). N-glycan heterogeneity at Asn-103: Hex5HexNAc4 (minor), dHex1Hex5HexNAc4 (major) and Hex6HexNAc5 (minor); N-glycan at Asn-147: dHex1Hex5HexNAc4. Ref.10

Sequence similarities

Contains 1 Ig-like C2-type (immunoglobulin-like) domain.

Sequence caution

The sequence AAD17187.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAD17188.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAD17189.1 differs from that shown. Reason: Intron retention.

The sequence AAD17190.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAD17191.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAD17192.1 differs from that shown. Reason: Intron retention.

The sequence AAF31697.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform A (identifier: O95998-2)

Also known as: IL-18BPA;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform B (identifier: O95998-3)

Also known as: IL-18BPB;

The sequence of this isoform differs from the canonical sequence as follows:
     79-115: NGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLW → SWAEGNLAPHPRSPALQPQQSTAAGLRLSTGPAAAQP
     116-194: Missing.
Isoform D (identifier: O95998-4)

Also known as: IL-18BPD;

The sequence of this isoform differs from the canonical sequence as follows:
     128-163: TQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHV → WAEGNLAPHPRSPALQPQQSTAAGLRLSTGPAAAQP
     164-194: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3030 Ref.1 Ref.2 Ref.9
Chain31 – 194164Interleukin-18-binding protein
PRO_0000014778

Regions

Domain65 – 166102Ig-like C2-type

Amino acid modifications

Glycosylation531O-linked (GalNAc...) Ref.10
Glycosylation791N-linked (GlcNAc...) Potential
Glycosylation941N-linked (GlcNAc...) Potential
Glycosylation1031N-linked (GlcNAc...) (complex) Ref.10
Glycosylation1471N-linked (GlcNAc...) (complex) Ref.10
Disulfide bond86 ↔ 150 By similarity

Natural variations

Alternative sequence79 – 11537NGTLS…PGRLW → SWAEGNLAPHPRSPALQPQQ STAAGLRLSTGPAAAQP in isoform B.
VSP_002515
Alternative sequence116 – 19479Missing in isoform B.
VSP_002516
Alternative sequence128 – 16336TQLCK…VQRHV → WAEGNLAPHPRSPALQPQQS TAAGLRLSTGPAAAQP in isoform D.
VSP_037605
Alternative sequence164 – 19431Missing in isoform D.
VSP_037606
Natural variant911R → H.
Corresponds to variant rs5743672 [ dbSNP | Ensembl ].
VAR_059393
Natural variant1211R → Q.
Corresponds to variant rs5743673 [ dbSNP | Ensembl ].
VAR_024497

Sequences

Sequence LengthMass (Da)Tools
Isoform A (IL-18BPA) [UniParc].

Last modified July 7, 2009. Version 2.
Checksum: 5E520D6E46AFA843

FASTA19421,099
        10         20         30         40         50         60 
MTMRHNWTPD LSPLWVLLLC AHVVTLLVRA TPVSQTTTAA TASVRSTKDP CPSQPPVFPA 

        70         80         90        100        110        120 
AKQCPALEVT WPEVEVPLNG TLSLSCVACS RFPNFSILYW LGNGSFIEHL PGRLWEGSTS 

       130        140        150        160        170        180 
RERGSTGTQL CKALVLEQLT PALHSTNFSC VLVDPEQVVQ RHVVLAQLWA GLRATLPPTQ 

       190 
EALPSSHSSP QQQG 

« Hide

Isoform B (IL-18BPB) [UniParc].

Checksum: 2D6C79F64E1937BF
Show »

FASTA11512,221
Isoform D (IL-18BPD) [UniParc].

Checksum: D25DD52998594ABB
Show »

