Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95866

- G6B_HUMAN

UniProt

O95866 - G6B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein G6b

Gene

G6B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide. Appears to operate in a calcium-independent manner. Isoform B is a putative inhibitory receptor. Isoform A may be its activating counterpart.1 Publication

GO - Molecular functioni

  1. heparin binding Source: UniProtKB-KW

GO - Biological processi

  1. blood coagulation Source: Ensembl
  2. integrin-mediated signaling pathway Source: Ensembl
  3. megakaryocyte development Source: Ensembl
  4. platelet formation Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Heparin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein G6b
Gene namesi
Name:G6BImported
Synonyms:C6orf25Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6, UP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:13937. C6orf25.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini18 – 142125Extracellular1 PublicationSequence AnalysisAdd
BLAST
Transmembranei143 – 16321HelicalSequence AnalysisAdd
BLAST
Topological domaini164 – 24178Cytoplasmic1 PublicationSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
  2. Golgi apparatus Source: UniProtKB-KW
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi211 – 2111Y → F: Loss of tyrosine phosphorylation and loss of interaction with PTPN6 and PTPN11. 1 Publication
Mutagenesisi237 – 2371Y → F: Reduced level of tyrosine phosphorylation and interaction with PTPN6 and PTPN11. 1 Publication

Organism-specific databases

PharmGKBiPA25926.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 17171 PublicationAdd
BLAST
Chaini18 – 241224Protein G6bPRO_0000021312Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi32 – 321N-linked (GlcNAc...)Sequence Analysis
Modified residuei211 – 2111Phosphotyrosine1 Publication

Post-translational modificationi

All isoforms are N-glycosylated.1 Publication
Isoform E is O-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiO95866.
PRIDEiO95866.

PTM databases

PhosphoSiteiO95866.

Expressioni

Tissue specificityi

Expressed in a restricted set of hematopoietic cell lines including the erythroleukemia cell line K-562 and the T-cell leukemia cell lines MOLT-4 and Jurkat. Not detected in the monocyte-like cell line U-937, the B-cell-like cell line Raji, the fibroblast cell lines TK and HeLa, or the natural killer cell lines NKL, NK 62 and YT. Expressed in platelets.2 Publications

Gene expression databases

BgeeiO95866.
ExpressionAtlasiO95866. baseline and differential.
GenevestigatoriO95866.

Interactioni

Subunit structurei

Interacts with PTPN6 and PTPN11. Binds to heparin.1 Publication

Protein-protein interaction databases

BioGridi123283. 2 interactions.
IntActiO95866. 3 interactions.
MINTiMINT-8020429.
STRINGi9606.ENSP00000364964.

Structurei

3D structure databases

ProteinModelPortaliO95866.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG26268.
GeneTreeiENSGT00390000017793.
HOVERGENiHBG080566.
InParanoidiO95866.
OMAiLGVVWWW.
PhylomeDBiO95866.
TreeFamiTF337394.

Family and domain databases

InterProiIPR028070. G6B.
IPR003599. Ig_sub.
[Graphical view]
PfamiPF15096. G6B. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform B1 Publication (identifier: O95866-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVFLQLLPL LLSRAQGNPG ASLDGRPGDR VNLSCGGVSH PIRWVWAPSF
60 70 80 90 100
PACKGLSKGR RPILWASSSG TPTVPPLQPF VGRLRSLDSG IRRLELLLSA
110 120 130 140 150
GDSGTFFCKG RHEDESRTVL HVLGDRTYCK APGPTHGSVY PQLLIPLLGA
160 170 180 190 200
GLVLGLGALG LVWWLHRRLP PQPIRPLPRF APLVKTEPQR PVKEEEPKIP
210 220 230 240
GDLDQEPSLL YADLDHLALS RPRRLSTADP ADASTIYAVV V
Length:241
Mass (Da):26,163
Last modified:May 1, 1999 - v1
Checksum:iC1390699EAA109BD
GO
Isoform A1 Publication (identifier: O95866-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...APPAVHSGPC

