Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95990 (F107A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 101. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein FAM107A
Alternative name(s):
Down-regulated in renal cell carcinoma 1
Protein TU3A
Gene names
Name:FAM107A
Synonyms:DRR1, TU3A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length144 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

When transfected into cell lines in which it is not expressed, suppresses cell growth. May play a role in tumor development. Ref.1

Subcellular location

Nucleus Ref.1 Ref.7.

Tissue specificity

Widely expressed in normal tissues. Expression is reduced or absent in a number of cancer cell lines. Ref.1

Sequence similarities

Belongs to the FAM107 family.

Ontologies

Keywords
   Biological processGrowth regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of cell growth

Inferred from direct assay Ref.1. Source: UniProtKB

   Cellular_componentnucleus

Inferred from direct assay Ref.1. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

DCDP816051EBI-743396,EBI-395625
PPP2R2AP631511EBI-743396,EBI-1048931

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O95990-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O95990-2)

The sequence of this isoform differs from the canonical sequence as follows:
     110-144: LEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL → VGDGHPAGTTHPPGLSSREELCCGHS
Note: May be due to an intron retention. No experimental confirmation available.
Isoform 3 (identifier: O95990-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAQRLGEWARGPSDATGLYRAVLLRSAAM
Isoform 4 (identifier: O95990-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGAAQGKKKTYSPQARFHSENEKQRRNGSAAM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 144144Protein FAM107A
PRO_0000080014

Regions

Coiled coil66 – 11247 Potential

Natural variations

Alternative sequence11M → MAQRLGEWARGPSDATGLYR AVLLRSAAM in isoform 3.
VSP_054803
Alternative sequence11M → MGAAQGKKKTYSPQARFHSE NEKQRRNGSAAM in isoform 4.
VSP_054804
Alternative sequence110 – 14435LEKPP…EEREL → VGDGHPAGTTHPPGLSSREE LCCGHS in isoform 2.
VSP_009232
Natural variant151L → M in ovarian cancer and renal cell carcinoma cell lines. Ref.1
VAR_017238
Natural variant191P → L in renal cell carcinoma cell line. Ref.1
VAR_017239
Natural variant891A → S.
Corresponds to variant rs1043942 [ dbSNP | Ensembl ].
VAR_049016
Natural variant1411E → Q.
Corresponds to variant rs11539086 [ dbSNP | Ensembl ].
VAR_049017

Experimental info

Isoform 4:
Sequence conflict261R → Q in BAG51416. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 1999. Version 1.
Checksum: 90C192C723D68A36

FASTA14417,455
        10         20         30         40         50         60 
MYSEIQRERA DIGGLMARPE YREWNPELIK PKKLLNPVKA SRSHQELHRE LLMNHRRGLG 

        70         80         90        100        110        120 
VDSKPELQRV LEHRRRNQLI KKKKEELEAK RLQCPFEQEL LRRQQRLNQL EKPPEKEEDH 

       130        140 
APEFIKVREN LRRIATLTSE EREL 

« Hide

Isoform 2 [UniParc].

Checksum: 07DB4059E0A02258
Show »

FASTA13515,853
Isoform 3 [UniParc].

Checksum: D8874896A4CBE583
Show »

FASTA17220,455
Isoform 4 [UniParc].

Checksum: 9B1079CEB91A4DCC
Show »

FASTA17520,872

References

« Hide 'large scale' references
[1]"Loss of expression of the DRR1 gene at chromosomal segment 3p21.1 in renal cell carcinoma."
Wang L., Darling J., Zhang J.-S., Liu W., Qian J., Bostwick D., Hartmann L., Jenkins R., Bardenhauer W., Schutte J., Opalka B., Smith D.I.
Genes Chromosomes Cancer 27:1-10(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS MET-15 AND LEU-19.
Tissue: Ovary.
[2]"Isolation and characterization of the novel gene, TU3A, in a commonly deleted region on 3p14.3->p14.2 in renal cell carcinoma."
Yamato T., Orikasa K., Fukushige S., Orikasa S., Horii A.
Cytogenet. Cell Genet. 87:291-295(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
Tissue: Fetal brain.
[5]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[7]"Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing."
Simpson J.C., Wellenreuther R., Poustka A., Pepperkok R., Wiemann S.
EMBO Rep. 1:287-292(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF089854 mRNA. Translation: AAD16094.1.
AF089853 mRNA. Translation: AAD16093.1.
AB023810 Genomic DNA. Translation: BAA83072.1.
AB023811 mRNA. Translation: BAA82845.1.
AL050264 mRNA. Translation: CAB43366.1.
AK054720 mRNA. Translation: BAG51416.1.
AK055443 mRNA. Translation: BAB70924.1.
AK316450 mRNA. Translation: BAH14821.1.
AC116036 Genomic DNA. No translation available.
AC119424 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW65380.1.
BC010561 mRNA. Translation: AAH10561.1.
CCDSCCDS2892.1. [O95990-1]
PIRT08666.
RefSeqNP_001070246.1. NM_001076778.2. [O95990-1]
NP_001269642.1. NM_001282713.1. [O95990-3]
NP_001269643.1. NM_001282714.1. [O95990-4]
NP_009108.1. NM_007177.3. [O95990-1]
XP_005264892.1. XM_005264835.1. [O95990-1]
UniGeneHs.506357.
Hs.729396.

3D structure databases

ProteinModelPortalO95990.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116341. 17 interactions.
IntActO95990. 15 interactions.
MINTMINT-1392905.
STRING9606.ENSP00000354270.

PTM databases

PhosphoSiteO95990.

Proteomic databases

PaxDbO95990.
PRIDEO95990.

Protocols and materials databases

DNASU11170.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000360997; ENSP00000354270; ENSG00000168309.
ENST00000394481; ENSP00000377991; ENSG00000168309.
ENST00000447756; ENSP00000400858; ENSG00000168309.
ENST00000464064; ENSP00000419529; ENSG00000168309.
ENST00000474531; ENSP00000419124; ENSG00000168309.
GeneID11170.
KEGGhsa:11170.
UCSCuc003dkm.3. human. [O95990-1]
uc003dkp.1. human. [O95990-2]

Organism-specific databases

CTD11170.
GeneCardsGC03M058526.
HGNCHGNC:30827. FAM107A.
HPAHPA055888.
MIM608295. gene.
neXtProtNX_O95990.
PharmGKBPA143485464.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG79877.
HOGENOMHOG000048230.
HOVERGENHBG002824.
InParanoidO95990.
OMAATWIANG.
OrthoDBEOG7P02MP.
PhylomeDBO95990.
TreeFamTF325943.

Gene expression databases

ArrayExpressO95990.
BgeeO95990.
CleanExHS_FAM107A.
GenevestigatorO95990.

Family and domain databases

InterProIPR009533. DUF1151.
[Graphical view]
PANTHERPTHR16768. PTHR16768. 1 hit.
PfamPF06625. DUF1151. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSFAM107A. human.
GeneWikiFAM107A.
GenomeRNAi11170.
NextBio35469096.
PROO95990.
SOURCESearch...

Entry information

Entry nameF107A_HUMAN
AccessionPrimary (citable) accession number: O95990
Secondary accession number(s): B3KNQ4 expand/collapse secondary AC list , B7ZAY5, J3KR61, Q96NH4
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: July 9, 2014
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM