Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein ecdysoneless homolog

Gene

ECD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulator of p53/TP53 stability and function. Inhibits MDM2-mediated degradation of p53/TP53 possibly by cooperating in part with TXNIP (PubMed:16849563, PubMed:23880345). May be involved transcriptional regulation. In vitro has intrinsic transactivation activity enhanced by EP300. May be a transcriptional activator required for the expression of glycolytic genes (PubMed:19919181, PubMed:9928932). Involved in regulation of cell cycle progression. Proposed to disrupt Rb-E2F binding leading to transcriptional activation of E2F proteins (PubMed:19640839). The cell cycle -regulating function may depend on its RUVBL1-mediated association with the R2TP complex (PubMed:26711270). May play a role in regulation of pre-mRNA splicing (PubMed:24722212).2 Publications5 Publications

GO - Molecular functioni

  • histone acetyltransferase binding Source: UniProtKB
  • transcription coactivator activity Source: ProtInc

GO - Biological processi

  • cell proliferation Source: Ensembl
  • mRNA processing Source: UniProtKB-KW
  • positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • regulation of G1/S transition of mitotic cell cycle Source: Ensembl
  • regulation of glycolytic process Source: ProtInc
  • RNA splicing Source: UniProtKB-KW
  • transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

mRNA processing, mRNA splicing, Transcription, Transcription regulation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122882-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein ecdysoneless homologBy similarity
Alternative name(s):
Human suppressor of GCR two1 Publication
Short name:
hSGT11 Publication
Gene namesi
Name:ECD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:17029. ECD.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi481I → A: Decreases transactivation activity. 1 Publication1
Mutagenesisi484D → F: Decreases transactivation activity. 1 Publication1
Mutagenesisi489L → A: Decreases transactivation activity. 1 Publication1
Mutagenesisi503S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-505, A-518, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi505S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-518, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi510D → R: Increases transactivation activity. 1 Publication1
Mutagenesisi512D → R: Increases transactivation activity. 1 Publication1
Mutagenesisi518S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi520D → P: Increases transactivation activity. 1 Publication1
Mutagenesisi572S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-579 and A-584. 1 Publication1
Mutagenesisi579S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-572 and A-584. 1 Publication1
Mutagenesisi584S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-572 and A-579. 1 Publication1

Organism-specific databases

DisGeNETi11319.
OpenTargetsiENSG00000122882.
PharmGKBiPA143485450.

Polymorphism and mutation databases

BioMutaiECD.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002208441 – 644Protein ecdysoneless homologAdd BLAST644

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei503PhosphoserineCombined sources1
Modified residuei505PhosphoserineCombined sources1
Modified residuei518PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated predominantly by CK2 on two serine-containing clusters; involved in cell cycle regulation activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO95905.
MaxQBiO95905.
PaxDbiO95905.
PeptideAtlasiO95905.
PRIDEiO95905.

PTM databases

iPTMnetiO95905.
PhosphoSitePlusiO95905.

Expressioni

Tissue specificityi

Highly expressed in muscle and heart. Over-expressed in pancreatic and breast cancers.2 Publications

Gene expression databases

BgeeiENSG00000122882.
CleanExiHS_ECD.
ExpressionAtlasiO95905. baseline and differential.
GenevisibleiO95905. HS.

Organism-specific databases

HPAiHPA006465.

Interactioni

Subunit structurei

Interacts with TP53, MDM2, TXNIP (PubMed:16849563, PubMed:23880345). Interacts (phosphorylated) with PIH1D1. Interacts with RUVBL1 mediating the PIH1D1-independent association with the R2TP complex (PubMed:24656813, PubMed:26711270). Interacts with RB1, RBL1 and RBL2; ECD competes with E2F1 for binding to hypophospshorylated RB1 (PubMed:19640839). Interacts with EP300 (PubMed:19919181).6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PIH1D1Q9NWS011EBI-2557598,EBI-357318
PRPF8Q6P2Q92EBI-2557598,EBI-538479
RUVBL1Q9Y2657EBI-2557598,EBI-353675
TXNIPQ9H3M75EBI-2557598,EBI-1369170

GO - Molecular functioni

  • histone acetyltransferase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi116450. 48 interactors.
IntActiO95905. 30 interactors.
MINTiMINT-265905.
STRINGi9606.ENSP00000401566.