Show »
Length:237
Mass (Da):25,003
Checksum:i109526EF36D3B6CF
GO
Isoform C1 Publication (identifier: O95866-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     138-180: SVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF → ACPRNRFDHSLDLLCPPHI

Show »
Length:217
Mass (Da):23,573
Checksum:i826F70FE5B45B9A0
GO
Isoform D1 Publication (identifier: O95866-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-241: GSVYPQLLIP...DASTIYAVVV → ALSPPHSSTC...APPAVHSGPC

Show »
Length:193
Mass (Da):20,169
Checksum:iE490E4D05BAF1652
GO
Isoform E1 Publication (identifier: O95866-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-180: Missing.

Show »
Length:197
Mass (Da):21,329
Checksum:i9183A850EEA4CB82
GO
Isoform F1 Publication (identifier: O95866-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     181-241: APLVKTEPQR...DASTIYAVVV → GETNSTPFSF...SPSFSSVPPT

Show »
Length:225
Mass (Da):24,225
Checksum:i1C0BF72C6E0D7CE2
GO
Isoform G1 Publication (identifier: O95866-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...TGKGMGMGRG

Show »
Length:222
Mass (Da):23,578
Checksum:i6253F93B2D56D1A6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti137 – 1382GS → ID in CAI18409. (PubMed:14574404)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti175 – 1751R → G.1 Publication
Corresponds to variant rs11575845 [ dbSNP | Ensembl ].
VAR_051004

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei137 – 241105GSVYP…YAVVV → ALSPPHSSTCENRAPEASKG GRAQDSRGPGPGTEPALCGS GPSSPQQAPPAVHSGPC in isoform D. 1 PublicationVSP_014172Add
BLAST
Alternative sequencei137 – 18044Missing in isoform E. 1 PublicationVSP_014173Add
BLAST
Alternative sequencei138 – 18043SVYPQ…PLPRF → ACPRNRFDHSLDLLCPPHI in isoform C. 1 PublicationVSP_014174Add
BLAST
Alternative sequencei181 – 24161APLVK…YAVVV → GETNSTPFSFSYMPTPHPSI PESEPLLGADTLVTFSPSFS SVPPT in isoform F. 1 PublicationVSP_014175Add
BLAST
Alternative sequencei182 – 24160PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTEPALCGSG PSSPQQAPPAVHSGPC in isoform A. 1 PublicationVSP_014176Add
BLAST
Alternative sequencei182 – 24160PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTGKGMGMGR G in isoform G. 2 PublicationsVSP_014177Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ292259 mRNA. Translation: CAC83497.1.
AJ292260 mRNA. Translation: CAC83496.1.
AJ292261 mRNA. Translation: CAC83498.1.
AJ292262 mRNA. Translation: CAC83502.1.
AJ292263 mRNA. Translation: CAC83499.1.
AJ292264 mRNA. Translation: CAC83500.1.
AJ292265 mRNA. Translation: CAC83501.1.
AF129756 Genomic DNA. Translation: AAD18075.1.
BA000025 Genomic DNA. Translation: BAB63378.1.
AL670886 Genomic DNA. Translation: CAI17813.2.
AL670886 Genomic DNA. Translation: CAI17814.2.
AL670886 Genomic DNA. Translation: CAI17815.1.
AL670886 Genomic DNA. Translation: CAI17816.2.
AL670886 Genomic DNA. Translation: CAI17818.2.
AL662899 Genomic DNA. Translation: CAI18406.2.
AL662899 Genomic DNA. Translation: CAI18407.2.
AL662899 Genomic DNA. Translation: CAI18408.1.
AL662899 Genomic DNA. Translation: CAI18409.2.
AL662899 Genomic DNA. Translation: CAI18412.2.
BX248244 Genomic DNA. Translation: CAM26092.1.
BX248244 Genomic DNA. Translation: CAM26093.1.
BX248244 Genomic DNA. Translation: CAM26094.1.
BX248244 Genomic DNA. Translation: CAM26095.1.
BX248244 Genomic DNA. Translation: CAM26096.1.
AL844216 Genomic DNA. Translation: CAM45767.1.
AL844216 Genomic DNA. Translation: CAM45768.1.
AL844216 Genomic DNA. Translation: CAM45769.1.
AL844216 Genomic DNA. Translation: CAM45770.1.
AL844216 Genomic DNA. Translation: CAM45771.1.
CR354443 Genomic DNA. Translation: CAQ07017.1.
CR354443 Genomic DNA. Translation: CAQ07020.1.
CR354443 Genomic DNA. Translation: CAQ07021.1.
CR936239 Genomic DNA. Translation: CAQ08890.1.
CR936239 Genomic DNA. Translation: CAQ08892.1.
CR936239 Genomic DNA. Translation: CAQ08893.1.
CR936239 Genomic DNA. Translation: CAQ08894.1.
CR759787 Genomic DNA. Translation: CAQ10105.1.
CR759787 Genomic DNA. Translation: CAQ10107.1.
CR759787 Genomic DNA. Translation: CAQ10108.1.
CR759787 Genomic DNA. Translation: CAQ10109.1.
CH471081 Genomic DNA. Translation: EAX03493.1.
CH471081 Genomic DNA. Translation: EAX03494.1.
CH471081 Genomic DNA. Translation: EAX03497.1.
CH471081 Genomic DNA. Translation: EAX03498.1.
BC113719 mRNA. Translation: AAI13720.1.
BC113721 mRNA. Translation: AAI13722.1.
CCDSiCCDS34405.1. [O95866-5]
CCDS34406.1. [O95866-2]
CCDS34407.1. [O95866-7]
CCDS4715.1. [O95866-1]
CCDS4716.1. [O95866-3]
CCDS4717.1. [O95866-4]
RefSeqiNP_079536.2. NM_025260.3. [O95866-2]
NP_612116.1. NM_138272.2. [O95866-1]
NP_612117.1. NM_138273.2. [O95866-3]
NP_612118.1. NM_138274.2. [O95866-4]
NP_612119.1. NM_138275.2. [O95866-5]
NP_612121.1. NM_138277.2. [O95866-7]
UniGeneiHs.247879.

