O95998 (I18BP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Interleukin-18-binding protein Short name=IL-18BP Alternative name(s): Tadekinig-alfa | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 194 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response. Ref.1 Ref.4 |
| Subcellular location | Secreted Potential. |
| Tissue specificity | Strongly expressed in heart, lung, placenta and spleen. Ref.1 Ref.2 |
| Post-translational modification | N- and O-glycosylated. O-glycosylated with core 1-like and core 2-like glycans. O-glycan heterogeneity at Ser-53: HexHexNAc (major) and Hex2HexNAc2 (minor). N-glycan heterogeneity at Asn-103: Hex5HexNAc4 (minor), dHex1Hex5HexNAc4 (major) and Hex6HexNAc5 (minor); N-glycan at Asn-147: dHex1Hex5HexNAc4. Ref.10 |
| Sequence similarities | Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
| Sequence caution | The sequence AAD17187.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAD17188.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAD17189.1 differs from that shown. Reason: Intron retention. The sequence AAD17190.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAD17191.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAD17192.1 differs from that shown. Reason: Intron retention. The sequence AAF31697.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Signal |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | T-helper 1 type immune response Inferred from direct assay Ref.1. Source: UniProtKB cellular response to hydrogen peroxideInferred from electronic annotation. Source: Compara cellular response to tumor necrosis factorInferred from electronic annotation. Source: Compara response to lipopolysaccharideInferred from electronic annotation. Source: Compara |
| Cellular_component | extracellular region Traceable author statement Ref.1. Source: UniProtKB extracellular spaceInferred from electronic annotation. Source: Compara |
| Molecular_function | interleukin-18 binding Inferred from direct assay Ref.1. Source: UniProtKB receptor antagonist activityTraceable author statement PubMed 11890646. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: O95998-2) Also known as: IL-18BPA; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: O95998-3) Also known as: IL-18BPB; The sequence of this isoform differs from the canonical sequence as follows: 79-115: NGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLW → SWAEGNLAPHPRSPALQPQQSTAAGLRLSTGPAAAQP 116-194: Missing. | ||||||
| Isoform D (identifier: O95998-4) Also known as: IL-18BPD; The sequence of this isoform differs from the canonical sequence as follows: 128-163: TQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHV → WAEGNLAPHPRSPALQPQQSTAAGLRLSTGPAAAQP 164-194: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 30 | 30 | Ref.1 Ref.2 Ref.9 | ||||||||
| Chain | 31 – 194 | 164 | Interleukin-18-binding protein | PRO_0000014778 | |||||||
Regions | |||||||||||
| Domain | 65 – 166 | 102 | Ig-like C2-type | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 53 | 1 | O-linked (GalNAc...) Ref.10 | ||||||||
| Glycosylation | 79 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 94 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) (complex) Ref.10 | ||||||||
| Glycosylation | 147 | 1 | N-linked (GlcNAc...) (complex) Ref.10 | ||||||||
| Disulfide bond | 86 ↔ 150 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 79 – 115 | 37 | NGTLS…PGRLW → SWAEGNLAPHPRSPALQPQQ STAAGLRLSTGPAAAQP in isoform B. | VSP_002515 | |||||||
| Alternative sequence | 116 – 194 | 79 | Missing in isoform B. | VSP_002516 | |||||||
| Alternative sequence | 128 – 163 | 36 | TQLCK…VQRHV → WAEGNLAPHPRSPALQPQQS TAAGLRLSTGPAAAQP in isoform D. | VSP_037605 | |||||||
| Alternative sequence | 164 – 194 | 31 | Missing in isoform D. | VSP_037606 | |||||||
| Natural variant | 91 | 1 | R → H. Corresponds to variant rs5743672 [ dbSNP | Ensembl ]. | VAR_059393 | |||||||
| Natural variant | 121 | 1 | R → Q. Corresponds to variant rs5743673 [ dbSNP | Ensembl ]. | VAR_024497 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Interleukin-18 binding protein: a novel modulator of the Th1 cytokine response." Novick D., Kim S.-H., Fantuzzi G., Reznikov L.L., Dinarello C.A., Rubinstein M. Immunity 10:127-136(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS A AND B), PROTEIN SEQUENCE OF 31-70, FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [2] | "Cloning and expression of interleukin-18 binding protein." Aizawa Y., Akita K., Taniai M., Torigoe K., Mori T., Nishida Y., Ushio S., Nukada Y., Tanimoto T., Ikegami H., Ikeda M., Kurimoto M. FEBS Lett. 445:338-342(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), PROTEIN SEQUENCE OF 31-35; 39-45; 48-54; 57-60; 63-74; 91-95; 107-144 AND 151-169, TISSUE SPECIFICITY. |
| [3] | "Identification of human and mouse homologs of the MC51L-53L-54L family of secreted glycoproteins encoded by the Molluscum contagiosum poxvirus." Xiang Y., Moss B. Virology 257:297-302(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). |
| [4] | "Structural requirements of six naturally occurring isoforms of the IL-18 binding protein to inhibit IL-18." Kim S.-H., Eisenstein M., Reznikov L., Fantuzzi G., Novick D., Rubinstein M., Dinarello C.A. Proc. Natl. Acad. Sci. U.S.A. 97:1190-1195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), FUNCTION, ALTERNATIVE SPLICING (ISOFORMS A AND B). Tissue: T-cell. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Uterus. |
| [6] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Leukocyte. |
| [9] | "Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 31-45. |
| [10] | "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD." Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT SER-53; ASN-103 AND ASN-147, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF110798 Genomic DNA. Translation: AAD17187.1. Different initiation. AF110798 Genomic DNA. Translation: AAD17188.1. Different initiation. AF110798 Genomic DNA. Translation: AAD17189.1. Sequence problems. AF110799 mRNA. Translation: AAD17190.1. Different initiation. AF110800 mRNA. Translation: AAD17191.1. Different initiation. AF110801 mRNA. Translation: AAD17192.1. Sequence problems. AB019504 mRNA. Translation: BAA76374.1. AF122906 mRNA. Translation: AAD41051.1. AF215907 mRNA. Translation: AAF31697.1. Different initiation. AK098255 mRNA. Translation: BAG53602.1. AP002490 Genomic DNA. No translation available. CH471076 Genomic DNA. Translation: EAW74813.1. CH471076 Genomic DNA. Translation: EAW74816.1. BC044215 mRNA. Translation: AAH44215.1. |
| IPI | IPI00304305. IPI00848010. IPI00873924. |
| RefSeq | NP_001034748.1. NM_001039659.1. NP_001034749.1. NM_001039660.1. NP_001138527.1. NM_001145055.1. NP_001138529.1. NM_001145057.1. NP_005690.2. NM_005699.3. NP_766630.2. NM_173042.2. NP_766632.2. NM_173044.2. |
| UniGene | Hs.591967. |
3D structure databases | |
| ProteinModelPortal | O95998. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O95998. 3 interactions. |
| STRING | 9606.ENSP00000260049. |
Proteomic databases | |
| PaxDb | O95998. |
| PRIDE | O95998. |
Protocols and materials databases | |
| DNASU | 10068. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000260049; ENSP00000260049; ENSG00000137496. ENST00000337131; ENSP00000338723; ENSG00000137496. ENST00000343898; ENSP00000343309; ENSG00000137496. ENST00000393703; ENSP00000377306; ENSG00000137496. ENST00000393705; ENSP00000377308; ENSG00000137496. ENST00000393707; ENSP00000377310; ENSG00000137496. ENST00000404792; ENSP00000384212; ENSG00000137496. ENST00000534583; ENSP00000434376; ENSG00000137496. |
| GeneID | 10068. |
| KEGG | hsa:10068. |
| UCSC | uc001ore.1. human. uc009ysv.1. human. uc021qmv.1. human. |
Organism-specific databases | |
| CTD | 10068. |
| GeneCards | GC11P071709. |
| H-InvDB | HIX0009903. |
| HGNC | HGNC:5987. IL18BP. |
| HPA | CAB025980. |
| MIM | 604113. gene. |
| neXtProt | NX_O95998. |
| PharmGKB | PA29803. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG45302. |
| HOVERGEN | HBG052064. |
| OMA | CTACSRF. |
| OrthoDB | EOG4DFPPS. |
Gene expression databases | |
| ArrayExpress | O95998. |
| Bgee | O95998. |
| CleanEx | HS_IL18BP. |
| Genevestigator | O95998. |
| GermOnline | ENSG00000137496. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007110. Ig-like_dom. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10068. |
| NextBio | 38051. |
| SOURCE | Search... |
Entry information
| Entry name | I18BP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95998 Secondary accession number(s): B3KUZ0 Q9UBR7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
