Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95866 (G6B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein G6b
Gene names
Name:G6B
Synonyms:C6orf25
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length241 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide. Appears to operate in a calcium-independent manner. Isoform B is a putative inhibitory receptor. Isoform A may be its activating counterpart. Ref.9

Subunit structure

Interacts with PTPN6 and PTPN11. Binds to heparin. Ref.1

Subcellular location

Isoform E: Endoplasmic reticulum. Golgi apparatus Ref.1.

Isoform D: Endoplasmic reticulum. Golgi apparatus Ref.1.

Isoform B: Cell membrane; Single-pass type I membrane protein Ref.1.

Isoform A: Cell membrane; Single-pass type I membrane protein Ref.1.

Tissue specificity

Expressed in a restricted set of hematopoietic cell lines including the erythroleukemia cell line K-562 and the T-cell leukemia cell lines MOLT-4 and Jurkat. Not detected in the monocyte-like cell line U-937, the B-cell-like cell line Raji, the fibroblast cell lines TK and HeLa, or the natural killer cell lines NKL, NK 62 and YT. Expressed in platelets. Ref.1 Ref.9

Post-translational modification

All isoforms are N-glycosylated. Ref.1

Isoform E is O-glycosylated. Ref.1

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform B Ref.1 (identifier: O95866-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform A Ref.1 (identifier: O95866-2)

The sequence of this isoform differs from the canonical sequence as follows:
     182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...APPAVHSGPC
Isoform C Ref.1 (identifier: O95866-3)

The sequence of this isoform differs from the canonical sequence as follows:
     138-180: SVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF → ACPRNRFDHSLDLLCPPHI
Isoform D Ref.1 (identifier: O95866-4)

The sequence of this isoform differs from the canonical sequence as follows:
     137-241: GSVYPQLLIP...DASTIYAVVV → ALSPPHSSTC...APPAVHSGPC
Isoform E Ref.1 (identifier: O95866-5)

The sequence of this isoform differs from the canonical sequence as follows:
     137-180: Missing.
Isoform F Ref.1 (identifier: O95866-6)

The sequence of this isoform differs from the canonical sequence as follows:
     181-241: APLVKTEPQR...DASTIYAVVV → GETNSTPFSF...SPSFSSVPPT
Isoform G Ref.1 (identifier: O95866-7)

The sequence of this isoform differs from the canonical sequence as follows:
     182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...TGKGMGMGRG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1717 Ref.7
Chain18 – 241224Protein G6b Ref.7
PRO_0000021312

Regions

Topological domain18 – 142125Extracellular Potential Ref.1
Transmembrane143 – 16321Helical; Potential
Topological domain164 – 24178Cytoplasmic Potential Ref.1

Amino acid modifications

Modified residue2111Phosphotyrosine Ref.1
Glycosylation321N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence137 – 241105GSVYP…YAVVV → ALSPPHSSTCENRAPEASKG GRAQDSRGPGPGTEPALCGS GPSSPQQAPPAVHSGPC in isoform D. Ref.1
VSP_014172
Alternative sequence137 – 18044Missing in isoform E. Ref.1
VSP_014173
Alternative sequence138 – 18043SVYPQ…PLPRF → ACPRNRFDHSLDLLCPPHI in isoform C. Ref.1
VSP_014174
Alternative sequence181 – 24161APLVK…YAVVV → GETNSTPFSFSYMPTPHPSI PESEPLLGADTLVTFSPSFS SVPPT in isoform F. Ref.1
VSP_014175
Alternative sequence182 – 24160PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTEPALCGSG PSSPQQAPPAVHSGPC in isoform A. Ref.1
VSP_014176
Alternative sequence182 – 24160PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTGKGMGMGR G in isoform G.
VSP_014177
Natural variant1751R → G. Ref.5
Corresponds to variant rs11575845 [ dbSNP | Ensembl ].
VAR_051004

Experimental info

Mutagenesis2111Y → F: Loss of tyrosine phosphorylation and loss of interaction with PTPN6 and PTPN11. Ref.1
Mutagenesis2371Y → F: Reduced level of tyrosine phosphorylation and interaction with PTPN6 and PTPN11. Ref.1
Sequence conflict137 – 1382GS → ID in CAI18409. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform B [UniParc].