Genome annotation databases

EnsembliENST00000375804; ENSP00000364962; ENSG00000204420. [O95866-4]
ENST00000375805; ENSP00000364963; ENSG00000204420. [O95866-3]
ENST00000375806; ENSP00000364964; ENSG00000204420. [O95866-1]
ENST00000375809; ENSP00000364967; ENSG00000204420. [O95866-2]
ENST00000375810; ENSP00000364968; ENSG00000204420. [O95866-7]
ENST00000375814; ENSP00000364972; ENSG00000204420. [O95866-5]
ENST00000383410; ENSP00000372902; ENSG00000206396. [O95866-5]
ENST00000383411; ENSP00000372903; ENSG00000206396. [O95866-3]
ENST00000383412; ENSP00000372904; ENSG00000206396. [O95866-2]
ENST00000400067; ENSP00000382940; ENSG00000206396. [O95866-4]
ENST00000400071; ENSP00000382944; ENSG00000206396. [O95866-1]
ENST00000411608; ENSP00000392961; ENSG00000228090. [O95866-4]
ENST00000415728; ENSP00000408430; ENSG00000224393. [O95866-1]
ENST00000415984; ENSP00000394082; ENSG00000237459. [O95866-5]
ENST00000417610; ENSP00000412747; ENSG00000230060. [O95866-4]
ENST00000422012; ENSP00000398061; ENSG00000230060. [O95866-3]
ENST00000425998; ENSP00000392917; ENSG00000224393. [O95866-4]
ENST00000426729; ENSP00000390272; ENSG00000230060. [O95866-2]
ENST00000428302; ENSP00000404519; ENSG00000231003. [O95866-2]
ENST00000431888; ENSP00000390821; ENSG00000230060. [O95866-5]
ENST00000433769; ENSP00000413647; ENSG00000228090. [O95866-5]
ENST00000435007; ENSP00000401892; ENSG00000231003. [O95866-3]
ENST00000436030; ENSP00000406706; ENSG00000231003. [O95866-1]
ENST00000437153; ENSP00000412937; ENSG00000231003. [O95866-4]
ENST00000440063; ENSP00000388982; ENSG00000237459. [O95866-4]
ENST00000444404; ENSP00000415282; ENSG00000237459. [O95866-2]
ENST00000445381; ENSP00000396823; ENSG00000224393. [O95866-3]
ENST00000447587; ENSP00000416447; ENSG00000237459. [O95866-1]
ENST00000449633; ENSP00000388484; ENSG00000231003. [O95866-5]
ENST00000451549; ENSP00000395801; ENSG00000224393. [O95866-2]
ENST00000455185; ENSP00000414824; ENSG00000224393. [O95866-5]
ENST00000457450; ENSP00000395279; ENSG00000237459. [O95866-3]
ENST00000457884; ENSP00000391097; ENSG00000230060. [O95866-1]
GeneIDi80739.
KEGGihsa:80739.
UCSCiuc003nwn.3. human. [O95866-7]
uc003nwo.3. human. [O95866-4]
uc011doc.2. human. [O95866-1]
uc011dod.2. human. [O95866-5]
uc011doe.2. human. [O95866-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ292259 mRNA. Translation: CAC83497.1 .
AJ292260 mRNA. Translation: CAC83496.1 .
AJ292261 mRNA. Translation: CAC83498.1 .
