Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95866

- G6B_HUMAN

UniProt

O95866 - G6B_HUMAN

Protein

Protein G6b

Gene

G6B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide. Appears to operate in a calcium-independent manner. Isoform B is a putative inhibitory receptor. Isoform A may be its activating counterpart.1 Publication

    GO - Molecular functioni

    1. heparin binding Source: UniProtKB-KW

    Keywords - Molecular functioni

    Receptor

    Keywords - Ligandi

    Heparin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein G6b
    Gene namesi
    Name:G6BImported
    Synonyms:C6orf25Imported
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:13937. C6orf25.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB-SubCell
    2. Golgi apparatus Source: UniProtKB-SubCell
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Endoplasmic reticulum, Golgi apparatus, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi211 – 2111Y → F: Loss of tyrosine phosphorylation and loss of interaction with PTPN6 and PTPN11. 1 Publication
    Mutagenesisi237 – 2371Y → F: Reduced level of tyrosine phosphorylation and interaction with PTPN6 and PTPN11. 1 Publication

    Organism-specific databases

    PharmGKBiPA25926.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 17171 PublicationAdd
    BLAST
    Chaini18 – 241224Protein G6bPRO_0000021312Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi32 – 321N-linked (GlcNAc...)Sequence Analysis
    Modified residuei211 – 2111Phosphotyrosine1 Publication

    Post-translational modificationi

    All isoforms are N-glycosylated.1 Publication
    Isoform E is O-glycosylated.1 Publication

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiO95866.
    PRIDEiO95866.

    PTM databases

    PhosphoSiteiO95866.

    Expressioni

    Tissue specificityi

    Expressed in a restricted set of hematopoietic cell lines including the erythroleukemia cell line K-562 and the T-cell leukemia cell lines MOLT-4 and Jurkat. Not detected in the monocyte-like cell line U-937, the B-cell-like cell line Raji, the fibroblast cell lines TK and HeLa, or the natural killer cell lines NKL, NK 62 and YT. Expressed in platelets.2 Publications

    Gene expression databases

    ArrayExpressiO95866.
    BgeeiO95866.
    GenevestigatoriO95866.

    Interactioni

    Subunit structurei

    Interacts with PTPN6 and PTPN11. Binds to heparin.1 Publication

    Protein-protein interaction databases

    BioGridi123283. 2 interactions.
    IntActiO95866. 3 interactions.
    MINTiMINT-8020429.
    STRINGi9606.ENSP00000364964.

    Structurei

    3D structure databases

    ProteinModelPortaliO95866.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini18 – 142125Extracellular1 PublicationSequence AnalysisAdd
    BLAST
    Topological domaini164 – 24178Cytoplasmic1 PublicationSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei143 – 16321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG26268.
    HOVERGENiHBG080566.
    InParanoidiO95866.
    OMAiLGVVWWW.
    PhylomeDBiO95866.
    TreeFamiTF337394.

    Family and domain databases

    InterProiIPR028070. G6B.
    IPR003599. Ig_sub.
    [Graphical view]
    PfamiPF15096. G6B. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform B1 Publication (identifier: O95866-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAVFLQLLPL LLSRAQGNPG ASLDGRPGDR VNLSCGGVSH PIRWVWAPSF    50
    PACKGLSKGR RPILWASSSG TPTVPPLQPF VGRLRSLDSG IRRLELLLSA 100
    GDSGTFFCKG RHEDESRTVL HVLGDRTYCK APGPTHGSVY PQLLIPLLGA 150
    GLVLGLGALG LVWWLHRRLP PQPIRPLPRF APLVKTEPQR PVKEEEPKIP 200
    GDLDQEPSLL YADLDHLALS RPRRLSTADP ADASTIYAVV V 241
    Length:241
    Mass (Da):26,163
    Last modified:May 1, 1999 - v1
    Checksum:iC1390699EAA109BD
    GO
    Isoform A1 Publication (identifier: O95866-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...APPAVHSGPC

    Show »
    Length:237
    Mass (Da):25,003
    Checksum:i109526EF36D3B6CF
    GO
    Isoform C1 Publication (identifier: O95866-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         138-180: SVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF → ACPRNRFDHSLDLLCPPHI

    Show »
    Length:217
    Mass (Da):23,573
    Checksum:i826F70FE5B45B9A0
    GO
    Isoform D1 Publication (identifier: O95866-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         137-241: GSVYPQLLIP...DASTIYAVVV → ALSPPHSSTC...APPAVHSGPC

    Show »
    Length:193
    Mass (Da):20,169
    Checksum:iE490E4D05BAF1652
    GO
    Isoform E1 Publication (identifier: O95866-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         137-180: Missing.

