Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein G6b

Gene

G6B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide. Appears to operate in a calcium-independent manner. Isoform B is a putative inhibitory receptor. Isoform A may be its activating counterpart.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Heparin-binding

Enzyme and pathway databases

ReactomeiR-HSA-114604. GPVI-mediated activation cascade.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein G6b
Gene namesi
Name:G6BImported
Synonyms:C6orf25Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:13937. C6orf25.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini18 – 142Extracellular1 PublicationSequence analysisAdd BLAST125
Transmembranei143 – 163HelicalSequence analysisAdd BLAST21
Topological domaini164 – 241Cytoplasmic1 PublicationSequence analysisAdd BLAST78

GO - Cellular componenti

  • endoplasmic reticulum Source: UniProtKB-SubCell
  • Golgi apparatus Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi211Y → F: Loss of tyrosine phosphorylation and loss of interaction with PTPN6 and PTPN11. 1 Publication1
Mutagenesisi237Y → F: Reduced level of tyrosine phosphorylation and interaction with PTPN6 and PTPN11. 1 Publication1

Organism-specific databases

DisGeNETi80739.
OpenTargetsiENSG00000204420.
ENSG00000206396.
ENSG00000224393.
ENSG00000228090.
ENSG00000230060.
ENSG00000231003.
ENSG00000237459.
PharmGKBiPA25926.

Polymorphism and mutation databases

BioMutaiG6B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 171 PublicationAdd BLAST17
ChainiPRO_000002131218 – 241Protein G6bAdd BLAST224

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi32N-linked (GlcNAc...)Sequence analysis1
Modified residuei211Phosphotyrosine1 Publication1

Post-translational modificationi

All isoforms are N-glycosylated.1 Publication
Isoform E is O-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiO95866.
PeptideAtlasiO95866.
PRIDEiO95866.

PTM databases

iPTMnetiO95866.
PhosphoSitePlusiO95866.

Expressioni

Tissue specificityi

Expressed in a restricted set of hematopoietic cell lines including the erythroleukemia cell line K-562 and the T-cell leukemia cell lines MOLT-4 and Jurkat. Not detected in the monocyte-like cell line U-937, the B-cell-like cell line Raji, the fibroblast cell lines TK and HeLa, or the natural killer cell lines NKL, NK 62 and YT. Expressed in platelets.2 Publications

Gene expression databases

BgeeiENSG00000204420.
ExpressionAtlasiO95866. baseline and differential.
GenevisibleiO95866. HS.

Interactioni

Subunit structurei

Interacts with PTPN6 and PTPN11. Binds to heparin.1 Publication

Protein-protein interaction databases

BioGridi123283. 2 interactors.
IntActiO95866. 3 interactors.
MINTiMINT-8020429.
STRINGi9606.ENSP00000364964.

Structurei

3D structure databases

ProteinModelPortaliO95866.
SMRiO95866.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IYA7. Eukaryota.
ENOG41118MY. LUCA.
GeneTreeiENSGT00390000017793.
HOVERGENiHBG080566.
InParanoidiO95866.
OMAiPRFPACK.
OrthoDBiEOG091G0N3N.
PhylomeDBiO95866.
TreeFamiTF337394.

Family and domain databases

InterProiIPR028070. G6B.
[Graphical view]
PfamiPF15096. G6B. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B1 Publication (identifier: O95866-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVFLQLLPL LLSRAQGNPG ASLDGRPGDR VNLSCGGVSH PIRWVWAPSF
60 70 80 90 100
PACKGLSKGR RPILWASSSG TPTVPPLQPF VGRLRSLDSG IRRLELLLSA
110 120 130 140 150
GDSGTFFCKG RHEDESRTVL HVLGDRTYCK APGPTHGSVY PQLLIPLLGA
160 170 180 190 200
GLVLGLGALG LVWWLHRRLP PQPIRPLPRF APLVKTEPQR PVKEEEPKIP
210 220 230 240
GDLDQEPSLL YADLDHLALS RPRRLSTADP ADASTIYAVV V
Length:241
Mass (Da):26,163
Last modified:May 1, 1999 - v1
Checksum:iC1390699EAA109BD
GO
Isoform A1 Publication (identifier: O95866-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...APPAVHSGPC

Show »
Length:237
Mass (Da):25,003
Checksum:i109526EF36D3B6CF
GO
Isoform C1 Publication (identifier: O95866-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     138-180: SVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF → ACPRNRFDHSLDLLCPPHI

Show »
Length:217
Mass (Da):23,573
Checksum:i826F70FE5B45B9A0
GO
Isoform D1 Publication (identifier: O95866-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-241: GSVYPQLLIP...DASTIYAVVV → ALSPPHSSTC...APPAVHSGPC

Show »
Length:193
Mass (Da):20,169
Checksum:iE490E4D05BAF1652
GO
Isoform E1 Publication (identifier: O95866-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-180: Missing.