AJ292262 mRNA. Translation: CAC83502.1 .
AJ292263 mRNA. Translation: CAC83499.1 .
AJ292264 mRNA. Translation: CAC83500.1 .
AJ292265 mRNA. Translation: CAC83501.1 .
AF129756 Genomic DNA. Translation: AAD18075.1 .
BA000025 Genomic DNA. Translation: BAB63378.1 .
AL670886 Genomic DNA. Translation: CAI17813.2 .
AL670886 Genomic DNA. Translation: CAI17814.2 .
AL670886 Genomic DNA. Translation: CAI17815.1 .
AL670886 Genomic DNA. Translation: CAI17816.2 .
AL670886 Genomic DNA. Translation: CAI17818.2 .
AL662899 Genomic DNA. Translation: CAI18406.2 .
AL662899 Genomic DNA. Translation: CAI18407.2 .
AL662899 Genomic DNA. Translation: CAI18408.1 .
AL662899 Genomic DNA. Translation: CAI18409.2 .
AL662899 Genomic DNA. Translation: CAI18412.2 .
BX248244 Genomic DNA. Translation: CAM26092.1 .
BX248244 Genomic DNA. Translation: CAM26093.1 .
BX248244 Genomic DNA. Translation: CAM26094.1 .
BX248244 Genomic DNA. Translation: CAM26095.1 .
BX248244 Genomic DNA. Translation: CAM26096.1 .
AL844216 Genomic DNA. Translation: CAM45767.1 .
AL844216 Genomic DNA. Translation: CAM45768.1 .
AL844216 Genomic DNA. Translation: CAM45769.1 .
AL844216 Genomic DNA. Translation: CAM45770.1 .
AL844216 Genomic DNA. Translation: CAM45771.1 .
CR354443 Genomic DNA. Translation: CAQ07017.1 .
CR354443 Genomic DNA. Translation: CAQ07020.1 .
CR354443 Genomic DNA. Translation: CAQ07021.1 .
CR936239 Genomic DNA. Translation: CAQ08890.1 .
CR936239 Genomic DNA. Translation: CAQ08892.1 .
CR936239 Genomic DNA. Translation: CAQ08893.1 .
CR936239 Genomic DNA. Translation: CAQ08894.1 .
CR759787 Genomic DNA. Translation: CAQ10105.1 .
CR759787 Genomic DNA. Translation: CAQ10107.1 .
CR759787 Genomic DNA. Translation: CAQ10108.1 .
CR759787 Genomic DNA. Translation: CAQ10109.1 .
CH471081 Genomic DNA. Translation: EAX03493.1 .
CH471081 Genomic DNA. Translation: EAX03494.1 .
CH471081 Genomic DNA. Translation: EAX03497.1 .
CH471081 Genomic DNA. Translation: EAX03498.1 .
BC113719 mRNA. Translation: AAI13720.1 .
BC113721 mRNA. Translation: AAI13722.1 .
CCDSi CCDS34405.1. [O95866-5 ]
CCDS34406.1. [O95866-2 ]
CCDS34407.1. [O95866-7 ]
CCDS4715.1. [O95866-1 ]
CCDS4716.1. [O95866-3 ]
CCDS4717.1. [O95866-4 ]
RefSeqi NP_079536.2. NM_025260.3. [O95866-2 ]
NP_612116.1. NM_138272.2. [O95866-1 ]
NP_612117.1. NM_138273.2. [O95866-3 ]
NP_612118.1. NM_138274.2. [O95866-4 ]
NP_612119.1. NM_138275.2. [O95866-5 ]
NP_612121.1. NM_138277.2. [O95866-7 ]
UniGenei Hs.247879.

