Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95990

- F107A_HUMAN

UniProt

O95990 - F107A_HUMAN

Protein

Protein FAM107A

Gene

FAM107A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    When transfected into cell lines in which it is not expressed, suppresses cell growth. May play a role in tumor development.1 Publication

    GO - Biological processi

    1. regulation of cell growth Source: UniProtKB

    Keywords - Biological processi

    Growth regulation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein FAM107A
    Alternative name(s):
    Down-regulated in renal cell carcinoma 1
    Protein TU3A
    Gene namesi
    Name:FAM107A
    Synonyms:DRR1, TU3A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:30827. FAM107A.

    Subcellular locationi

    Nucleus 2 Publications

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485464.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 144144Protein FAM107APRO_0000080014Add
    BLAST

    Proteomic databases

    PaxDbiO95990.
    PRIDEiO95990.

    PTM databases

    PhosphoSiteiO95990.

    Expressioni

    Tissue specificityi

    Widely expressed in normal tissues. Expression is reduced or absent in a number of cancer cell lines.1 Publication

    Gene expression databases

    ArrayExpressiO95990.
    BgeeiO95990.
    CleanExiHS_FAM107A.
    GenevestigatoriO95990.

    Organism-specific databases

    HPAiHPA055888.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DCDP816051EBI-743396,EBI-395625
    PPP2R2AP631511EBI-743396,EBI-1048931

    Protein-protein interaction databases

    BioGridi116341. 17 interactions.
    IntActiO95990. 16 interactions.
    MINTiMINT-1392905.
    STRINGi9606.ENSP00000354270.

    Structurei

    3D structure databases

    ProteinModelPortaliO95990.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili66 – 11247Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the FAM107 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG79877.
    HOGENOMiHOG000048230.
    HOVERGENiHBG002824.
    InParanoidiO95990.
    OMAiATWIANG.
    OrthoDBiEOG7P02MP.
    PhylomeDBiO95990.
    TreeFamiTF325943.

    Family and domain databases

    InterProiIPR009533. DUF1151.
    [Graphical view]
    PANTHERiPTHR16768. PTHR16768. 1 hit.
    PfamiPF06625. DUF1151. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95990-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYSEIQRERA DIGGLMARPE YREWNPELIK PKKLLNPVKA SRSHQELHRE    50
    LLMNHRRGLG VDSKPELQRV LEHRRRNQLI KKKKEELEAK RLQCPFEQEL 100
    LRRQQRLNQL EKPPEKEEDH APEFIKVREN LRRIATLTSE EREL 144
    Length:144
    Mass (Da):17,455
    Last modified:May 1, 1999 - v1
    Checksum:i90C192C723D68A36
    GO
    Isoform 2 (identifier: O95990-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         110-144: LEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL → VGDGHPAGTTHPPGLSSREELCCGHS

    Note: May be due to an intron retention. No experimental confirmation available.

    Show »
    Length:135
    Mass (Da):15,853
    Checksum:i07DB4059E0A02258
    GO
    Isoform 3 (identifier: O95990-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAQRLGEWARGPSDATGLYRAVLLRSAAM

    Show »
    Length:172
    Mass (Da):20,455
    Checksum:iD8874896A4CBE583
    GO
    Isoform 4 (identifier: O95990-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGAAQGKKKTYSPQARFHSENEKQRRNGSAAM

    Show »
    Length:175
    Mass (Da):20,872
    Checksum:i9B1079CEB91A4DCC
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Isoform 4 (identifier: O95990-4)
    Sequence conflicti26 – 261R → Q in BAG51416. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti15 – 151L → M in ovarian cancer and renal cell carcinoma cell lines. 1 Publication
    VAR_017238
    Natural varianti19 – 191P → L in renal cell carcinoma cell line. 1 Publication
    VAR_017239
    Natural varianti89 – 891A → S.
    Corresponds to variant rs1043942 [ dbSNP | Ensembl ].
    VAR_049016
    Natural varianti141 – 1411E → Q.
    Corresponds to variant rs11539086 [ dbSNP | Ensembl ].
    VAR_049017

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MAQRLGEWARGPSDATGLYR AVLLRSAAM in isoform 3. 1 PublicationVSP_054803
    Alternative sequencei1 – 11M → MGAAQGKKKTYSPQARFHSE NEKQRRNGSAAM in isoform 4. 1 PublicationVSP_054804
    Alternative sequencei110 – 14435LEKPP…EEREL → VGDGHPAGTTHPPGLSSREE LCCGHS in isoform 2. 1 PublicationVSP_009232Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF089854 mRNA. Translation: AAD16094.1.
    AF089853 mRNA. Translation: AAD16093.1.
    AB023810 Genomic DNA. Translation: BAA83072.1.
    AB023811 mRNA. Translation: BAA82845.1.
    AL050264 mRNA. Translation: CAB43366.1.
    AK054720 mRNA. Translation: BAG51416.1.
    AK055443 mRNA. Translation: BAB70924.1.
    AK316450 mRNA. Translation: BAH14821.1.
    AC116036 Genomic DNA. No translation available.
    AC119424 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW65380.1.
    BC010561 mRNA. Translation: AAH10561.1.
    CCDSiCCDS2892.1. [O95990-1]
    CCDS63672.1. [O95990-3]
    CCDS63673.1. [O95990-4]
    PIRiT08666.
    RefSeqiNP_001070246.1. NM_001076778.2. [O95990-1]
    NP_001269642.1. NM_001282713.1. [O95990-3]
    NP_001269643.1. NM_001282714.1. [O95990-4]
    NP_009108.1. NM_007177.3. [O95990-1]
    XP_005264892.1. XM_005264835.1. [O95990-1]
    UniGeneiHs.506357.
    Hs.729396.

    Genome annotation databases

    EnsembliENST00000360997; ENSP00000354270; ENSG00000168309. [O95990-1]
    ENST00000394481; ENSP00000377991; ENSG00000168309. [O95990-1]
    ENST00000447756; ENSP00000400858; ENSG00000168309. [O95990-3]
    ENST00000464064; ENSP00000419529; ENSG00000168309. [O95990-2]
    ENST00000474531; ENSP00000419124; ENSG00000168309. [O95990-4]
    GeneIDi11170.
    KEGGihsa:11170.
    UCSCiuc003dkm.3. human. [O95990-1]
    uc003dko.3. human.
    uc003dkp.1. human. [O95990-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF089854 mRNA. Translation: AAD16094.1 .
    AF089853 mRNA. Translation: AAD16093.1 .
    AB023810 Genomic DNA. Translation: BAA83072.1 .
    AB023811 mRNA. Translation: BAA82845.1 .
    AL050264 mRNA. Translation: CAB43366.1 .
    AK054720 mRNA. Translation: BAG51416.1 .
    AK055443 mRNA. Translation: BAB70924.1 .
    AK316450 mRNA. Translation: BAH14821.1 .
    AC116036 Genomic DNA. No translation available.
    AC119424 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW65380.1 .
    BC010561 mRNA. Translation: AAH10561.1 .
    CCDSi CCDS2892.1. [O95990-1 ]
    CCDS63672.1. [O95990-3 ]
    CCDS63673.1. [O95990-4 ]
    PIRi T08666.
    RefSeqi NP_001070246.1. NM_001076778.2. [O95990-1 ]
    NP_001269642.1. NM_001282713.1. [O95990-3 ]
    NP_001269643.1. NM_001282714.1. [O95990-4 ]
    NP_009108.1. NM_007177.3. [O95990-1 ]
    XP_005264892.1. XM_005264835.1. [O95990-1 ]
    UniGenei Hs.506357.
    Hs.729396.

    3D structure databases

    ProteinModelPortali O95990.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116341. 17 interactions.
    IntActi O95990. 16 interactions.
    MINTi MINT-1392905.
    STRINGi 9606.ENSP00000354270.

    PTM databases

    PhosphoSitei O95990.

    Proteomic databases

    PaxDbi O95990.
    PRIDEi O95990.

    Protocols and materials databases

    DNASUi 11170.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000360997 ; ENSP00000354270 ; ENSG00000168309 . [O95990-1 ]
    ENST00000394481 ; ENSP00000377991 ; ENSG00000168309 . [O95990-1 ]
    ENST00000447756 ; ENSP00000400858 ; ENSG00000168309 . [O95990-3 ]
    ENST00000464064 ; ENSP00000419529 ; ENSG00000168309 . [O95990-2 ]
    ENST00000474531 ; ENSP00000419124 ; ENSG00000168309 . [O95990-4 ]
    GeneIDi 11170.
    KEGGi hsa:11170.
    UCSCi uc003dkm.3. human. [O95990-1 ]
    uc003dko.3. human.
    uc003dkp.1. human. [O95990-2 ]

    Organism-specific databases

    CTDi 11170.
    GeneCardsi GC03M058526.
    HGNCi HGNC:30827. FAM107A.
    HPAi HPA055888.
    MIMi 608295. gene.
    neXtProti NX_O95990.
    PharmGKBi PA143485464.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG79877.
    HOGENOMi HOG000048230.
    HOVERGENi HBG002824.
    InParanoidi O95990.
    OMAi ATWIANG.
    OrthoDBi EOG7P02MP.
    PhylomeDBi O95990.
    TreeFami TF325943.

    Miscellaneous databases

    ChiTaRSi FAM107A. human.
    GeneWikii FAM107A.
    GenomeRNAii 11170.
    NextBioi 35469096.
    PROi O95990.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95990.
    Bgeei O95990.
    CleanExi HS_FAM107A.
    Genevestigatori O95990.

    Family and domain databases

    InterProi IPR009533. DUF1151.
    [Graphical view ]
    PANTHERi PTHR16768. PTHR16768. 1 hit.
    Pfami PF06625. DUF1151. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Loss of expression of the DRR1 gene at chromosomal segment 3p21.1 in renal cell carcinoma."
      Wang L., Darling J., Zhang J.-S., Liu W., Qian J., Bostwick D., Hartmann L., Jenkins R., Bardenhauer W., Schutte J., Opalka B., Smith D.I.
      Genes Chromosomes Cancer 27:1-10(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS MET-15 AND LEU-19.
      Tissue: Ovary.
    2. "Isolation and characterization of the novel gene, TU3A, in a commonly deleted region on 3p14.3->p14.2 in renal cell carcinoma."
      Yamato T., Orikasa K., Fukushige S., Orikasa S., Horii A.
      Cytogenet. Cell Genet. 87:291-295(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
      Tissue: Fetal brain.
    5. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    7. "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing."
      Simpson J.C., Wellenreuther R., Poustka A., Pepperkok R., Wiemann S.
      EMBO Rep. 1:287-292(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiF107A_HUMAN
    AccessioniPrimary (citable) accession number: O95990
    Secondary accession number(s): B3KNQ4
    , B7ZAY5, J3KR61, Q96NH4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 103 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3