Structurei

3D structure databases

ProteinModelPortaliO95905.
SMRiO95905.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni439 – 644Transcription activation1 PublicationAdd BLAST206
Regioni481 – 497Involved in nuclear export1 PublicationAdd BLAST17
Regioni502 – 532Acidic region required for transactivation activity1 PublicationAdd BLAST31

Sequence similaritiesi

Belongs to the ECD family.Curated

Phylogenomic databases

eggNOGiKOG2406. Eukaryota.
ENOG410XR07. LUCA.
GeneTreeiENSGT00390000015361.
HOGENOMiHOG000029899.
HOVERGENiHBG023145.
InParanoidiO95905.
OMAiIVYIVKQ.
OrthoDBiEOG091G081H.
PhylomeDBiO95905.
TreeFamiTF324229.

Family and domain databases

InterProiIPR010770. Ecd.
[Graphical view]
PANTHERiPTHR13060. PTHR13060. 1 hit.
PfamiPF07093. SGT1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95905-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEETMKLATM EDTVEYCLFL IPDESRDSDK HKEILQKYIE RIITRFAPML
60 70 80 90 100
VPYIWQNQPF NLKYKPGKGG VPAHMFGVTK FGDNIEDEWF IVYVIKQITK
110 120 130 140 150
EFPELVARIE DNDGEFLLIE AADFLPKWLD PENSTNRVFF CHGELCIIPA
160 170 180 190 200
PRKSGAESWL PTTPPTIPQA LNIITAHSEK ILASESIRAA VNRRIRGYPE
210 220 230 240 250
KIQASLHRAH CFLPAGIVAV LKQRPRLVAA AVQAFYLRDP IDLRACRVFK
260 270 280 290 300
TFLPETRIMT SVTFTKCLYA QLVQQRFVPD RRSGYRLPPP SDPQYRAHEL
310 320 330 340 350
GMKLAHGFEI LCSKCSPHFS DCKKSLVTAS PLWASFLESL KKNDYFKGLI
360 370 380 390 400
EGSAQYRERL EMAENYFQLS VDWPESSLAM SPGEEILTLL QTIPFDIEDL
410 420 430 440 450
KKEAANLPPE DDDQWLDLSP DQLDQLLQEA VGKKESESVS KEEKEQNYDL
460 470 480 490 500
TEVSESMKAF ISKVSTHKGA ELPREPSEAP ITFDADSFLN YFDKILGPRP
510 520 530 540 550
NESDSDDLDD EDFECLDSDD DLDFETHEPG EEASLKGTLD NLKSYMAQMD
560 570 580 590 600
QELAHTCISK SFTTRNQVEP VSQTTDNNSD EEDSGTGESV MAPVDVDLNL
610 620 630 640
VSNILESYSS QAGLAGPASN LLQSMGVQLP DNTDHRPTSK PTKN
Length:644
Mass (Da):72,758
Last modified:May 1, 1999 - v1
Checksum:iF9B0D2BBFDB38CAF
GO
Isoform 2 (identifier: O95905-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-304: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):67,712
Checksum:i4F0AC1D928853E85
GO
Isoform 3 (identifier: O95905-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     375-375: E → ERLEVQWRDPGLLQAPPPGFTPFICLSLLSTWDN