3D structure databases

ProteinModelPortali O95866.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123283. 2 interactions.
IntActi O95866. 3 interactions.
MINTi MINT-8020429.
STRINGi 9606.ENSP00000364964.

PTM databases

PhosphoSitei O95866.

Proteomic databases

PaxDbi O95866.
PRIDEi O95866.

Protocols and materials databases

DNASUi 80739.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000375804 ; ENSP00000364962 ; ENSG00000204420 . [O95866-4 ]
ENST00000375805 ; ENSP00000364963 ; ENSG00000204420 . [O95866-3 ]
ENST00000375806 ; ENSP00000364964 ; ENSG00000204420 . [O95866-1 ]
ENST00000375809 ; ENSP00000364967 ; ENSG00000204420 . [O95866-2 ]
ENST00000375810 ; ENSP00000364968 ; ENSG00000204420 . [O95866-7 ]
ENST00000375814 ; ENSP00000364972 ; ENSG00000204420 . [O95866-5 ]
ENST00000383410 ; ENSP00000372902 ; ENSG00000206396 . [O95866-5 ]
ENST00000383411 ; ENSP00000372903 ; ENSG00000206396 . [O95866-3 ]
ENST00000383412 ; ENSP00000372904 ; ENSG00000206396 . [O95866-2 ]
ENST00000400067 ; ENSP00000382940 ; ENSG00000206396 . [O95866-4 ]
ENST00000400071 ; ENSP00000382944 ; ENSG00000206396 . [O95866-1 ]
ENST00000411608 ; ENSP00000392961 ; ENSG00000228090 . [O95866-4 ]
ENST00000415728 ; ENSP00000408430 ; ENSG00000224393 . [O95866-1 ]
ENST00000415984 ; ENSP00000394082 ; ENSG00000237459 . [O95866-5 ]
ENST00000417610 ; ENSP00000412747 ; ENSG00000230060 . [O95866-4 ]
ENST00000422012 ; ENSP00000398061 ; ENSG00000230060 . [O95866-3 ]
ENST00000425998 ; ENSP00000392917 ; ENSG00000224393 . [O95866-4 ]
ENST00000426729 ; ENSP00000390272 ; ENSG00000230060 . [O95866-2 ]
ENST00000428302 ; ENSP00000404519 ; ENSG00000231003 . [O95866-2 ]
ENST00000431888 ; ENSP00000390821 ; ENSG00000230060 . [O95866-5 ]
ENST00000433769 ; ENSP00000413647 ; ENSG00000228090 . [O95866-5 ]
ENST00000435007 ; ENSP00000401892 ; ENSG00000231003 . [O95866-3 ]
ENST00000436030 ; ENSP00000406706 ; ENSG00000231003 . [O95866-1 ]
ENST00000437153 ; ENSP00000412937 ; ENSG00000231003 . [O95866-4 ]
ENST00000440063 ; ENSP00000388982 ; ENSG00000237459 . [O95866-4 ]
ENST00000444404 ; ENSP00000415282 ; ENSG00000237459 . [O95866-2 ]
ENST00000445381 ; ENSP00000396823 ; ENSG00000224393 . [O95866-3 ]
ENST00000447587 ; ENSP00000416447 ; ENSG00000237459 . [O95866-1 ]
ENST00000449633 ; ENSP00000388484 ; ENSG00000231003 . [O95866-5 ]
ENST00000451549 ; ENSP00000395801 ; ENSG00000224393 . [O95866-2 ]
ENST00000455185 ; ENSP00000414824 ; ENSG00000224393 . [O95866-5 ]
ENST00000457450 ; ENSP00000395279 ; ENSG00000237459 . [O95866-3 ]
ENST00000457884 ; ENSP00000391097 ; ENSG00000230060 . [O95866-1 ]
GeneIDi 80739.
KEGGi hsa:80739.
UCSCi uc003nwn.3. human. [O95866-7 ]
uc003nwo.3. human. [O95866-4 ]
uc011doc.2. human. [O95866-1 ]
uc011dod.2. human. [O95866-5 ]
uc011doe.2. human. [O95866-3 ]