FASTA16317,478

References

« Hide 'large scale' references
[1]"Interleukin-18 binding protein: a novel modulator of the Th1 cytokine response."
Novick D., Kim S.-H., Fantuzzi G., Reznikov L.L., Dinarello C.A., Rubinstein M.
Immunity 10:127-136(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS A AND B), PROTEIN SEQUENCE OF 31-70, FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
[2]"Cloning and expression of interleukin-18 binding protein."
Aizawa Y., Akita K., Taniai M., Torigoe K., Mori T., Nishida Y., Ushio S., Nukada Y., Tanimoto T., Ikegami H., Ikeda M., Kurimoto M.
FEBS Lett. 445:338-342(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), PROTEIN SEQUENCE OF 31-35; 39-45; 48-54; 57-60; 63-74; 91-95; 107-144 AND 151-169, TISSUE SPECIFICITY.
[3]"Identification of human and mouse homologs of the MC51L-53L-54L family of secreted glycoproteins encoded by the Molluscum contagiosum poxvirus."
Xiang Y., Moss B.
Virology 257:297-302(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
[4]"Structural requirements of six naturally occurring isoforms of the IL-18 binding protein to inhibit IL-18."
Kim S.-H., Eisenstein M., Reznikov L., Fantuzzi G., Novick D., Rubinstein M., Dinarello C.A.
Proc. Natl. Acad. Sci. U.S.A. 97:1190-1195(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), FUNCTION, ALTERNATIVE SPLICING (ISOFORMS A AND B).
Tissue: T-cell.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
Tissue: Uterus.
[6]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
Tissue: Leukocyte.
[9]"Signal peptide prediction based on analysis of experimentally verified cleavage sites."
Zhang Z., Henzel W.J.
Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 31-45.
[10]"Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD."
Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.
Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION AT SER-53; ASN-103 AND ASN-147, STRUCTURE OF CARBOHYDRATES, IDENTIFICATION BY MASS SPECTROMETRY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF110798 Genomic DNA. Translation: AAD17187.1. Different initiation.
AF110798 Genomic DNA. Translation: AAD17188.1. Different initiation.
AF110798 Genomic DNA. Translation: AAD17189.1. Sequence problems.
AF110799 mRNA. Translation: AAD17190.1. Different initiation.
AF110800 mRNA. Translation: AAD17191.1. Different initiation.
AF110801 mRNA. Translation: AAD17192.1. Sequence problems.
AB019504 mRNA. Translation: BAA76374.1.
AF122906 mRNA. Translation: AAD41051.1.
AF215907 mRNA. Translation: AAF31697.1. Different initiation.
AK098255 mRNA. Translation: BAG53602.1.
AP002490 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74813.1.
CH471076 Genomic DNA. Translation: EAW74816.1.
BC044215 mRNA. Translation: AAH44215.1.
RefSeqNP_001034748.1. NM_001039659.1.
NP_001034749.1. NM_001039660.1.
NP_001138527.1. NM_001145055.1.
NP_001138529.1. NM_001145057.1.
NP_005690.2. NM_005699.3.
NP_766630.2. NM_173042.2.
NP_766632.2. NM_173044.2.
XP_005273762.1. XM_005273705.1.
UniGeneHs.591967.

3D structure databases

ProteinModelPortalO95998.
SMRO95998. Positions 74-169.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115379. 1 interaction.
IntActO95998. 3 interactions.
STRING9606.ENSP00000260049.

Proteomic databases

PaxDbO95998.
PRIDEO95998.

Protocols and materials databases

DNASU10068.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000260049; ENSP00000260049; ENSG00000137496. [O95998-2]
ENST00000337131; ENSP00000338723; ENSG00000137496. [O95998-2]
ENST00000343898; ENSP00000343309; ENSG00000137496. [O95998-4]
ENST00000393703; ENSP00000377306; ENSG00000137496. [O95998-2]
ENST00000393705; ENSP00000377308; ENSG00000137496. [O95998-2]
ENST00000393707; ENSP00000377310; ENSG00000137496. [O95998-3]
ENST00000404792; ENSP00000384212; ENSG00000137496. [O95998-2]
ENST00000534583; ENSP00000434376; ENSG00000137496. [O95998-2]
GeneID10068.
KEGGhsa:10068.
UCSCuc001ore.1. human. [O95998-2]
uc009ysv.1. human. [O95998-3]
uc021qmv.1. human. [O95998-4]

Organism-specific databases

CTD10068.
GeneCardsGC11P071709.
H-InvDBHIX0009903.
HGNCHGNC:5987. IL18BP.
HPACAB025980.
MIM604113. gene.
neXtProtNX_O95998.
PharmGKBPA29803.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG45302.
HOVERGENHBG052064.
OMAHFSILYW.
OrthoDBEOG7MD4RH.
PhylomeDBO95998.
TreeFamTF337962.

Gene expression databases

ArrayExpressO95998.
BgeeO95998.
CleanExHS_IL18BP.
GenevestigatorO95998.

Family and domain databases

InterProIPR007110. Ig-like_dom.
[Graphical view]
PROSITEPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiIL18BP.
GenomeRNAi10068.
NextBio38051.
PROO95998.
SOURCESearch...

Entry information

Entry nameI18BP_HUMAN
AccessionPrimary (citable) accession number: O95998
Secondary accession number(s): B3KUZ0 expand/collapse secondary AC list , B7WPK4, O95993, O96027, Q9NZA9, Q9UBR7
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: July 7, 2009
Last modified: April 16, 2014
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM