Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95998

- I18BP_HUMAN

UniProt

O95998 - I18BP_HUMAN

Protein

Interleukin-18-binding protein

Gene

IL18BP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 123 (01 Oct 2014)
      Sequence version 2 (07 Jul 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.2 Publications

    GO - Molecular functioni

    1. interleukin-18 binding Source: UniProtKB
    2. receptor antagonist activity Source: UniProtKB

    GO - Biological processi

    1. cellular response to hydrogen peroxide Source: Ensembl
    2. cellular response to tumor necrosis factor Source: Ensembl
    3. extracellular negative regulation of signal transduction Source: GOC
    4. response to lipopolysaccharide Source: Ensembl
    5. T-helper 1 type immune response Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Interleukin-18-binding protein
    Short name:
    IL-18BP
    Alternative name(s):
    Tadekinig-alfa
    Gene namesi
    Name:IL18BP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:5987. IL18BP.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB
    2. extracellular space Source: Ensembl
    3. extracellular vesicular exosome Source: UniProt

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA29803.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 30303 PublicationsAdd
    BLAST
    Chaini31 – 194164Interleukin-18-binding proteinPRO_0000014778Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi53 – 531O-linked (GalNAc...)1 Publication
    Glycosylationi79 – 791N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi86 ↔ 150PROSITE-ProRule annotation
    Glycosylationi94 – 941N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi103 – 1031N-linked (GlcNAc...) (complex)1 Publication
    Glycosylationi147 – 1471N-linked (GlcNAc...) (complex)1 Publication

    Post-translational modificationi

    N- and O-glycosylated. O-glycosylated with core 1-like and core 2-like glycans. O-glycan heterogeneity at Ser-53: HexHexNAc (major) and Hex2HexNAc2 (minor). N-glycan heterogeneity at Asn-103: Hex5HexNAc4 (minor), dHex1Hex5HexNAc4 (major) and Hex6HexNAc5 (minor); N-glycan at Asn-147: dHex1Hex5HexNAc4.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiO95998.
    PRIDEiO95998.

    Expressioni

    Tissue specificityi

    Strongly expressed in heart, lung, placenta and spleen.2 Publications

    Gene expression databases

    ArrayExpressiO95998.
    BgeeiO95998.
    CleanExiHS_IL18BP.
    GenevestigatoriO95998.

    Organism-specific databases

    HPAiCAB025980.

    Interactioni

    Protein-protein interaction databases

    BioGridi115379. 1 interaction.
    IntActiO95998. 3 interactions.
    STRINGi9606.ENSP00000260049.

    Structurei

    3D structure databases

    ProteinModelPortaliO95998.
    SMRiO95998. Positions 74-169.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini65 – 166102Ig-like C2-typeAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Signal

    Phylogenomic databases

    eggNOGiNOG45302.
    HOVERGENiHBG052064.
    OMAiHFSILYW.
    OrthoDBiEOG7MD4RH.
    PhylomeDBiO95998.
    TreeFamiTF337962.

    Family and domain databases

    InterProiIPR007110. Ig-like_dom.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform A (identifier: O95998-2) [UniParc]FASTAAdd to Basket

    Also known as: IL-18BPA

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTMRHNWTPD LSPLWVLLLC AHVVTLLVRA TPVSQTTTAA TASVRSTKDP    50
    CPSQPPVFPA AKQCPALEVT WPEVEVPLNG TLSLSCVACS RFPNFSILYW 100
    LGNGSFIEHL PGRLWEGSTS RERGSTGTQL CKALVLEQLT PALHSTNFSC 150
    VLVDPEQVVQ RHVVLAQLWA GLRATLPPTQ EALPSSHSSP QQQG 194
    Length:194
    Mass (Da):21,099
    Last modified:July 7, 2009 - v2
    Checksum:i5E520D6E46AFA843
    GO
    Isoform B (identifier: O95998-3) [UniParc]FASTAAdd to Basket

    Also known as: IL-18BPB

    The sequence of this isoform differs from the canonical sequence as follows:
         79-115: NGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLW → SWAEGNLAPHPRSPALQPQQSTAAGLRLSTGPAAAQP
         116-194: Missing.

    Show »
    Length:115
    Mass (Da):12,221
    Checksum:i2D6C79F64E1937BF
    GO
    Isoform D (identifier: O95998-4) [UniParc]FASTAAdd to Basket

    Also known as: IL-18BPD

    The sequence of this isoform differs from the canonical sequence as follows:
         128-163: TQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHV → WAEGNLAPHPRSPALQPQQSTAAGLRLSTGPAAAQP
         164-194: Missing.

    Show »
    Length:163
    Mass (Da):17,478
    Checksum:iD25DD52998594ABB
    GO

    Sequence cautioni

    The sequence AAD17189.1 differs from that shown. Reason: Intron retention.
    The sequence AAD17192.1 differs from that shown. Reason: Intron retention.
    The sequence AAD17187.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAD17188.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAD17190.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAD17191.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAF31697.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti91 – 911R → H.
    Corresponds to variant rs5743672 [ dbSNP | Ensembl ].
    VAR_059393
    Natural varianti121 – 1211R → Q.
    Corresponds to variant rs5743673 [ dbSNP | Ensembl ].
    VAR_024497

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei79 – 11537NGTLS…PGRLW → SWAEGNLAPHPRSPALQPQQ STAAGLRLSTGPAAAQP in isoform B. 1 PublicationVSP_002515Add
    BLAST
    Alternative sequencei116 – 19479Missing in isoform B. 1 PublicationVSP_002516Add
    BLAST
    Alternative sequencei128 – 16336TQLCK…VQRHV → WAEGNLAPHPRSPALQPQQS TAAGLRLSTGPAAAQP in isoform D. 1 PublicationVSP_037605Add
    BLAST
    Alternative sequencei164 – 19431Missing in isoform D. 1 PublicationVSP_037606Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF110798 Genomic DNA. Translation: AAD17187.1. Different initiation.
    AF110798 Genomic DNA. Translation: AAD17188.1. Different initiation.
    AF110798 Genomic DNA. Translation: AAD17189.1. Sequence problems.
    AF110799 mRNA. Translation: AAD17190.1. Different initiation.
    AF110800 mRNA. Translation: AAD17191.1. Different initiation.
    AF110801 mRNA. Translation: AAD17192.1. Sequence problems.
    AB019504 mRNA. Translation: BAA76374.1.
    AF122906 mRNA. Translation: AAD41051.1.
    AF215907 mRNA. Translation: AAF31697.1. Different initiation.
    AK098255 mRNA. Translation: BAG53602.1.
    AP002490 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74813.1.
    CH471076 Genomic DNA. Translation: EAW74816.1.
    BC044215 mRNA. Translation: AAH44215.1.
    CCDSiCCDS44666.1. [O95998-3]
    CCDS8206.2. [O95998-2]
    RefSeqiNP_001034748.1. NM_001039659.1. [O95998-2]
    NP_001034749.1. NM_001039660.1. [O95998-2]
    NP_001138527.1. NM_001145055.1. [O95998-3]
    NP_001138529.1. NM_001145057.1. [O95998-2]
    NP_005690.2. NM_005699.3.
    NP_766630.2. NM_173042.2. [O95998-2]
    NP_766632.2. NM_173044.2. [O95998-4]
    XP_005273762.1. XM_005273705.1. [O95998-2]
    UniGeneiHs.591967.

    Genome annotation databases

    EnsembliENST00000260049; ENSP00000260049; ENSG00000137496. [O95998-2]
    ENST00000337131; ENSP00000338723; ENSG00000137496. [O95998-2]
    ENST00000343898; ENSP00000343309; ENSG00000137496. [O95998-4]
    ENST00000393703; ENSP00000377306; ENSG00000137496. [O95998-2]
    ENST00000393705; ENSP00000377308; ENSG00000137496. [O95998-2]
    ENST00000393707; ENSP00000377310; ENSG00000137496. [O95998-3]
    ENST00000404792; ENSP00000384212; ENSG00000137496. [O95998-2]
    ENST00000534583; ENSP00000434376; ENSG00000137496. [O95998-2]
    GeneIDi10068.
    KEGGihsa:10068.
    UCSCiuc001ore.1. human. [O95998-2]
    uc009ysv.1. human. [O95998-3]
    uc021qmv.1. human. [O95998-4]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF110798 Genomic DNA. Translation: AAD17187.1 . Different initiation.
    AF110798 Genomic DNA. Translation: AAD17188.1 . Different initiation.
    AF110798 Genomic DNA. Translation: AAD17189.1 . Sequence problems.
    AF110799 mRNA. Translation: AAD17190.1 . Different initiation.
    AF110800 mRNA. Translation: AAD17191.1 . Different initiation.
    AF110801 mRNA. Translation: AAD17192.1 . Sequence problems.
    AB019504 mRNA. Translation: BAA76374.1 .
    AF122906 mRNA. Translation: AAD41051.1 .
    AF215907 mRNA. Translation: AAF31697.1 . Different initiation.
    AK098255 mRNA. Translation: BAG53602.1 .
    AP002490 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74813.1 .
    CH471076 Genomic DNA. Translation: EAW74816.1 .
    BC044215 mRNA. Translation: AAH44215.1 .
    CCDSi CCDS44666.1. [O95998-3 ]
    CCDS8206.2. [O95998-2 ]
    RefSeqi NP_001034748.1. NM_001039659.1. [O95998-2 ]
    NP_001034749.1. NM_001039660.1. [O95998-2 ]
    NP_001138527.1. NM_001145055.1. [O95998-3 ]
    NP_001138529.1. NM_001145057.1. [O95998-2 ]
    NP_005690.2. NM_005699.3.
    NP_766630.2. NM_173042.2. [O95998-2 ]
    NP_766632.2. NM_173044.2. [O95998-4 ]
    XP_005273762.1. XM_005273705.1. [O95998-2 ]
    UniGenei Hs.591967.