Organism-specific databases

CTDi 80739.
GeneCardsi GC06P031686.
GC06Pj31673.
GC06Pk31668.
GC06Pl31725.
GC06Pm31762.
GC06Pn31676.
GC06Po31676.
HGNCi HGNC:13937. C6orf25.
MIMi 606520. gene.
neXtProti NX_O95866.
PharmGKBi PA25926.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG26268.
GeneTreei ENSGT00390000017793.
HOVERGENi HBG080566.
InParanoidi O95866.
OMAi LGVVWWW.
PhylomeDBi O95866.
TreeFami TF337394.

Miscellaneous databases

GeneWikii G6B_(gene).
GenomeRNAii 80739.
NextBioi 71066.
PROi O95866.
SOURCEi Search...

Gene expression databases

Bgeei O95866.
ExpressionAtlasi O95866. baseline and differential.
Genevestigatori O95866.

Family and domain databases

InterProi IPR028070. G6B.
IPR003599. Ig_sub.
[Graphical view ]
Pfami PF15096. G6B. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "G6b, a novel immunoglobulin superfamily member encoded in the human major histocompatibility complex, interacts with SHP-1 and SHP-2."
    de Vet E.C.M., Aguado B., Campbell R.D.
    J. Biol. Chem. 276:42070-42076(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D; E; F AND G), INTERACTION WITH PTPN6 AND PTPN11, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION, PHOSPHORYLATION AT TYR-211, MUTAGENESIS OF TYR-211 AND TYR-237.
    Tissue: T-cell.
  2. "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
    Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
    Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
    Shiina S., Tamiya G., Oka A., Inoko H.
    Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLY-175.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM G).
  7. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
    Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
    Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 18-30.
    Tissue: Platelet1 Publication.
  8. "The cell surface receptor G6b, a member of the immunoglobulin superfamily, binds heparin."
    de Vet E.C., Newland S.A., Lyons P.A., Aguado B., Campbell R.D.
    FEBS Lett. 579:2355-2358(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: HEPARIN-BINDING.
  9. "The novel inhibitory receptor G6B is expressed on the surface of platelets and attenuates platelet function in vitro."
    Newland S.A., Macaulay I.C., Floto A.R., de Vet E.C., Ouwehand W.H., Watkins N.A., Lyons P.A., Campbell D.R.
    Blood 109:4806-4809(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.

Entry informationi

Entry nameiG6B_HUMAN
AccessioniPrimary (citable) accession number: O95866
Secondary accession number(s): A2BEZ1
, A2BEZ2, A2BEZ3, A2BEZ4, A2BEZ5, B0UXC4, B0UXC7, B0UXC8, B0V024, B0V026, Q14CK2, Q96A86, Q96A87, Q96A88, Q96A89, Q96A90, Q96A91
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: May 1, 1999
Last modified: October 29, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3