O95954 (FTCD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Formimidoyltransferase-cyclodeaminase Alternative name(s): Formiminotransferase-cyclodeaminase Short name=FTCD LCHC1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 541 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool. Binds and promotes bundling of vimentin filaments originating from the Golgi By similarity. |
| Catalytic activity | 5-formimidoyltetrahydrofolate + L-glutamate = tetrahydrofolate + N-formimidoyl-L-glutamate. 5-formyltetrahydrofolate + L-glutamate = tetrahydrofolate + N-formyl-L-glutamate. 5-formimidoyltetrahydrofolate = 5,10-methenyltetrahydrofolate + NH3. |
| Cofactor | Pyridoxal phosphate. |
| Pathway | |
| Subunit structure | Homooctamer, including four polyglutamate binding sites. The subunits are arranged as a tetramer of dimers, and form a planar ring-shaped structure By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton › centrosome › centriole. Golgi apparatus By similarity. Note: More abundantly located around the mother centriole. Ref.5 |
| Involvement in disease | Defects in FTCD are the cause of glutamate formiminotransferase deficiency (FIGLU-URIA) [MIM:229100]; also known as formiminoglutamicaciduria (FIGLU-uria). It is an autosomal recessive disorder. Features of a severe phenotype, include elevated levels of formiminoglutamate (FIGLU) in the urine in response to histidine administration, megaloblastic anemia, and mental retardation. Features of a mild phenotype include high urinary excretion of FIGLU in the absence of histidine administration, mild developmental delay, and no hematological abnormalities. Ref.6 |
| Sequence similarities | In the C-terminal section; belongs to the cyclodeaminase/cyclohydrolase family. In the N-terminal section; belongs to the formiminotransferase family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: O95954-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform C (identifier: O95954-2) The sequence of this isoform differs from the canonical sequence as follows: 514-541: IHHRVSSLLQEAKTQAALVLDCLETRQE → PPAGSQDPGC...GTAGPSTLEG | ||||||
| Isoform D (identifier: O95954-3) The sequence of this isoform differs from the canonical sequence as follows: 421-541: EAMRLPKNTP...VLDCLETRQE → AHGGPTGGSE...QPEGHHRRGI | ||||||
| Isoform E (identifier: O95954-4) The sequence of this isoform differs from the canonical sequence as follows: 123-158: VYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADW → GLTAGLSCSLPVRRGSQDGQSPDPAGHPGRGVRGPP 159-541: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 541 | 541 | Formimidoyltransferase-cyclodeaminase | PRO_0000087359 | |||||
Regions | |||||||||
| Region | 1 – 181 | 181 | Formiminotransferase N-subdomain By similarity | ||||||
| Region | 182 – 326 | 145 | Formiminotransferase C-subdomain By similarity | ||||||
| Region | 327 – 334 | 8 | Linker By similarity | ||||||
| Region | 335 – 541 | 207 | Cyclodeaminase/cyclohydrolase By similarity | ||||||
Sites | |||||||||
| Active site | 82 | 1 | For formimidoyltransferase activity By similarity | ||||||
| Active site | 412 | 1 | For cyclodeaminase activity By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 519 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 123 – 158 | 36 | VYLYG…QQADW → GLTAGLSCSLPVRRGSQDGQ SPDPAGHPGRGVRGPP in isoform E. | VSP_004257 | |||||
| Alternative sequence | 159 – 541 | 383 | Missing in isoform E. | VSP_004258 | |||||
| Alternative sequence | 421 – 541 | 121 | EAMRL…ETRQE → AHGGPTGGSEAGSLCAADAG GDGGLAVAGAAGTGPVWEPG LPVRPPGGGQSPGDGRVWRI FQRAHQPEGHHRRGI in isoform D. | VSP_004259 | |||||
| Alternative sequence | 514 – 541 | 28 | IHHRV…ETRQE → PPAGSQDPGCTGAGLLGDPA GVTVREASPGSVAPPSPIPR GQSCDLETPGTAGPSTLEG in isoform C. | VSP_004260 | |||||
| Natural variant | 135 | 1 | R → C in FIGLU-URIA; mild phenotype; 61% wild-type activity. Ref.6 Corresponds to variant rs28941768 [ dbSNP | Ensembl ]. | VAR_015887 | |||||
| Natural variant | 299 | 1 | R → P in FIGLU-URIA; mild phenotype; 57% wild-type activity. Ref.6 | VAR_015888 | |||||
| Natural variant | 438 | 1 | A → E. Ref.6 | VAR_015889 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of human FTCD on 21q22.3, a candidate gene for glutamate formiminotransferase deficiency." Solans A., Estivill X., de la Luna S. Cytogenet. Cell Genet. 88:43-49(2000) [PubMed: 10773664] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; C; D AND E). Tissue: Kidney. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Liver. |
| [3] | "Formiminotransferase cyclodeaminase is an organ-specific autoantigen recognized by sera of patients with autoimmune hepatitis." Lapierre P., Hajoui O., Homberg J.-C., Alvarez F. Gastroenterology 116:643-649(1999) [PubMed: 10029623] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 396-541. |
| [4] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [5] | "Localization of Golgi 58K protein (formiminotransferase cyclodeaminase) to the centrosome." Hagiwara H., Tajika Y., Matsuzaki T., Suzuki T., Aoki T., Takata K. Histochem. Cell Biol. 126:251-259(2006) [PubMed: 16534631] [Abstract] Cited for: SUBCELLULAR LOCATION, CENTRIOLE ASSOCIATION. |
| [6] | "The molecular basis of glutamate formiminotransferase deficiency." Hilton J.F., Christensen K.E., Watkins D., Raby B.A., Renaud Y., De La Luna S., Estivill X., MacKenzie R.E., Hudson T.J., Rosenblatt D.S. Hum. Mutat. 22:67-73(2003) [PubMed: 12815595] [Abstract] Cited for: VARIANTS FIGLU-URIA CYS-135 AND PRO-299, VARIANT GLU-438. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF169017 mRNA. Translation: AAF15558.1. AF289021 mRNA. Translation: AAG01852.1. AF289022 mRNA. Translation: AAG01853.1. AF289023 mRNA. Translation: AAG01854.1. AF289024 mRNA. Translation: AAG01855.1. BC052248 mRNA. Translation: AAH52248.2. BC136383 mRNA. Translation: AAI36384.1. BC136395 mRNA. Translation: AAI36396.1. U91541 mRNA. Translation: AAD15627.1. |
| IPI | IPI00001441. IPI00218976. IPI00218977. IPI00218978. |
| RefSeq | NP_006648.1. NM_006657.2. NP_996848.1. NM_206965.1. |
| UniGene | Hs.415846. |
3D structure databases | |
| ProteinModelPortal | O95954. |
| SMR | O95954. Positions 2-541. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O95954. |
Proteomic databases | |
| PRIDE | O95954. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000291670; ENSP00000291670; ENSG00000160282. ENST00000397746; ENSP00000380854; ENSG00000160282. |
| GeneID | 10841. |
| KEGG | hsa:10841. |
| NMPDR | fig|9606.3.peg.21130. |
| UCSC | uc002zif.1. human. uc002zig.1. human. uc010gqf.1. human. |
Organism-specific databases | |
| CTD | 10841. |
| GeneCards | GC21M047556. |
| H-InvDB | HIX0040867. |
| HGNC | HGNC:3974. FTCD. |
| HPA | CAB016409. HPA020073. |
| MIM | 229100. phenotype. 606806. gene. |
| neXtProt | NX_O95954. |
| Orphanet | 51208. Formiminoglutamic aciduria. |
| PharmGKB | PA28391. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG07650. |
| HOVERGEN | HBG000168. |
| OMA | NFSEGKN. |
| OrthoDB | EOG4FTW0C. |
| PhylomeDB | O95954. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| ArrayExpress | O95954. |
| Bgee | O95954. |
| CleanEx | HS_FTCD. |
| Genevestigator | O95954. |
| GermOnline | ENSG00000160282. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007044. Cyclodeamin/CycHdrlase. IPR013802. Formiminotransferase_C. IPR004227. Formiminotransferase_cat. IPR012886. Formiminotransferase_N. IPR022384. FormiminoTrfase_N/C_subdom. [Graphical view] |
| Gene3D | G3DSA:3.30.70.670. Formiminotransferase_C. 1 hit. G3DSA:3.30.990.10. Formiminotransferase_N. 1 hit. |
| KO | K13990. |
| Pfam | PF02971. FTCD. 1 hit. PF04961. FTCD_C. 1 hit. PF07837. FTCD_N. 1 hit. [Graphical view] |
| SUPFAM | SSF101262. Cyclodeamin/cyclohydro. 1 hit. SSF55116. Formiminotr. 2 hits. |
| TIGRFAMs | TIGR02024. FtcD. 1 hit. |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00142. L-Glutamic Acid. DB00114. Pyridoxal Phosphate. DB00116. Tetrahydrofolic acid. |
| NextBio | 41160. |
| SOURCE | Search... |
Entry information
| Entry name | FTCD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95954 Secondary accession number(s): B9EGD0 Q9UHJ2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with