Last modified May 1, 1999. Version 1.
Checksum: C1390699EAA109BD

FASTA24126,163
        10         20         30         40         50         60 
MAVFLQLLPL LLSRAQGNPG ASLDGRPGDR VNLSCGGVSH PIRWVWAPSF PACKGLSKGR 

        70         80         90        100        110        120 
RPILWASSSG TPTVPPLQPF VGRLRSLDSG IRRLELLLSA GDSGTFFCKG RHEDESRTVL 

       130        140        150        160        170        180 
HVLGDRTYCK APGPTHGSVY PQLLIPLLGA GLVLGLGALG LVWWLHRRLP PQPIRPLPRF 

       190        200        210        220        230        240 
APLVKTEPQR PVKEEEPKIP GDLDQEPSLL YADLDHLALS RPRRLSTADP ADASTIYAVV 


V 

« Hide

Isoform A [UniParc].

Checksum: 109526EF36D3B6CF
Show »

FASTA23725,003
Isoform C [UniParc].

Checksum: 826F70FE5B45B9A0
Show »

FASTA21723,573
Isoform D [UniParc].

Checksum: E490E4D05BAF1652
Show »

FASTA19320,169
Isoform E [UniParc].

Checksum: 9183A850EEA4CB82
Show »

FASTA19721,329
Isoform F [UniParc].

Checksum: 1C0BF72C6E0D7CE2
Show »

FASTA22524,225
Isoform G [UniParc].

Checksum: 6253F93B2D56D1A6
Show »

