Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM107A

Gene

FAM107A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

When transfected into cell lines in which it is not expressed, suppresses cell growth. May play a role in tumor development.1 Publication

GO - Biological processi

  • regulation of cell growth Source: UniProtKB

Keywordsi

Biological processGrowth regulation

Enzyme and pathway databases

SIGNORiO95990

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM107A
Alternative name(s):
Down-regulated in renal cell carcinoma 1
Protein TU3A
Gene namesi
Name:FAM107A
Synonyms:DRR1, TU3A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000168309.16
HGNCiHGNC:30827 FAM107A
MIMi608295 gene
neXtProtiNX_O95990

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi11170
OpenTargetsiENSG00000168309
PharmGKBiPA143485464

Polymorphism and mutation databases

BioMutaiFAM107A

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000800141 – 144Protein FAM107AAdd BLAST144

Proteomic databases

PaxDbiO95990
PeptideAtlasiO95990
PRIDEiO95990
ProteomicsDBi51166
51167 [O95990-2]

Expressioni

Tissue specificityi

Widely expressed in normal tissues. Expression is reduced or absent in a number of cancer cell lines.1 Publication

Gene expression databases

BgeeiENSG00000168309
CleanExiHS_FAM107A
ExpressionAtlasiO95990 baseline and differential
GenevisibleiO95990 HS

Organism-specific databases

HPAiHPA055888

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi116341, 52 interactors
IntActiO95990, 29 interactors
STRINGi9606.ENSP00000354270

Structurei

3D structure databases

ProteinModelPortaliO95990
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili66 – 112Sequence analysisAdd BLAST47

Sequence similaritiesi

Belongs to the FAM107 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IX5W Eukaryota
ENOG4111Z4D LUCA
GeneTreeiENSGT00390000011228
HOGENOMiHOG000048230
HOVERGENiHBG002824
InParanoidiO95990
OMAiLMNHKRG
PhylomeDBiO95990
TreeFamiTF325943

Family and domain databases

InterProiView protein in InterPro
IPR009533 DUF1151
PANTHERiPTHR16768 PTHR16768, 1 hit
PfamiView protein in Pfam
PF06625 DUF1151, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95990-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYSEIQRERA DIGGLMARPE YREWNPELIK PKKLLNPVKA SRSHQELHRE
60 70 80 90 100
LLMNHRRGLG VDSKPELQRV LEHRRRNQLI KKKKEELEAK RLQCPFEQEL
110 120 130 140
LRRQQRLNQL EKPPEKEEDH APEFIKVREN LRRIATLTSE EREL
Length:144
Mass (Da):17,455
Last modified:May 1, 1999 - v1
Checksum:i90C192C723D68A36
GO
Isoform 2 (identifier: O95990-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-144: LEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL → VGDGHPAGTTHPPGLSSREELCCGHS

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:135
Mass (Da):15,853
Checksum:i07DB4059E0A02258
GO
Isoform 3 (identifier: O95990-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAQRLGEWARGPSDATGLYRAVLLRSAAM

Show »
Length:172
Mass (Da):20,455
Checksum:iD8874896A4CBE583
GO
Isoform 4 (identifier: O95990-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGAAQGKKKTYSPQARFHSENEKQRRNGSAAM

Show »
Length:175
Mass (Da):20,872
Checksum:i9B1079CEB91A4DCC
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 4 (identifier: O95990-4)
Sequence conflicti26R → Q in BAG51416 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01723815L → M in ovarian cancer and renal cell carcinoma cell lines. 1 Publication1
Natural variantiVAR_01723919P → L in renal cell carcinoma cell line. 1 Publication1
Natural variantiVAR_04901689A → S. Corresponds to variant dbSNP:rs1043942Ensembl.1
Natural variantiVAR_049017141E → Q. Corresponds to variant dbSNP:rs11539086Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0548031M → MAQRLGEWARGPSDATGLYR AVLLRSAAM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0548041M → MGAAQGKKKTYSPQARFHSE NEKQRRNGSAAM in isoform 4. 1 Publication1
Alternative sequenceiVSP_009232110 – 144LEKPP…EEREL → VGDGHPAGTTHPPGLSSREE LCCGHS in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF089854 mRNA Translation: AAD16094.1
AF089853 mRNA Translation: AAD16093.1
AB023810 Genomic DNA Translation: BAA83072.1
AB023811 mRNA Translation: BAA82845.1
AL050264 mRNA Translation: CAB43366.1
AK054720 mRNA Translation: BAG51416.1
AK055443 mRNA Translation: BAB70924.1
AK316450 mRNA Translation: BAH14821.1
AC116036 Genomic DNA No translation available.
AC119424 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW65380.1
BC010561 mRNA Translation: AAH10561.1
CCDSiCCDS2892.1 [O95990-1]
CCDS63672.1 [O95990-3]
CCDS63673.1 [O95990-4]
PIRiT08666
RefSeqiNP_001070246.1, NM_001076778.2 [O95990-1]
NP_001269642.1, NM_001282713.1 [O95990-3]
NP_001269643.1, NM_001282714.1 [O95990-4]
NP_009108.1, NM_007177.3 [O95990-1]
UniGeneiHs.506357
Hs.729396

Genome annotation databases

EnsembliENST00000360997; ENSP00000354270; ENSG00000168309 [O95990-1]
ENST00000394481; ENSP00000377991; ENSG00000168309 [O95990-1]
ENST00000447756; ENSP00000400858; ENSG00000168309 [O95990-3]
ENST00000464064; ENSP00000419529; ENSG00000168309 [O95990-2]
ENST00000474531; ENSP00000419124; ENSG00000168309 [O95990-4]
GeneIDi11170
KEGGihsa:11170
UCSCiuc003dko.5 human [O95990-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiF107A_HUMAN
AccessioniPrimary (citable) accession number: O95990
Secondary accession number(s): B3KNQ4
, B7ZAY5, J3KR61, Q96NH4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: June 20, 2018
This is version 134 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health