    Show »
    Length:197
    Mass (Da):21,329
    Checksum:i9183A850EEA4CB82
    GO
    Isoform F1 Publication (identifier: O95866-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         181-241: APLVKTEPQR...DASTIYAVVV → GETNSTPFSF...SPSFSSVPPT

    Show »
    Length:225
    Mass (Da):24,225
    Checksum:i1C0BF72C6E0D7CE2
    GO
    Isoform G1 Publication (identifier: O95866-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...TGKGMGMGRG

    Show »
    Length:222
    Mass (Da):23,578
    Checksum:i6253F93B2D56D1A6
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti137 – 1382GS → ID in CAI18409. (PubMed:14574404)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti175 – 1751R → G.1 Publication
    Corresponds to variant rs11575845 [ dbSNP | Ensembl ].
    VAR_051004

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei137 – 241105GSVYP…YAVVV → ALSPPHSSTCENRAPEASKG GRAQDSRGPGPGTEPALCGS GPSSPQQAPPAVHSGPC in isoform D. 1 PublicationVSP_014172Add
    BLAST
    Alternative sequencei137 – 18044Missing in isoform E. 1 PublicationVSP_014173Add
    BLAST
    Alternative sequencei138 – 18043SVYPQ…PLPRF → ACPRNRFDHSLDLLCPPHI in isoform C. 1 PublicationVSP_014174Add
    BLAST
    Alternative sequencei181 – 24161APLVK…YAVVV → GETNSTPFSFSYMPTPHPSI PESEPLLGADTLVTFSPSFS SVPPT in isoform F. 1 PublicationVSP_014175Add
    BLAST
    Alternative sequencei182 – 24160PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTEPALCGSG PSSPQQAPPAVHSGPC in isoform A. 1 PublicationVSP_014176Add
    BLAST
    Alternative sequencei182 – 24160PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTGKGMGMGR G in isoform G. 2 PublicationsVSP_014177Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ292259 mRNA. Translation: CAC83497.1.
    AJ292260 mRNA. Translation: CAC83496.1.
    AJ292261 mRNA. Translation: CAC83498.1.
    AJ292262 mRNA. Translation: CAC83502.1.
    AJ292263 mRNA. Translation: CAC83499.1.
    AJ292264 mRNA. Translation: CAC83500.1.
    AJ292265 mRNA. Translation: CAC83501.1.
    AF129756 Genomic DNA. Translation: AAD18075.1.
    BA000025 Genomic DNA. Translation: BAB63378.1.
    AL670886 Genomic DNA. Translation: CAI17813.2.
    AL670886 Genomic DNA. Translation: CAI17814.2.
    AL670886 Genomic DNA. Translation: CAI17815.1.
    AL670886 Genomic DNA. Translation: CAI17816.2.
    AL670886 Genomic DNA. Translation: CAI17818.2.
    AL662899 Genomic DNA. Translation: CAI18406.2.
    AL662899 Genomic DNA. Translation: CAI18407.2.
    AL662899 Genomic DNA. Translation: CAI18408.1.
    AL662899 Genomic DNA. Translation: CAI18409.2.
    AL662899 Genomic DNA. Translation: CAI18412.2.
    BX248244 Genomic DNA. Translation: CAM26092.1.
    BX248244 Genomic DNA. Translation: CAM26093.1.
    BX248244 Genomic DNA. Translation: CAM26094.1.
    BX248244 Genomic DNA. Translation: CAM26095.1.
    BX248244 Genomic DNA. Translation: CAM26096.1.
    AL844216 Genomic DNA. Translation: CAM45767.1.
    AL844216 Genomic DNA. Translation: CAM45768.1.
    AL844216 Genomic DNA. Translation: CAM45769.1.
    AL844216 Genomic DNA. Translation: CAM45770.1.
    AL844216 Genomic DNA. Translation: CAM45771.1.
    CR354443 Genomic DNA. Translation: CAQ07017.1.
    CR354443 Genomic DNA. Translation: CAQ07020.1.
    CR354443 Genomic DNA. Translation: CAQ07021.1.
    CR936239 Genomic DNA. Translation: CAQ08890.1.
    CR936239 Genomic DNA. Translation: CAQ08892.1.
    CR936239 Genomic DNA. Translation: CAQ08893.1.
    CR936239 Genomic DNA. Translation: CAQ08894.1.
    CR759787 Genomic DNA. Translation: CAQ10105.1.
    CR759787 Genomic DNA. Translation: CAQ10107.1.
    CR759787 Genomic DNA. Translation: CAQ10108.1.
    CR759787 Genomic DNA. Translation: CAQ10109.1.
    CH471081 Genomic DNA. Translation: EAX03493.1.
    CH471081 Genomic DNA. Translation: EAX03494.1.
    CH471081 Genomic DNA. Translation: EAX03497.1.
    CH471081 Genomic DNA. Translation: EAX03498.1.
    BC113719 mRNA. Translation: AAI13720.1.
    BC113721 mRNA. Translation: AAI13722.1.
    CCDSiCCDS34405.1. [O95866-5]
    CCDS34406.1. [O95866-2]
    CCDS34407.1. [O95866-7]
    CCDS4715.1. [O95866-1]
    CCDS4716.1. [O95866-3]
    CCDS4717.1. [O95866-4]
    RefSeqiNP_079536.2. NM_025260.3. [O95866-2]
    NP_612116.1. NM_138272.2. [O95866-1]
    NP_612117.1. NM_138273.2. [O95866-3]
    NP_612118.1. NM_138274.2. [O95866-4]
    NP_612119.1. NM_138275.2. [O95866-5]
    NP_612121.1. NM_138277.2. [O95866-7]
    UniGeneiHs.247879.