FASTA22223,578

References

« Hide 'large scale' references
[1]"G6b, a novel immunoglobulin superfamily member encoded in the human major histocompatibility complex, interacts with SHP-1 and SHP-2."
de Vet E.C.M., Aguado B., Campbell R.D.
J. Biol. Chem. 276:42070-42076(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D; E; F AND G), INTERACTION WITH PTPN6 AND PTPN11, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION, PHOSPHORYLATION AT TYR-211, MUTAGENESIS OF TYR-211 AND TYR-237.
Tissue: T-cell.
[2]"Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
Shiina S., Tamiya G., Oka A., Inoko H.
Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLY-175.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM G).
[7]"Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 18-30.
Tissue: Platelet.
[8]"The cell surface receptor G6b, a member of the immunoglobulin superfamily, binds heparin."
de Vet E.C., Newland S.A., Lyons P.A., Aguado B., Campbell R.D.
FEBS Lett. 579:2355-2358(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: HEPARIN-BINDING.
[9]"The novel inhibitory receptor G6B is expressed on the surface of platelets and attenuates platelet function in vitro."
Newland S.A., Macaulay I.C., Floto A.R., de Vet E.C., Ouwehand W.H., Watkins N.A., Lyons P.A., Campbell D.R.
Blood 109:4806-4809(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
[10]"Phosphoproteome of resting human platelets."
Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A.
J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Platelet.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ292259 mRNA. Translation: CAC83497.1.
AJ292260 mRNA. Translation: CAC83496.1.
AJ292261 mRNA. Translation: CAC83498.1.
AJ292262 mRNA. Translation: CAC83502.1.
AJ292263 mRNA. Translation: CAC83499.1.
AJ292264 mRNA. Translation: CAC83500.1.
AJ292265 mRNA. Translation: CAC83501.1.
AF129756 Genomic DNA. Translation: AAD18075.1.
BA000025 Genomic DNA. Translation: BAB63378.1.
AL670886 Genomic DNA. Translation: CAI17813.2.
AL670886 Genomic DNA. Translation: CAI17814.2.
AL670886 Genomic DNA. Translation: CAI17815.1.
AL670886 Genomic DNA. Translation: CAI17816.2.
AL670886 Genomic DNA. Translation: CAI17818.2.
AL662899 Genomic DNA. Translation: CAI18406.2.
AL662899 Genomic DNA. Translation: CAI18407.2.
AL662899 Genomic DNA. Translation: CAI18408.1.
AL662899 Genomic DNA. Translation: CAI18409.2.
AL662899 Genomic DNA. Translation: CAI18412.2.
BX248244 Genomic DNA. Translation: CAM26092.1.
BX248244 Genomic DNA. Translation: CAM26093.1.
BX248244 Genomic DNA. Translation: CAM26094.1.
BX248244 Genomic DNA. Translation: CAM26095.1.
BX248244 Genomic DNA. Translation: CAM26096.1.
AL844216 Genomic DNA. Translation: CAM45767.1.
AL844216 Genomic DNA. Translation: CAM45768.1.
AL844216 Genomic DNA. Translation: CAM45769.1.
AL844216 Genomic DNA. Translation: CAM45770.1.
AL844216 Genomic DNA. Translation: CAM45771.1.
CR354443 Genomic DNA. Translation: CAQ07017.1.
CR354443 Genomic DNA. Translation: CAQ07020.1.
CR354443 Genomic DNA. Translation: CAQ07021.1.
CR936239 Genomic DNA. Translation: CAQ08890.1.
CR936239 Genomic DNA. Translation: CAQ08892.1.
CR936239 Genomic DNA. Translation: CAQ08893.1.
CR936239 Genomic DNA. Translation: CAQ08894.1.
CR759787 Genomic DNA. Translation: CAQ10105.1.
CR759787 Genomic DNA. Translation: CAQ10107.1.
CR759787 Genomic DNA. Translation: CAQ10108.1.
CR759787 Genomic DNA. Translation: CAQ10109.1.
CH471081 Genomic DNA. Translation: EAX03493.1.
CH471081 Genomic DNA. Translation: EAX03494.1.
CH471081 Genomic DNA. Translation: EAX03497.1.
CH471081 Genomic DNA. Translation: EAX03498.1.
BC113719 mRNA. Translation: AAI13720.1.
BC113721 mRNA. Translation: AAI13722.1.
CCDSCCDS34405.1. [O95866-5]
CCDS34406.1. [O95866-2]
CCDS34407.1. [O95866-7]
CCDS4715.1. [O95866-1]
CCDS4716.1. [O95866-3]
CCDS4717.1. [O95866-4]
RefSeqNP_079536.2. NM_025260.3. [O95866-2]
NP_612116.1. NM_138272.2. [O95866-1]
NP_612117.1. NM_138273.2. [O95866-3]
NP_612118.1. NM_138274.2. [O95866-4]
NP_612119.1. NM_138275.2. [O95866-5]
NP_612121.1. NM_138277.2. [O95866-7]
UniGeneHs.247879.

3D structure databases

ProteinModelPortalO95866.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123283. 2 interactions.
IntActO95866. 3 interactions.
MINTMINT-8020429.
STRING9606.ENSP00000364964.

PTM databases

PhosphoSiteO95866.

Proteomic databases

PaxDbO95866.
PRIDEO95866.

