Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95990

- F107A_HUMAN

UniProt

O95990 - F107A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein FAM107A

Gene

FAM107A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

When transfected into cell lines in which it is not expressed, suppresses cell growth. May play a role in tumor development.1 Publication

GO - Biological processi

  1. regulation of cell growth Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Growth regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM107A
Alternative name(s):
Down-regulated in renal cell carcinoma 1
Protein TU3A
Gene namesi
Name:FAM107A
Synonyms:DRR1, TU3A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:30827. FAM107A.

Subcellular locationi

Nucleus 2 Publications

GO - Cellular componenti

  1. neuron projection Source: Ensembl
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485464.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 144144Protein FAM107APRO_0000080014Add
BLAST

Proteomic databases

PaxDbiO95990.
PRIDEiO95990.

PTM databases

PhosphoSiteiO95990.

Expressioni

Tissue specificityi

Widely expressed in normal tissues. Expression is reduced or absent in a number of cancer cell lines.1 Publication

Gene expression databases

BgeeiO95990.
CleanExiHS_FAM107A.
ExpressionAtlasiO95990. baseline and differential.
GenevestigatoriO95990.

Organism-specific databases

HPAiHPA055888.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DCDP816051EBI-743396,EBI-395625
PPP2R2AP631511EBI-743396,EBI-1048931

Protein-protein interaction databases

BioGridi116341. 17 interactions.
IntActiO95990. 16 interactions.
MINTiMINT-1392905.
STRINGi9606.ENSP00000354270.

Structurei

3D structure databases

ProteinModelPortaliO95990.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili66 – 11247Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the FAM107 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG79877.
GeneTreeiENSGT00390000011228.
HOGENOMiHOG000048230.
HOVERGENiHBG002824.
InParanoidiO95990.
OMAiATWIANG.
OrthoDBiEOG7P02MP.
PhylomeDBiO95990.
TreeFamiTF325943.

Family and domain databases

InterProiIPR009533. DUF1151.
[Graphical view]
PANTHERiPTHR16768. PTHR16768. 1 hit.
PfamiPF06625. DUF1151. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95990-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYSEIQRERA DIGGLMARPE YREWNPELIK PKKLLNPVKA SRSHQELHRE
60 70 80 90 100
LLMNHRRGLG VDSKPELQRV LEHRRRNQLI KKKKEELEAK RLQCPFEQEL
110 120 130 140
LRRQQRLNQL EKPPEKEEDH APEFIKVREN LRRIATLTSE EREL
Length:144
Mass (Da):17,455
Last modified:May 1, 1999 - v1
Checksum:i90C192C723D68A36
GO
Isoform 2 (identifier: O95990-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-144: LEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL → VGDGHPAGTTHPPGLSSREELCCGHS

Note: May be due to an intron retention. No experimental confirmation available.

Show »
Length:135
Mass (Da):15,853
Checksum:i07DB4059E0A02258
GO
Isoform 3 (identifier: O95990-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAQRLGEWARGPSDATGLYRAVLLRSAAM

Show »
Length:172
Mass (Da):20,455
Checksum:iD8874896A4CBE583
GO
Isoform 4 (identifier: O95990-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGAAQGKKKTYSPQARFHSENEKQRRNGSAAM

Show »
Length:175
Mass (Da):20,872
Checksum:i9B1079CEB91A4DCC
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 4 (identifier: O95990-4)
Sequence conflicti26 – 261R → Q in BAG51416. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti15 – 151L → M in ovarian cancer and renal cell carcinoma cell lines. 1 Publication
VAR_017238
Natural varianti19 – 191P → L in renal cell carcinoma cell line. 1 Publication
VAR_017239
Natural varianti89 – 891A → S.
Corresponds to variant rs1043942 [ dbSNP | Ensembl ].
VAR_049016
Natural varianti141 – 1411E → Q.
Corresponds to variant rs11539086 [ dbSNP | Ensembl ].
VAR_049017

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MAQRLGEWARGPSDATGLYR AVLLRSAAM in isoform 3. 1 PublicationVSP_054803
Alternative sequencei1 – 11M → MGAAQGKKKTYSPQARFHSE NEKQRRNGSAAM in isoform 4. 1 PublicationVSP_054804
Alternative sequencei110 – 14435LEKPP…EEREL → VGDGHPAGTTHPPGLSSREE LCCGHS in isoform 2. 1 PublicationVSP_009232Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF089854 mRNA. Translation: AAD16094.1.
AF089853 mRNA. Translation: AAD16093.1.
AB023810 Genomic DNA. Translation: BAA83072.1.
AB023811 mRNA. Translation: BAA82845.1.
AL050264 mRNA. Translation: CAB43366.1.
AK054720 mRNA. Translation: BAG51416.1.
AK055443 mRNA. Translation: BAB70924.1.
AK316450 mRNA. Translation: BAH14821.1.
AC116036 Genomic DNA. No translation available.
AC119424 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW65380.1.
BC010561 mRNA. Translation: AAH10561.1.
CCDSiCCDS2892.1. [O95990-1]
CCDS63672.1. [O95990-3]
CCDS63673.1. [O95990-4]
PIRiT08666.
RefSeqiNP_001070246.1. NM_001076778.2. [O95990-1]
NP_001269642.1. NM_001282713.1. [O95990-3]
NP_001269643.1. NM_001282714.1. [O95990-4]
NP_009108.1. NM_007177.3. [O95990-1]
XP_005264892.1. XM_005264835.1. [O95990-1]
UniGeneiHs.506357.
Hs.729396.