    Genome annotation databases

    EnsembliENST00000375804; ENSP00000364962; ENSG00000204420. [O95866-4]
    ENST00000375805; ENSP00000364963; ENSG00000204420. [O95866-3]
    ENST00000375806; ENSP00000364964; ENSG00000204420. [O95866-1]
    ENST00000375809; ENSP00000364967; ENSG00000204420. [O95866-2]
    ENST00000375810; ENSP00000364968; ENSG00000204420. [O95866-7]
    ENST00000375814; ENSP00000364972; ENSG00000204420. [O95866-5]
    ENST00000383410; ENSP00000372902; ENSG00000206396. [O95866-5]
    ENST00000383411; ENSP00000372903; ENSG00000206396. [O95866-3]
    ENST00000383412; ENSP00000372904; ENSG00000206396. [O95866-2]
    ENST00000400067; ENSP00000382940; ENSG00000206396. [O95866-4]
    ENST00000400071; ENSP00000382944; ENSG00000206396. [O95866-1]
    ENST00000411608; ENSP00000392961; ENSG00000228090. [O95866-4]
    ENST00000415728; ENSP00000408430; ENSG00000224393. [O95866-1]
    ENST00000415984; ENSP00000394082; ENSG00000237459. [O95866-5]
    ENST00000417610; ENSP00000412747; ENSG00000230060. [O95866-4]
    ENST00000422012; ENSP00000398061; ENSG00000230060. [O95866-3]
    ENST00000425998; ENSP00000392917; ENSG00000224393. [O95866-4]
    ENST00000426729; ENSP00000390272; ENSG00000230060. [O95866-2]
    ENST00000428302; ENSP00000404519; ENSG00000231003. [O95866-2]
    ENST00000431888; ENSP00000390821; ENSG00000230060. [O95866-5]
    ENST00000433769; ENSP00000413647; ENSG00000228090. [O95866-5]
    ENST00000435007; ENSP00000401892; ENSG00000231003. [O95866-3]
    ENST00000436030; ENSP00000406706; ENSG00000231003. [O95866-1]
    ENST00000437153; ENSP00000412937; ENSG00000231003. [O95866-4]
    ENST00000440063; ENSP00000388982; ENSG00000237459. [O95866-4]
    ENST00000444404; ENSP00000415282; ENSG00000237459. [O95866-2]
    ENST00000445381; ENSP00000396823; ENSG00000224393. [O95866-3]
    ENST00000447587; ENSP00000416447; ENSG00000237459. [O95866-1]
    ENST00000449633; ENSP00000388484; ENSG00000231003. [O95866-5]
    ENST00000451549; ENSP00000395801; ENSG00000224393. [O95866-2]
    ENST00000455185; ENSP00000414824; ENSG00000224393. [O95866-5]
    ENST00000457450; ENSP00000395279; ENSG00000237459. [O95866-3]
    ENST00000457884; ENSP00000391097; ENSG00000230060. [O95866-1]
    GeneIDi80739.
    KEGGihsa:80739.
    UCSCiuc003nwn.3. human. [O95866-7]
    uc003nwo.3. human. [O95866-4]
    uc011doc.2. human. [O95866-1]
    uc011dod.2. human. [O95866-5]
    uc011doe.2. human. [O95866-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ292259 mRNA. Translation: CAC83497.1 .
    AJ292260 mRNA. Translation: CAC83496.1 .
    AJ292261 mRNA. Translation: CAC83498.1 .
    AJ292262 mRNA. Translation: CAC83502.1 .
    AJ292263 mRNA. Translation: CAC83499.1 .
    AJ292264 mRNA. Translation: CAC83500.1 .
    AJ292265 mRNA. Translation: CAC83501.1 .
    AF129756 Genomic DNA. Translation: AAD18075.1 .
    BA000025 Genomic DNA. Translation: BAB63378.1 .
    AL670886 Genomic DNA. Translation: CAI17813.2 .
    AL670886 Genomic DNA. Translation: CAI17814.2 .
    AL670886 Genomic DNA. Translation: CAI17815.1 .
    AL670886 Genomic DNA. Translation: CAI17816.2 .
    AL670886 Genomic DNA. Translation: CAI17818.2 .
    AL662899 Genomic DNA. Translation: CAI18406.2 .
    AL662899 Genomic DNA. Translation: CAI18407.2 .
    AL662899 Genomic DNA. Translation: CAI18408.1 .
    AL662899 Genomic DNA. Translation: CAI18409.2 .
    AL662899 Genomic DNA. Translation: CAI18412.2 .
    BX248244 Genomic DNA. Translation: CAM26092.1 .
    BX248244 Genomic DNA. Translation: CAM26093.1 .
    BX248244 Genomic DNA. Translation: CAM26094.1 .
    BX248244 Genomic DNA. Translation: CAM26095.1 .
    BX248244 Genomic DNA. Translation: CAM26096.1 .
    AL844216 Genomic DNA. Translation: CAM45767.1 .
    AL844216 Genomic DNA. Translation: CAM45768.1 .
    AL844216 Genomic DNA. Translation: CAM45769.1 .
    AL844216 Genomic DNA. Translation: CAM45770.1 .
    AL844216 Genomic DNA. Translation: CAM45771.1 .
    CR354443 Genomic DNA. Translation: CAQ07017.1 .
    CR354443 Genomic DNA. Translation: CAQ07020.1 .
    CR354443 Genomic DNA. Translation: CAQ07021.1 .
    CR936239 Genomic DNA. Translation: CAQ08890.1 .
    CR936239 Genomic DNA. Translation: CAQ08892.1 .
    CR936239 Genomic DNA. Translation: CAQ08893.1 .
    CR936239 Genomic DNA. Translation: CAQ08894.1 .
    CR759787 Genomic DNA. Translation: CAQ10105.1 .
    CR759787 Genomic DNA. Translation: CAQ10107.1 .
    CR759787 Genomic DNA. Translation: CAQ10108.1 .
    CR759787 Genomic DNA. Translation: CAQ10109.1 .
    CH471081 Genomic DNA. Translation: EAX03493.1 .
    CH471081 Genomic DNA. Translation: EAX03494.1 .
    CH471081 Genomic DNA. Translation: EAX03497.1 .
    CH471081 Genomic DNA. Translation: EAX03498.1 .
    BC113719 mRNA. Translation: AAI13720.1 .
    BC113721 mRNA. Translation: AAI13722.1 .
    CCDSi CCDS34405.1. [O95866-5 ]
    CCDS34406.1. [O95866-2 ]
    CCDS34407.1. [O95866-7 ]
    CCDS4715.1. [O95866-1 ]
    CCDS4716.1. [O95866-3 ]
    CCDS4717.1. [O95866-4 ]
    RefSeqi NP_079536.2. NM_025260.3. [O95866-2 ]
    NP_612116.1. NM_138272.2. [O95866-1 ]
    NP_612117.1. NM_138273.2. [O95866-3 ]
    NP_612118.1. NM_138274.2. [O95866-4 ]
    NP_612119.1. NM_138275.2. [O95866-5 ]
    NP_612121.1. NM_138277.2. [O95866-7 ]
    UniGenei Hs.247879.