Show »
Length:197
Mass (Da):21,329
Checksum:i9183A850EEA4CB82
GO
Isoform F1 Publication (identifier: O95866-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     181-241: APLVKTEPQR...DASTIYAVVV → GETNSTPFSF...SPSFSSVPPT

Show »
Length:225
Mass (Da):24,225
Checksum:i1C0BF72C6E0D7CE2
GO
Isoform G1 Publication (identifier: O95866-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...TGKGMGMGRG

Show »
Length:222
Mass (Da):23,578
Checksum:i6253F93B2D56D1A6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti137 – 138GS → ID in CAI18409 (PubMed:14574404).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051004175R → G.1 PublicationCorresponds to variant rs11575845dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014172137 – 241GSVYP…YAVVV → ALSPPHSSTCENRAPEASKG GRAQDSRGPGPGTEPALCGS GPSSPQQAPPAVHSGPC in isoform D. 1 PublicationAdd BLAST105
Alternative sequenceiVSP_014173137 – 180Missing in isoform E. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_014174138 – 180SVYPQ…PLPRF → ACPRNRFDHSLDLLCPPHI in isoform C. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_014175181 – 241APLVK…YAVVV → GETNSTPFSFSYMPTPHPSI PESEPLLGADTLVTFSPSFS SVPPT in isoform F. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_014176182 – 241PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTEPALCGSG PSSPQQAPPAVHSGPC in isoform A. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_014177182 – 241PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTGKGMGMGR G in isoform G. 2 PublicationsAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ292259 mRNA. Translation: CAC83497.1.
AJ292260 mRNA. Translation: CAC83496.1.
AJ292261 mRNA. Translation: CAC83498.1.
AJ292262 mRNA. Translation: CAC83502.1.
AJ292263 mRNA. Translation: CAC83499.1.
AJ292264 mRNA. Translation: CAC83500.1.
AJ292265 mRNA. Translation: CAC83501.1.
AF129756 Genomic DNA. Translation: AAD18075.1.
BA000025 Genomic DNA. Translation: BAB63378.1.
AL670886 Genomic DNA. Translation: CAI17813.2.
AL670886 Genomic DNA. Translation: CAI17814.2.
AL670886 Genomic DNA. Translation: CAI17815.1.
AL670886 Genomic DNA. Translation: CAI17816.2.
AL670886 Genomic DNA. Translation: CAI17818.2.
AL662899 Genomic DNA. Translation: CAI18406.2.
AL662899 Genomic DNA. Translation: CAI18407.2.
AL662899 Genomic DNA. Translation: CAI18408.1.
AL662899 Genomic DNA. Translation: CAI18409.2.
AL662899 Genomic DNA. Translation: CAI18412.2.
BX248244 Genomic DNA. Translation: CAM26092.1.
BX248244 Genomic DNA. Translation: CAM26093.1.
BX248244 Genomic DNA. Translation: CAM26094.1.
BX248244 Genomic DNA. Translation: CAM26095.1.
BX248244 Genomic DNA. Translation: CAM26096.1.
AL844216 Genomic DNA. Translation: CAM45767.1.
AL844216 Genomic DNA. Translation: CAM45768.1.
AL844216 Genomic DNA. Translation: CAM45769.1.
AL844216 Genomic DNA. Translation: CAM45770.1.
AL844216 Genomic DNA. Translation: CAM45771.1.
CR354443 Genomic DNA. Translation: CAQ07017.1.
CR354443 Genomic DNA. Translation: CAQ07020.1.
CR354443 Genomic DNA. Translation: CAQ07021.1.
CR936239 Genomic DNA. Translation: CAQ08890.1.
CR936239 Genomic DNA. Translation: CAQ08892.1.
CR936239 Genomic DNA. Translation: CAQ08893.1.
CR936239 Genomic DNA. Translation: CAQ08894.1.
CR759787 Genomic DNA. Translation: CAQ10105.1.
CR759787 Genomic DNA. Translation: CAQ10107.1.
CR759787 Genomic DNA. Translation: CAQ10108.1.
CR759787 Genomic DNA. Translation: CAQ10109.1.
CH471081 Genomic DNA. Translation: EAX03493.1.
CH471081 Genomic DNA. Translation: EAX03494.1.
CH471081 Genomic DNA. Translation: EAX03497.1.
CH471081 Genomic DNA. Translation: EAX03498.1.
BC113719 mRNA. Translation: AAI13720.1.
BC113721 mRNA. Translation: AAI13722.1.
CCDSiCCDS34405.1. [O95866-5]
CCDS34406.1. [O95866-2]
CCDS34407.1. [O95866-7]
CCDS4715.1. [O95866-1]
CCDS4716.1. [O95866-3]
CCDS4717.1. [O95866-4]
RefSeqiNP_079536.2. NM_025260.3. [O95866-2]
NP_612116.1. NM_138272.2. [O95866-1]
NP_612117.1. NM_138273.2. [O95866-3]
NP_612118.1. NM_138274.2. [O95866-4]
NP_612119.1. NM_138275.2. [O95866-5]
NP_612121.1. NM_138277.2. [O95866-7]
UniGeneiHs.247879.