Genome annotation databases

EnsembliENST00000360997; ENSP00000354270; ENSG00000168309. [O95990-1]
ENST00000394481; ENSP00000377991; ENSG00000168309. [O95990-1]
ENST00000447756; ENSP00000400858; ENSG00000168309. [O95990-3]
ENST00000464064; ENSP00000419529; ENSG00000168309. [O95990-2]
ENST00000474531; ENSP00000419124; ENSG00000168309. [O95990-4]
GeneIDi11170.
KEGGihsa:11170.
UCSCiuc003dkm.3. human. [O95990-1]
uc003dko.3. human.
uc003dkp.1. human. [O95990-2]
uc010hnm.3. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF089854 mRNA. Translation: AAD16094.1 .
AF089853 mRNA. Translation: AAD16093.1 .
AB023810 Genomic DNA. Translation: BAA83072.1 .
AB023811 mRNA. Translation: BAA82845.1 .
AL050264 mRNA. Translation: CAB43366.1 .
AK054720 mRNA. Translation: BAG51416.1 .
AK055443 mRNA. Translation: BAB70924.1 .
AK316450 mRNA. Translation: BAH14821.1 .
AC116036 Genomic DNA. No translation available.
AC119424 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW65380.1 .
BC010561 mRNA. Translation: AAH10561.1 .
CCDSi CCDS2892.1. [O95990-1 ]
CCDS63672.1. [O95990-3 ]
CCDS63673.1. [O95990-4 ]
PIRi T08666.
RefSeqi NP_001070246.1. NM_001076778.2. [O95990-1 ]
NP_001269642.1. NM_001282713.1. [O95990-3 ]
NP_001269643.1. NM_001282714.1. [O95990-4 ]
NP_009108.1. NM_007177.3. [O95990-1 ]
XP_005264892.1. XM_005264835.1. [O95990-1 ]
UniGenei Hs.506357.
Hs.729396.

3D structure databases

ProteinModelPortali O95990.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116341. 17 interactions.
IntActi O95990. 16 interactions.
MINTi MINT-1392905.
STRINGi 9606.ENSP00000354270.

PTM databases

PhosphoSitei O95990.

Proteomic databases

PaxDbi O95990.
PRIDEi O95990.

Protocols and materials databases

DNASUi 11170.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000360997 ; ENSP00000354270 ; ENSG00000168309 . [O95990-1 ]
ENST00000394481 ; ENSP00000377991 ; ENSG00000168309 . [O95990-1 ]
ENST00000447756 ; ENSP00000400858 ; ENSG00000168309 . [O95990-3 ]
ENST00000464064 ; ENSP00000419529 ; ENSG00000168309 . [O95990-2 ]
ENST00000474531 ; ENSP00000419124 ; ENSG00000168309 . [O95990-4 ]
GeneIDi 11170.
KEGGi hsa:11170.
UCSCi uc003dkm.3. human. [O95990-1 ]
uc003dko.3. human.
uc003dkp.1. human. [O95990-2 ]
uc010hnm.3. human.

Organism-specific databases

CTDi 11170.
GeneCardsi GC03M058549.
HGNCi HGNC:30827. FAM107A.
HPAi HPA055888.
MIMi 608295. gene.
neXtProti NX_O95990.
PharmGKBi PA143485464.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG79877.
GeneTreei ENSGT00390000011228.
HOGENOMi HOG000048230.
HOVERGENi HBG002824.
InParanoidi O95990.
OMAi ATWIANG.
OrthoDBi EOG7P02MP.
PhylomeDBi O95990.
TreeFami TF325943.

Miscellaneous databases

ChiTaRSi FAM107A. human.
GeneWikii FAM107A.
GenomeRNAii 11170.
NextBioi 35469096.
PROi O95990.
SOURCEi Search...

Gene expression databases

Bgeei O95990.
CleanExi HS_FAM107A.
ExpressionAtlasi O95990. baseline and differential.
Genevestigatori O95990.

Family and domain databases

InterProi IPR009533. DUF1151.
[Graphical view ]
PANTHERi PTHR16768. PTHR16768. 1 hit.
Pfami PF06625. DUF1151. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Loss of expression of the DRR1 gene at chromosomal segment 3p21.1 in renal cell carcinoma."
    Wang L., Darling J., Zhang J.-S., Liu W., Qian J., Bostwick D., Hartmann L., Jenkins R., Bardenhauer W., Schutte J., Opalka B., Smith D.I.
    Genes Chromosomes Cancer 27:1-10(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS MET-15 AND LEU-19.
    Tissue: Ovary.
  2. "Isolation and characterization of the novel gene, TU3A, in a commonly deleted region on 3p14.3->p14.2 in renal cell carcinoma."
    Yamato T., Orikasa K., Fukushige S., Orikasa S., Horii A.
    Cytogenet. Cell Genet. 87:291-295(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
    Tissue: Fetal brain.
  5. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  7. "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing."
    Simpson J.C., Wellenreuther R., Poustka A., Pepperkok R., Wiemann S.
    EMBO Rep. 1:287-292(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiF107A_HUMAN
AccessioniPrimary (citable) accession number: O95990
Secondary accession number(s): B3KNQ4
, B7ZAY5, J3KR61, Q96NH4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: October 29, 2014
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3