Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95864

- FADS2_HUMAN

UniProt

O95864 - FADS2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fatty acid desaturase 2

Gene

FADS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3) respectively and other desaturation steps. Highly unsaturated fatty acids (HUFA) play pivotal roles in many biological functions. It catalizes as well the introduction of a cis double bond in palmitate to produce the mono-unsaturated fatty acid sapienate, the most abundant fatty acid in sebum.2 Publications

Pathwayi

GO - Molecular functioni

  1. heme binding Source: InterPro
  2. iron ion binding Source: InterPro
  3. stearoyl-CoA 9-desaturase activity Source: Ensembl

GO - Biological processi

  1. alpha-linolenic acid metabolic process Source: Reactome
  2. linoleic acid metabolic process Source: Reactome
  3. small molecule metabolic process Source: Reactome
  4. unsaturated fatty acid biosynthetic process Source: ProtInc
  5. unsaturated fatty acid metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Electron transport, Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Transport

Enzyme and pathway databases

BioCyciMetaCyc:HS05918-MONOMER.
ReactomeiREACT_121100. Linoleic acid (LA) metabolism.
REACT_121147. alpha-linolenic acid (ALA) metabolism.
UniPathwayiUPA00658.

Names & Taxonomyi

Protein namesi
Recommended name:
Fatty acid desaturase 2 (EC:1.14.19.-)
Alternative name(s):
Delta(6) fatty acid desaturase
Short name:
D6D
Short name:
Delta(6) desaturase
Short name:
Delta-6 desaturase
Gene namesi
Name:FADS2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:3575. FADS2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 131131CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei132 – 15221HelicalSequence AnalysisAdd
BLAST
Topological domaini153 – 1575LumenalSequence Analysis
Transmembranei158 – 17821HelicalSequence AnalysisAdd
BLAST
Topological domaini179 – 26486CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei265 – 28521HelicalSequence AnalysisAdd
BLAST
Topological domaini286 – 30520LumenalSequence AnalysisAdd
BLAST
Transmembranei306 – 32621HelicalSequence AnalysisAdd
BLAST
Topological domaini327 – 444118CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: Reactome
  2. integral component of plasma membrane Source: ProtInc
  3. membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27974.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 444444Fatty acid desaturase 2PRO_0000307101Add
BLAST

Proteomic databases

MaxQBiO95864.
PaxDbiO95864.
PeptideAtlasiO95864.
PRIDEiO95864.

PTM databases

PhosphoSiteiO95864.

Expressioni

Tissue specificityi

Expressed in a wide array of tissues, highest expression is found in liver followed by brain, lung, heart, and retina. A lower level is found in breast tumor when compared with normal tissues; lowest levels were found in patients with poor prognostic index.3 Publications

Developmental stagei

Found in fetal heart.

Inductioni

Repressed by dietary highly unsaturated fatty acids.2 Publications

Gene expression databases

BgeeiO95864.
CleanExiHS_FADS2.
ExpressionAtlasiO95864. baseline and differential.
GenevestigatoriO95864.

Organism-specific databases

HPAiHPA006741.

Interactioni

Protein-protein interaction databases

BioGridi114810. 6 interactions.
MINTiMINT-2866355.
STRINGi9606.ENSP00000278840.

Structurei

3D structure databases

ProteinModelPortaliO95864.
SMRiO95864. Positions 17-98.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini18 – 9578Cytochrome b5 heme-bindingPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi180 – 1845Histidine box-1
Motifi217 – 2215Histidine box-2
Motifi382 – 3865Histidine box-3

Domaini

The histidine box domains may contain the active site and/or be involved in metal ion binding.

Sequence similaritiesi

Belongs to the fatty acid desaturase family.Curated
Contains 1 cytochrome b5 heme-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5274.
GeneTreeiENSGT00510000046574.
HOVERGENiHBG002839.
InParanoidiO95864.
KOiK10226.
OMAiGHPITGQ.
PhylomeDBiO95864.
TreeFamiTF313604.

Family and domain databases

Gene3Di3.10.120.10. 1 hit.
InterProiIPR001199. Cyt_B5-like_heme/steroid-bd.
IPR012171. Fatty_acid/sphinglp_desaturase.
IPR005804. Fatty_acid_desaturase-1.
[Graphical view]
PfamiPF00173. Cyt-b5. 1 hit.
PF00487. FA_desaturase. 1 hit.
[Graphical view]
PIRSFiPIRSF015921. FA_sphinglp_des. 1 hit.
SUPFAMiSSF55856. SSF55856. 1 hit.
PROSITEiPS50255. CYTOCHROME_B5_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95864-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKGGNQGEG AAEREVSVPT FSWEEIQKHN LRTDRWLVID RKVYNITKWS
60 70 80 90 100
IQHPGGQRVI GHYAGEDATD AFRAFHPDLE FVGKFLKPLL IGELAPEEPS
110 120 130 140 150
QDHGKNSKIT EDFRALRKTA EDMNLFKTNH VFFLLLLAHI IALESIAWFT
160 170 180 190 200
VFYFGNGWIP TLITAFVLAT SQAQAGWLQH DYGHLSVYRK PKWNHLVHKF
210 220 230 240 250
VIGHLKGASA NWWNHRHFQH HAKPNIFHKD PDVNMLHVFV LGEWQPIEYG
260 270 280 290 300
KKKLKYLPYN HQHEYFFLIG PPLLIPMYFQ YQIIMTMIVH KNWVDLAWAV
310 320 330 340 350
SYYIRFFITY IPFYGILGAL LFLNFIRFLE SHWFVWVTQM NHIVMEIDQE
360 370 380 390 400
AYRDWFSSQL TATCNVEQSF FNDWFSGHLN FQIEHHLFPT MPRHNLHKIA
410 420 430 440
PLVKSLCAKH GIEYQEKPLL RALLDIIRSL KKSGKLWLDA YLHK
Length:444
Mass (Da):52,259
Last modified:May 1, 1999 - v1
Checksum:iF65CE58076961A7A
GO
Isoform 2 (identifier: O95864-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MGKGGNQGEG...IGHYAGEDAT → MHGREAGPFV...SAGHPITGQQ