Genome annotation databases

EnsembliENST00000375804; ENSP00000364962; ENSG00000204420. [O95866-4]
ENST00000375805; ENSP00000364963; ENSG00000204420. [O95866-3]
ENST00000375806; ENSP00000364964; ENSG00000204420. [O95866-1]
ENST00000375809; ENSP00000364967; ENSG00000204420. [O95866-2]
ENST00000375810; ENSP00000364968; ENSG00000204420. [O95866-7]
ENST00000375814; ENSP00000364972; ENSG00000204420. [O95866-5]
ENST00000383410; ENSP00000372902; ENSG00000206396. [O95866-5]
ENST00000383411; ENSP00000372903; ENSG00000206396. [O95866-3]
ENST00000383412; ENSP00000372904; ENSG00000206396. [O95866-2]
ENST00000400067; ENSP00000382940; ENSG00000206396. [O95866-4]
ENST00000400071; ENSP00000382944; ENSG00000206396. [O95866-1]
ENST00000411608; ENSP00000392961; ENSG00000228090. [O95866-4]
ENST00000415728; ENSP00000408430; ENSG00000224393. [O95866-1]
ENST00000415984; ENSP00000394082; ENSG00000237459. [O95866-5]
ENST00000417610; ENSP00000412747; ENSG00000230060. [O95866-4]
ENST00000422012; ENSP00000398061; ENSG00000230060. [O95866-3]
ENST00000425998; ENSP00000392917; ENSG00000224393. [O95866-4]
ENST00000426729; ENSP00000390272; ENSG00000230060. [O95866-2]
ENST00000428302; ENSP00000404519; ENSG00000231003. [O95866-2]
ENST00000431888; ENSP00000390821; ENSG00000230060. [O95866-5]
ENST00000433769; ENSP00000413647; ENSG00000228090. [O95866-5]
ENST00000435007; ENSP00000401892; ENSG00000231003. [O95866-3]
ENST00000436030; ENSP00000406706; ENSG00000231003. [O95866-1]
ENST00000437153; ENSP00000412937; ENSG00000231003. [O95866-4]
ENST00000440063; ENSP00000388982; ENSG00000237459. [O95866-4]
ENST00000444404; ENSP00000415282; ENSG00000237459. [O95866-2]
ENST00000445381; ENSP00000396823; ENSG00000224393. [O95866-3]
ENST00000447587; ENSP00000416447; ENSG00000237459. [O95866-1]
ENST00000449633; ENSP00000388484; ENSG00000231003. [O95866-5]
ENST00000451549; ENSP00000395801; ENSG00000224393. [O95866-2]
ENST00000455185; ENSP00000414824; ENSG00000224393. [O95866-5]
ENST00000457450; ENSP00000395279; ENSG00000237459. [O95866-3]
ENST00000457884; ENSP00000391097; ENSG00000230060. [O95866-1]
GeneIDi80739.
KEGGihsa:80739.
UCSCiuc003nwk.4. human. [O95866-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ292259 mRNA. Translation: CAC83497.1.
AJ292260 mRNA. Translation: CAC83496.1.
AJ292261 mRNA. Translation: CAC83498.1.
AJ292262 mRNA. Translation: CAC83502.1.
AJ292263 mRNA. Translation: CAC83499.1.
AJ292264 mRNA. Translation: CAC83500.1.
AJ292265 mRNA. Translation: CAC83501.1.
AF129756 Genomic DNA. Translation: AAD18075.1.