    3D structure databases

    ProteinModelPortali O95866.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123283. 2 interactions.
    IntActi O95866. 3 interactions.
    MINTi MINT-8020429.
    STRINGi 9606.ENSP00000364964.

    PTM databases

    PhosphoSitei O95866.

    Proteomic databases

    PaxDbi O95866.
    PRIDEi O95866.

    Protocols and materials databases

    DNASUi 80739.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000375804 ; ENSP00000364962 ; ENSG00000204420 . [O95866-4 ]
    ENST00000375805 ; ENSP00000364963 ; ENSG00000204420 . [O95866-3 ]
    ENST00000375806 ; ENSP00000364964 ; ENSG00000204420 . [O95866-1 ]
    ENST00000375809 ; ENSP00000364967 ; ENSG00000204420 . [O95866-2 ]
    ENST00000375810 ; ENSP00000364968 ; ENSG00000204420 . [O95866-7 ]
    ENST00000375814 ; ENSP00000364972 ; ENSG00000204420 . [O95866-5 ]
    ENST00000383410 ; ENSP00000372902 ; ENSG00000206396 . [O95866-5 ]
    ENST00000383411 ; ENSP00000372903 ; ENSG00000206396 . [O95866-3 ]
    ENST00000383412 ; ENSP00000372904 ; ENSG00000206396 . [O95866-2 ]
    ENST00000400067 ; ENSP00000382940 ; ENSG00000206396 . [O95866-4 ]
    ENST00000400071 ; ENSP00000382944 ; ENSG00000206396 . [O95866-1 ]
    ENST00000411608 ; ENSP00000392961 ; ENSG00000228090 . [O95866-4 ]
    ENST00000415728 ; ENSP00000408430 ; ENSG00000224393 . [O95866-1 ]
    ENST00000415984 ; ENSP00000394082 ; ENSG00000237459 . [O95866-5 ]
    ENST00000417610 ; ENSP00000412747 ; ENSG00000230060 . [O95866-4 ]
    ENST00000422012 ; ENSP00000398061 ; ENSG00000230060 . [O95866-3 ]
    ENST00000425998 ; ENSP00000392917 ; ENSG00000224393 . [O95866-4 ]
    ENST00000426729 ; ENSP00000390272 ; ENSG00000230060 . [O95866-2 ]
    ENST00000428302 ; ENSP00000404519 ; ENSG00000231003 . [O95866-2 ]
    ENST00000431888 ; ENSP00000390821 ; ENSG00000230060 . [O95866-5 ]
    ENST00000433769 ; ENSP00000413647 ; ENSG00000228090 . [O95866-5 ]
    ENST00000435007 ; ENSP00000401892 ; ENSG00000231003 . [O95866-3 ]
    ENST00000436030 ; ENSP00000406706 ; ENSG00000231003 . [O95866-1 ]
    ENST00000437153 ; ENSP00000412937 ; ENSG00000231003 . [O95866-4 ]
    ENST00000440063 ; ENSP00000388982 ; ENSG00000237459 . [O95866-4 ]
    ENST00000444404 ; ENSP00000415282 ; ENSG00000237459 . [O95866-2 ]
    ENST00000445381 ; ENSP00000396823 ; ENSG00000224393 . [O95866-3 ]
    ENST00000447587 ; ENSP00000416447 ; ENSG00000237459 . [O95866-1 ]
    ENST00000449633 ; ENSP00000388484 ; ENSG00000231003 . [O95866-5 ]
    ENST00000451549 ; ENSP00000395801 ; ENSG00000224393 . [O95866-2 ]
    ENST00000455185 ; ENSP00000414824 ; ENSG00000224393 . [O95866-5 ]
    ENST00000457450 ; ENSP00000395279 ; ENSG00000237459 . [O95866-3 ]
    ENST00000457884 ; ENSP00000391097 ; ENSG00000230060 . [O95866-1 ]
    GeneIDi 80739.
    KEGGi hsa:80739.
    UCSCi uc003nwn.3. human. [O95866-7 ]
    uc003nwo.3. human. [O95866-4 ]
    uc011doc.2. human. [O95866-1 ]
    uc011dod.2. human. [O95866-5 ]
    uc011doe.2. human. [O95866-3 ]