Show »
Length:422
Mass (Da):49,326
Checksum:iA4A7EB76FBF1FFA4
GO
Isoform 3 (identifier: O95864-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     386-444: HLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLKKSGKLWLDAYLHK → Q

Note: No experimental confirmation available.

Show »
Length:386
Mass (Da):45,524
Checksum:i2A18FA9CBFBFE432
GO
Isoform 4 (identifier: O95864-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MGKGGNQGEG...IGHYAGEDAT → MTREPPGCRR...HPERWATSSQ

Show »
Length:413
Mass (Da):48,883
Checksum:i3A9CD17C669AE834
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti134 – 1374LLLL → RTRG in CAB43280. (PubMed:17974005)Curated
Sequence conflicti380 – 3812NF → SL in BAB55167. (PubMed:14702039)Curated
Sequence conflicti429 – 4313SLK → DLM in CAB43280. (PubMed:17974005)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6969MGKGG…GEDAT → MHGREAGPFVCVCVLLASIP TPQTPLLQASLPPFHPASAG HPITGQQ in isoform 2. 2 PublicationsVSP_028568Add
BLAST
Alternative sequencei1 – 6969MGKGG…GEDAT → MTREPPGCRRVNSLMLYTLR SITSHRSSHPERWATSSQ in isoform 4. 1 PublicationVSP_054809Add
BLAST
Alternative sequencei386 – 44459HLFPT…AYLHK → Q in isoform 3. 1 PublicationVSP_028569Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF126799 mRNA. Translation: AAD20018.1.
AF084559 mRNA. Translation: AAG23121.1.
AF108658 mRNA. Translation: AAG43192.1.
AK027513 mRNA. Translation: BAB55167.1.
AK290291 mRNA. Translation: BAF82980.1.
AK299762 mRNA. Translation: BAH13120.1.
AK074939 mRNA. Translation: BAC11305.1.
AP002380 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW73975.1.
BC009011 mRNA. Translation: AAH09011.1.
AL050118 mRNA. Translation: CAB43280.1.
BX640945 mRNA. Translation: CAE45971.1.
CCDSiCCDS60807.1. [O95864-2]
CCDS60808.1. [O95864-4]
CCDS8012.1. [O95864-1]
PIRiT13155.
RefSeqiNP_001268430.1. NM_001281501.1. [O95864-2]
NP_001268431.1. NM_001281502.1. [O95864-4]
NP_004256.1. NM_004265.3. [O95864-1]
UniGeneiHs.502745.

Genome annotation databases

EnsembliENST00000257261; ENSP00000257261; ENSG00000134824. [O95864-2]
ENST00000278840; ENSP00000278840; ENSG00000134824. [O95864-1]
ENST00000521849; ENSP00000431091; ENSG00000134824. [O95864-3]
ENST00000522056; ENSP00000429500; ENSG00000134824. [O95864-4]
GeneIDi9415.
KEGGihsa:9415.
UCSCiuc001nsj.2. human. [O95864-2]
uc001nsk.3. human. [O95864-3]
uc001nsl.1. human. [O95864-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF126799 mRNA. Translation: AAD20018.1 .
AF084559 mRNA. Translation: AAG23121.1 .
AF108658 mRNA. Translation: AAG43192.1 .
AK027513 mRNA. Translation: BAB55167.1 .
AK290291 mRNA. Translation: BAF82980.1 .
AK299762 mRNA. Translation: BAH13120.1 .
AK074939 mRNA. Translation: BAC11305.1 .
AP002380 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW73975.1 .
BC009011 mRNA. Translation: AAH09011.1 .
AL050118 mRNA. Translation: CAB43280.1 .
BX640945 mRNA. Translation: CAE45971.1 .
CCDSi CCDS60807.1. [O95864-2 ]
CCDS60808.1. [O95864-4 ]
CCDS8012.1. [O95864-1 ]
PIRi T13155.
RefSeqi NP_001268430.1. NM_001281501.1. [O95864-2 ]
NP_001268431.1. NM_001281502.1. [O95864-4 ]
NP_004256.1. NM_004265.3. [O95864-1 ]
UniGenei Hs.502745.

3D structure databases

ProteinModelPortali O95864.
SMRi O95864. Positions 17-98.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114810. 6 interactions.
MINTi MINT-2866355.
STRINGi 9606.ENSP00000278840.

Chemistry

BindingDBi O95864.
ChEMBLi CHEMBL6097.
DrugBanki DB00132. Alpha-Linolenic Acid.

PTM databases

PhosphoSitei O95864.

Proteomic databases

MaxQBi O95864.
PaxDbi O95864.
PeptideAtlasi O95864.
PRIDEi O95864.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000257261 ; ENSP00000257261 ; ENSG00000134824 . [O95864-2 ]
ENST00000278840 ; ENSP00000278840 ; ENSG00000134824 . [O95864-1 ]
ENST00000521849 ; ENSP00000431091 ; ENSG00000134824 . [O95864-3 ]
ENST00000522056 ; ENSP00000429500 ; ENSG00000134824 . [O95864-4 ]
GeneIDi 9415.
KEGGi hsa:9415.
UCSCi uc001nsj.2. human. [O95864-2 ]
uc001nsk.3. human. [O95864-3 ]
uc001nsl.1. human. [O95864-1 ]

Organism-specific databases

CTDi 9415.
GeneCardsi GC11P061583.
HGNCi HGNC:3575. FADS2.
HPAi HPA006741.
MIMi 606149. gene.
neXtProti NX_O95864.
PharmGKBi PA27974.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5274.
GeneTreei ENSGT00510000046574.
HOVERGENi HBG002839.
InParanoidi O95864.
KOi K10226.
OMAi GHPITGQ.
PhylomeDBi O95864.
TreeFami TF313604.

Enzyme and pathway databases

UniPathwayi UPA00658 .
BioCyci MetaCyc:HS05918-MONOMER.
Reactomei REACT_121100. Linoleic acid (LA) metabolism.
REACT_121147. alpha-linolenic acid (ALA) metabolism.

Miscellaneous databases

ChiTaRSi FADS2. human.
GeneWikii FADS2.
GenomeRNAii 9415.
NextBioi 35274.
PROi O95864.
SOURCEi Search...

Gene expression databases

Bgeei O95864.
CleanExi HS_FADS2.
ExpressionAtlasi O95864. baseline and differential.
Genevestigatori O95864.

Family and domain databases

Gene3Di 3.10.120.10. 1 hit.
InterProi IPR001199. Cyt_B5-like_heme/steroid-bd.
IPR012171. Fatty_acid/sphinglp_desaturase.
IPR005804. Fatty_acid_desaturase-1.
[Graphical view ]
Pfami PF00173. Cyt-b5. 1 hit.
PF00487. FA_desaturase. 1 hit.
[Graphical view ]
PIRSFi PIRSF015921. FA_sphinglp_des. 1 hit.
SUPFAMi SSF55856. SSF55856. 1 hit.
PROSITEi PS50255. CYTOCHROME_B5_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, expression, and nutritional regulation of the mammalian Delta-6 desaturase."
    Cho H.P., Nakamura M.T., Clarke S.D.
    J. Biol. Chem. 274:471-477(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
  2. "cDNA cloning, genomic structure, and chromosomal localization of three members of the human fatty acid desaturase family."
    Marquardt A., Stoehr H., White K., Weber B.H.
    Genomics 66:175-183(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  3. Zhang J.S.S., Reddel R.R.
    Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Mesothelium.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 277-444 (ISOFORMS 1/2).
    Tissue: Tongue.
  5. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 134-444 (ISOFORMS 1/2).
    Tissue: Uterus.
  10. "The E-box like sterol regulatory element mediates the suppression of human Delta-6 desaturase gene by highly unsaturated fatty acids."
    Nara T.Y., He W.S., Tang C., Clarke S.D., Nakamura M.T.
    Biochem. Biophys. Res. Commun. 296:111-117(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  11. "Identification of the delta-6 desaturase of human sebaceous glands: expression and enzyme activity."
    Ge L., Gordon J.S., Hsuan C., Stenn K., Prouty S.M.
    J. Invest. Dermatol. 120:707-714(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  12. Erratum
    Ge L., Gordon J.S., Hsuan C., Stenn K., Prouty S.M.
    J. Invest. Dermatol. 121:434-434(2003)
  13. "Regulation of human delta-6 desaturase gene transcription: identification of a functional direct repeat-1 element."
    Tang C., Cho H.P., Nakamura M.T., Clarke S.D.
    J. Lipid Res. 44:686-695(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  14. "Expression of human delta-6-desaturase is associated with aggressiveness of human breast cancer."
    Lane J., Mansel R.E., Jiang W.G.
    Int. J. Mol. Med. 12:253-257(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiFADS2_HUMAN
AccessioniPrimary (citable) accession number: O95864
Secondary accession number(s): A8K2M6
, B7Z634, Q6MZQ7, Q96H07, Q96SV8, Q9H3G3, Q9Y3X4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: May 1, 1999
Last modified: October 29, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3