BA000025 Genomic DNA. Translation: BAB63378.1.
AL670886 Genomic DNA. Translation: CAI17813.2.
AL670886 Genomic DNA. Translation: CAI17814.2.
AL670886 Genomic DNA. Translation: CAI17815.1.
AL670886 Genomic DNA. Translation: CAI17816.2.
AL670886 Genomic DNA. Translation: CAI17818.2.
AL662899 Genomic DNA. Translation: CAI18406.2.
AL662899 Genomic DNA. Translation: CAI18407.2.
AL662899 Genomic DNA. Translation: CAI18408.1.
AL662899 Genomic DNA. Translation: CAI18409.2.
AL662899 Genomic DNA. Translation: CAI18412.2.
BX248244 Genomic DNA. Translation: CAM26092.1.
BX248244 Genomic DNA. Translation: CAM26093.1.
BX248244 Genomic DNA. Translation: CAM26094.1.
BX248244 Genomic DNA. Translation: CAM26095.1.
BX248244 Genomic DNA. Translation: CAM26096.1.
AL844216 Genomic DNA. Translation: CAM45767.1.
AL844216 Genomic DNA. Translation: CAM45768.1.
AL844216 Genomic DNA. Translation: CAM45769.1.
AL844216 Genomic DNA. Translation: CAM45770.1.
AL844216 Genomic DNA. Translation: CAM45771.1.
CR354443 Genomic DNA. Translation: CAQ07017.1.
CR354443 Genomic DNA. Translation: CAQ07020.1.
CR354443 Genomic DNA. Translation: CAQ07021.1.
CR936239 Genomic DNA. Translation: CAQ08890.1.
CR936239 Genomic DNA. Translation: CAQ08892.1.
CR936239 Genomic DNA. Translation: CAQ08893.1.
CR936239 Genomic DNA. Translation: CAQ08894.1.
CR759787 Genomic DNA. Translation: CAQ10105.1.
CR759787 Genomic DNA. Translation: CAQ10107.1.
CR759787 Genomic DNA. Translation: CAQ10108.1.
CR759787 Genomic DNA. Translation: CAQ10109.1.
CH471081 Genomic DNA. Translation: EAX03493.1.
CH471081 Genomic DNA. Translation: EAX03494.1.
CH471081 Genomic DNA. Translation: EAX03497.1.
CH471081 Genomic DNA. Translation: EAX03498.1.
BC113719 mRNA. Translation: AAI13720.1.
BC113721 mRNA. Translation: AAI13722.1.
CCDSiCCDS34405.1. [O95866-5]
CCDS34406.1. [O95866-2]
CCDS34407.1. [O95866-7]
CCDS4715.1. [O95866-1]
CCDS4716.1. [O95866-3]
CCDS4717.1. [O95866-4]
RefSeqiNP_079536.2. NM_025260.3. [O95866-2]
NP_612116.1. NM_138272.2. [O95866-1]
NP_612117.1. NM_138273.2. [O95866-3]
NP_612118.1. NM_138274.2. [O95866-4]
NP_612119.1. NM_138275.2. [O95866-5]
NP_612121.1. NM_138277.2. [O95866-7]
UniGeneiHs.247879.

3D structure databases

ProteinModelPortaliO95866.
SMRiO95866.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123283. 2 interactors.
IntActiO95866. 3 interactors.
MINTiMINT-8020429.
STRINGi9606.ENSP00000364964.

PTM databases

iPTMnetiO95866.
PhosphoSitePlusiO95866.

Polymorphism and mutation databases

BioMutaiG6B.

Proteomic databases

PaxDbiO95866.
PeptideAtlasiO95866.
PRIDEiO95866.

Protocols and materials databases

DNASUi80739.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375804; ENSP00000364962; ENSG00000204420. [O95866-4]
ENST00000375805; ENSP00000364963; ENSG00000204420. [O95866-3]
ENST00000375806; ENSP00000364964; ENSG00000204420. [O95866-1]
ENST00000375809; ENSP00000364967; ENSG00000204420. [O95866-2]
ENST00000375810; ENSP00000364968; ENSG00000204420. [O95866-7]
ENST00000375814; ENSP00000364972; ENSG00000204420. [O95866-5]
ENST00000383410; ENSP00000372902; ENSG00000206396. [O95866-5]
ENST00000383411; ENSP00000372903; ENSG00000206396. [O95866-3]
ENST00000383412; ENSP00000372904; ENSG00000206396. [O95866-2]
ENST00000400067; ENSP00000382940; ENSG00000206396. [O95866-4]
ENST00000400071; ENSP00000382944; ENSG00000206396. [O95866-1]
ENST00000411608; ENSP00000392961; ENSG00000228090. [O95866-4]
ENST00000415728; ENSP00000408430; ENSG00000224393. [O95866-1]
ENST00000415984; ENSP00000394082; ENSG00000237459. [O95866-5]
ENST00000417610; ENSP00000412747; ENSG00000230060. [O95866-4]
ENST00000422012; ENSP00000398061; ENSG00000230060. [O95866-3]
ENST00000425998; ENSP00000392917; ENSG00000224393. [O95866-4]
ENST00000426729; ENSP00000390272; ENSG00000230060. [O95866-2]
ENST00000428302; ENSP00000404519; ENSG00000231003. [O95866-2]
ENST00000431888; ENSP00000390821; ENSG00000230060. [O95866-5]
ENST00000433769; ENSP00000413647; ENSG00000228090. [O95866-5]
ENST00000435007; ENSP00000401892; ENSG00000231003. [O95866-3]
ENST00000436030; ENSP00000406706; ENSG00000231003. [O95866-1]
ENST00000437153; ENSP00000412937; ENSG00000231003. [O95866-4]
ENST00000440063; ENSP00000388982; ENSG00000237459. [O95866-4]
ENST00000444404; ENSP00000415282; ENSG00000237459. [O95866-2]
ENST00000445381; ENSP00000396823; ENSG00000224393. [O95866-3]
ENST00000447587; ENSP00000416447; ENSG00000237459. [O95866-1]
ENST00000449633; ENSP00000388484; ENSG00000231003. [O95866-5]
ENST00000451549; ENSP00000395801; ENSG00000224393. [O95866-2]
ENST00000455185; ENSP00000414824; ENSG00000224393. [O95866-5]
ENST00000457450; ENSP00000395279; ENSG00000237459. [O95866-3]
ENST00000457884; ENSP00000391097; ENSG00000230060. [O95866-1]
GeneIDi80739.
KEGGihsa:80739.
UCSCiuc003nwk.4. human. [O95866-1]

Organism-specific databases

CTDi80739.
DisGeNETi80739.
GeneCardsiC6orf25.
HGNCiHGNC:13937. C6orf25.
MIMi606520. gene.
neXtProtiNX_O95866.
OpenTargetsiENSG00000204420.
ENSG00000206396.
ENSG00000224393.
ENSG00000228090.
ENSG00000230060.
ENSG00000231003.
ENSG00000237459.
PharmGKBiPA25926.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IYA7. Eukaryota.
ENOG41118MY. LUCA.
GeneTreeiENSGT00390000017793.
HOVERGENiHBG080566.
InParanoidiO95866.
OMAiPRFPACK.
OrthoDBiEOG091G0N3N.
PhylomeDBiO95866.
TreeFamiTF337394.

Enzyme and pathway databases

ReactomeiR-HSA-114604. GPVI-mediated activation cascade.

Miscellaneous databases

GeneWikiiG6B_(gene).
GenomeRNAii80739.
PROiO95866.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000204420.
ExpressionAtlasiO95866. baseline and differential.
GenevisibleiO95866. HS.

Family and domain databases

InterProiIPR028070. G6B.
[Graphical view]
PfamiPF15096. G6B. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiG6B_HUMAN
AccessioniPrimary (citable) accession number: O95866
Secondary accession number(s): A2BEZ1
, A2BEZ2, A2BEZ3, A2BEZ4, A2BEZ5, B0UXC4, B0UXC7, B0UXC8, B0V024, B0V026, Q14CK2, Q96A86, Q96A87, Q96A88, Q96A89, Q96A90, Q96A91
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: May 1, 1999
Last modified: November 2, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.