    3D structure databases

    ProteinModelPortali O95998.
    SMRi O95998. Positions 74-169.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115379. 1 interaction.
    IntActi O95998. 3 interactions.
    STRINGi 9606.ENSP00000260049.

    Proteomic databases

    PaxDbi O95998.
    PRIDEi O95998.

    Protocols and materials databases

    DNASUi 10068.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000260049 ; ENSP00000260049 ; ENSG00000137496 . [O95998-2 ]
    ENST00000337131 ; ENSP00000338723 ; ENSG00000137496 . [O95998-2 ]
    ENST00000343898 ; ENSP00000343309 ; ENSG00000137496 . [O95998-4 ]
    ENST00000393703 ; ENSP00000377306 ; ENSG00000137496 . [O95998-2 ]
    ENST00000393705 ; ENSP00000377308 ; ENSG00000137496 . [O95998-2 ]
    ENST00000393707 ; ENSP00000377310 ; ENSG00000137496 . [O95998-3 ]
    ENST00000404792 ; ENSP00000384212 ; ENSG00000137496 . [O95998-2 ]
    ENST00000534583 ; ENSP00000434376 ; ENSG00000137496 . [O95998-2 ]
    GeneIDi 10068.
    KEGGi hsa:10068.
    UCSCi uc001ore.1. human. [O95998-2 ]
    uc009ysv.1. human. [O95998-3 ]
    uc021qmv.1. human. [O95998-4 ]

    Organism-specific databases

    CTDi 10068.
    GeneCardsi GC11P071709.
    H-InvDB HIX0009903.
    HGNCi HGNC:5987. IL18BP.
    HPAi CAB025980.
    MIMi 604113. gene.
    neXtProti NX_O95998.
    PharmGKBi PA29803.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG45302.
    HOVERGENi HBG052064.
    OMAi HFSILYW.
    OrthoDBi EOG7MD4RH.
    PhylomeDBi O95998.
    TreeFami TF337962.

    Miscellaneous databases

    GeneWikii IL18BP.
    GenomeRNAii 10068.
    NextBioi 38051.
    PROi O95998.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95998.
    Bgeei O95998.
    CleanExi HS_IL18BP.
    Genevestigatori O95998.

    Family and domain databases

    InterProi IPR007110. Ig-like_dom.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Interleukin-18 binding protein: a novel modulator of the Th1 cytokine response."
      Novick D., Kim S.-H., Fantuzzi G., Reznikov L.L., Dinarello C.A., Rubinstein M.
      Immunity 10:127-136(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS A AND B), PROTEIN SEQUENCE OF 31-70, FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), PROTEIN SEQUENCE OF 31-35; 39-45; 48-54; 57-60; 63-74; 91-95; 107-144 AND 151-169, TISSUE SPECIFICITY.
    3. "Identification of human and mouse homologs of the MC51L-53L-54L family of secreted glycoproteins encoded by the Molluscum contagiosum poxvirus."
      Xiang Y., Moss B.
      Virology 257:297-302(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
    4. "Structural requirements of six naturally occurring isoforms of the IL-18 binding protein to inhibit IL-18."
      Kim S.-H., Eisenstein M., Reznikov L., Fantuzzi G., Novick D., Rubinstein M., Dinarello C.A.
      Proc. Natl. Acad. Sci. U.S.A. 97:1190-1195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), FUNCTION, ALTERNATIVE SPLICING (ISOFORMS A AND B).
      Tissue: T-cell.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
      Tissue: Uterus.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
      Tissue: Leukocyte.
    9. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 31-45.
    10. "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD."
      Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.
      Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT SER-53; ASN-103 AND ASN-147, STRUCTURE OF CARBOHYDRATES, IDENTIFICATION BY MASS SPECTROMETRY.

    Entry informationi

    Entry nameiI18BP_HUMAN
    AccessioniPrimary (citable) accession number: O95998
    Secondary accession number(s): B3KUZ0
    , B7WPK4, O95993, O96027, Q9NZA9, Q9UBR7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: July 7, 2009
    Last modified: October 1, 2014
    This is version 123 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3