    Organism-specific databases

    CTDi 80739.
    GeneCardsi GC06P031686.
    GC06Pj31673.
    GC06Pk31668.
    GC06Pl31725.
    GC06Pm31762.
    GC06Pn31676.
    GC06Po31676.
    HGNCi HGNC:13937. C6orf25.
    MIMi 606520. gene.
    neXtProti NX_O95866.
    PharmGKBi PA25926.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG26268.
    HOVERGENi HBG080566.
    InParanoidi O95866.
    OMAi LGVVWWW.
    PhylomeDBi O95866.
    TreeFami TF337394.

    Miscellaneous databases

    GeneWikii G6B_(gene).
    GenomeRNAii 80739.
    NextBioi 71066.
    PROi O95866.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95866.
    Bgeei O95866.
    Genevestigatori O95866.

    Family and domain databases

    InterProi IPR028070. G6B.
    IPR003599. Ig_sub.
    [Graphical view ]
    Pfami PF15096. G6B. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "G6b, a novel immunoglobulin superfamily member encoded in the human major histocompatibility complex, interacts with SHP-1 and SHP-2."
      de Vet E.C.M., Aguado B., Campbell R.D.
      J. Biol. Chem. 276:42070-42076(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D; E; F AND G), INTERACTION WITH PTPN6 AND PTPN11, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION, PHOSPHORYLATION AT TYR-211, MUTAGENESIS OF TYR-211 AND TYR-237.
      Tissue: T-cell.
    2. "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
      Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
      Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
      Shiina S., Tamiya G., Oka A., Inoko H.
      Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLY-175.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM G).
    7. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
      Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
      Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 18-30.
      Tissue: Platelet1 Publication.
    8. "The cell surface receptor G6b, a member of the immunoglobulin superfamily, binds heparin."
      de Vet E.C., Newland S.A., Lyons P.A., Aguado B., Campbell R.D.
      FEBS Lett. 579:2355-2358(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: HEPARIN-BINDING.
    9. "The novel inhibitory receptor G6B is expressed on the surface of platelets and attenuates platelet function in vitro."
      Newland S.A., Macaulay I.C., Floto A.R., de Vet E.C., Ouwehand W.H., Watkins N.A., Lyons P.A., Campbell D.R.
      Blood 109:4806-4809(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Platelet.

    Entry informationi

    Entry nameiG6B_HUMAN
    AccessioniPrimary (citable) accession number: O95866
    Secondary accession number(s): A2BEZ1
    , A2BEZ2, A2BEZ3, A2BEZ4, A2BEZ5, B0UXC4, B0UXC7, B0UXC8, B0V024, B0V026, Q14CK2, Q96A86, Q96A87, Q96A88, Q96A89, Q96A90, Q96A91
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 21, 2005
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 106 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3