Note: No experimental confirmation available.
Show »
Length:677
Mass (Da):76,508
Checksum:i4628E86C662AE075
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28S → P in AK225519 (PubMed:14702039).Curated1
Sequence conflicti319F → S in AK225519 (PubMed:14702039).Curated1
Sequence conflicti333W → R in AK225519 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05197045R → Q.Corresponds to variant rs3812619dbSNPEnsembl.1
Natural variantiVAR_012191281R → G Could be a rare polymorphism. 1 PublicationCorresponds to variant rs151023501dbSNPEnsembl.1
Natural variantiVAR_051971452E → Q.Corresponds to variant rs3736518dbSNPEnsembl.1
Natural variantiVAR_051972501N → S.Corresponds to variant rs36152134dbSNPEnsembl.1
Natural variantiVAR_051973634D → G.Corresponds to variant rs2271904dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045670262 – 304Missing in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_045671375E → ERLEVQWRDPGLLQAPPPGF TPFICLSLLSTWDN in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88208 mRNA. Translation: BAA75199.1.
AK315711 mRNA. No translation available.
AK225519 mRNA. No translation available.
AC016394 Genomic DNA. No translation available.
BC000721 mRNA. Translation: AAH00721.1.
CCDSiCCDS44433.1. [O95905-2]
CCDS44434.1. [O95905-3]
CCDS7321.1. [O95905-1]
RefSeqiNP_001129224.1. NM_001135752.1. [O95905-3]
NP_001129225.1. NM_001135753.1. [O95905-2]
NP_009196.1. NM_007265.2. [O95905-1]
UniGeneiHs.631822.

Genome annotation databases

EnsembliENST00000372979; ENSP00000362070; ENSG00000122882. [O95905-1]
ENST00000430082; ENSP00000401566; ENSG00000122882. [O95905-3]
ENST00000454759; ENSP00000395786; ENSG00000122882. [O95905-2]
GeneIDi11319.
KEGGihsa:11319.
UCSCiuc001jtn.4. human. [O95905-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88208 mRNA. Translation: BAA75199.1.
AK315711 mRNA. No translation available.
AK225519 mRNA. No translation available.
AC016394 Genomic DNA. No translation available.
BC000721 mRNA. Translation: AAH00721.1.
CCDSiCCDS44433.1. [O95905-2]
CCDS44434.1. [O95905-3]
CCDS7321.1. [O95905-1]
RefSeqiNP_001129224.1. NM_001135752.1. [O95905-3]
NP_001129225.1. NM_001135753.1. [O95905-2]
NP_009196.1. NM_007265.2. [O95905-1]
UniGeneiHs.631822.

3D structure databases

ProteinModelPortaliO95905.
SMRiO95905.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116450. 48 interactors.
IntActiO95905. 30 interactors.
MINTiMINT-265905.
STRINGi9606.ENSP00000401566.

PTM databases

iPTMnetiO95905.
PhosphoSitePlusiO95905.

Polymorphism and mutation databases

BioMutaiECD.

Proteomic databases

EPDiO95905.
MaxQBiO95905.
PaxDbiO95905.
PeptideAtlasiO95905.
PRIDEiO95905.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372979; ENSP00000362070; ENSG00000122882. [O95905-1]
ENST00000430082; ENSP00000401566; ENSG00000122882. [O95905-3]
ENST00000454759; ENSP00000395786; ENSG00000122882. [O95905-2]
GeneIDi11319.
KEGGihsa:11319.
UCSCiuc001jtn.4. human. [O95905-1]

Organism-specific databases

CTDi11319.
DisGeNETi11319.
GeneCardsiECD.
HGNCiHGNC:17029. ECD.
HPAiHPA006465.
MIMi616464. gene.
neXtProtiNX_O95905.
OpenTargetsiENSG00000122882.
PharmGKBiPA143485450.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2406. Eukaryota.
ENOG410XR07. LUCA.
GeneTreeiENSGT00390000015361.
HOGENOMiHOG000029899.
HOVERGENiHBG023145.
InParanoidiO95905.
OMAiIVYIVKQ.
OrthoDBiEOG091G081H.
PhylomeDBiO95905.
TreeFamiTF324229.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122882-MONOMER.

Miscellaneous databases

ChiTaRSiECD. human.
GeneWikiiECD_(gene).
GenomeRNAii11319.
PROiO95905.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122882.
CleanExiHS_ECD.
ExpressionAtlasiO95905. baseline and differential.
GenevisibleiO95905. HS.

Family and domain databases

InterProiIPR010770. Ecd.
[Graphical view]
PANTHERiPTHR13060. PTHR13060. 1 hit.
PfamiPF07093. SGT1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiECD_HUMAN
AccessioniPrimary (citable) accession number: O95905
Secondary accession number(s): C9JX46, E9PAW8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 1999
Last modified: November 30, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.