Protocols and materials databases

DNASU80739.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000375804; ENSP00000364962; ENSG00000204420. [O95866-4]
ENST00000375805; ENSP00000364963; ENSG00000204420. [O95866-3]
ENST00000375806; ENSP00000364964; ENSG00000204420. [O95866-1]
ENST00000375809; ENSP00000364967; ENSG00000204420. [O95866-2]
ENST00000375810; ENSP00000364968; ENSG00000204420. [O95866-7]
ENST00000375814; ENSP00000364972; ENSG00000204420. [O95866-5]
ENST00000383410; ENSP00000372902; ENSG00000206396. [O95866-5]
ENST00000383411; ENSP00000372903; ENSG00000206396. [O95866-3]
ENST00000383412; ENSP00000372904; ENSG00000206396. [O95866-2]
ENST00000400067; ENSP00000382940; ENSG00000206396. [O95866-4]
ENST00000400071; ENSP00000382944; ENSG00000206396. [O95866-1]
ENST00000411608; ENSP00000392961; ENSG00000228090. [O95866-4]
ENST00000415728; ENSP00000408430; ENSG00000224393. [O95866-1]
ENST00000415984; ENSP00000394082; ENSG00000237459. [O95866-5]
ENST00000417610; ENSP00000412747; ENSG00000230060. [O95866-4]
ENST00000422012; ENSP00000398061; ENSG00000230060. [O95866-3]
ENST00000425998; ENSP00000392917; ENSG00000224393. [O95866-4]
ENST00000426729; ENSP00000390272; ENSG00000230060. [O95866-2]
ENST00000428302; ENSP00000404519; ENSG00000231003. [O95866-2]
ENST00000431888; ENSP00000390821; ENSG00000230060. [O95866-5]
ENST00000433769; ENSP00000413647; ENSG00000228090. [O95866-5]
ENST00000435007; ENSP00000401892; ENSG00000231003. [O95866-3]
ENST00000436030; ENSP00000406706; ENSG00000231003. [O95866-1]
ENST00000437153; ENSP00000412937; ENSG00000231003. [O95866-4]
ENST00000440063; ENSP00000388982; ENSG00000237459. [O95866-4]
ENST00000444404; ENSP00000415282; ENSG00000237459. [O95866-2]
ENST00000445381; ENSP00000396823; ENSG00000224393. [O95866-3]
ENST00000447587; ENSP00000416447; ENSG00000237459. [O95866-1]
ENST00000449633; ENSP00000388484; ENSG00000231003. [O95866-5]
ENST00000451549; ENSP00000395801; ENSG00000224393. [O95866-2]
ENST00000455185; ENSP00000414824; ENSG00000224393. [O95866-5]
ENST00000457450; ENSP00000395279; ENSG00000237459. [O95866-3]
ENST00000457884; ENSP00000391097; ENSG00000230060. [O95866-1]
GeneID80739.
KEGGhsa:80739.
UCSCuc003nwn.3. human. [O95866-7]
uc003nwo.3. human. [O95866-4]
uc011doc.2. human. [O95866-1]
uc011dod.2. human. [O95866-5]
uc011doe.2. human. [O95866-3]

Organism-specific databases

CTD80739.
GeneCardsGC06P031686.
GC06Pj31673.
GC06Pk31668.
GC06Pl31725.
GC06Pm31762.
GC06Pn31676.
GC06Po31676.
HGNCHGNC:13937. C6orf25.
MIM606520. gene.
neXtProtNX_O95866.
PharmGKBPA25926.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG26268.
HOVERGENHBG080566.
InParanoidO95866.
OMALGVVWWW.
PhylomeDBO95866.
TreeFamTF337394.

Gene expression databases

ArrayExpressO95866.
BgeeO95866.
GenevestigatorO95866.

Family and domain databases

InterProIPR028070. G6B.
IPR003599. Ig_sub.
[Graphical view]
PfamPF15096. G6B. 1 hit.
[Graphical view]
SMARTSM00409. IG. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiG6B_(gene).
GenomeRNAi80739.
NextBio71066.
PROO95866.
SOURCESearch...

Entry information

Entry nameG6B_HUMAN
AccessionPrimary (citable) accession number: O95866
Secondary accession number(s): A2BEZ1 expand/collapse secondary AC list , A2BEZ2, A2BEZ3, A2BEZ4, A2BEZ5, B0UXC4, B0UXC7, B0UXC8, B0V024, B0V026, Q14CK2, Q96A86, Q96A87, Q96A88, Q96A89, Q96A90, Q96A91
Entry history
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: May 1, 1999
Last modified: July 9, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM