Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95864

- FADS2_HUMAN

UniProt

O95864 - FADS2_HUMAN

Protein

Fatty acid desaturase 2

Gene

FADS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3) respectively and other desaturation steps. Highly unsaturated fatty acids (HUFA) play pivotal roles in many biological functions. It catalizes as well the introduction of a cis double bond in palmitate to produce the mono-unsaturated fatty acid sapienate, the most abundant fatty acid in sebum.2 Publications

    Pathwayi

    GO - Molecular functioni

    1. heme binding Source: InterPro
    2. iron ion binding Source: InterPro
    3. stearoyl-CoA 9-desaturase activity Source: Ensembl

    GO - Biological processi

    1. alpha-linolenic acid metabolic process Source: Reactome
    2. linoleic acid metabolic process Source: Reactome
    3. small molecule metabolic process Source: Reactome
    4. unsaturated fatty acid biosynthetic process Source: ProtInc
    5. unsaturated fatty acid metabolic process Source: Reactome

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Electron transport, Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Transport

    Enzyme and pathway databases

    BioCyciMetaCyc:HS05918-MONOMER.
    ReactomeiREACT_121100. Linoleic acid (LA) metabolism.
    REACT_121147. alpha-linolenic acid (ALA) metabolism.
    UniPathwayiUPA00658.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fatty acid desaturase 2 (EC:1.14.19.-)
    Alternative name(s):
    Delta(6) fatty acid desaturase
    Short name:
    D6D
    Short name:
    Delta(6) desaturase
    Short name:
    Delta-6 desaturase
    Gene namesi
    Name:FADS2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:3575. FADS2.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: Reactome
    2. integral component of plasma membrane Source: ProtInc
    3. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27974.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 444444Fatty acid desaturase 2PRO_0000307101Add
    BLAST

    Proteomic databases

    MaxQBiO95864.
    PaxDbiO95864.
    PeptideAtlasiO95864.
    PRIDEiO95864.

    PTM databases

    PhosphoSiteiO95864.

    Expressioni

    Tissue specificityi

    Expressed in a wide array of tissues, highest expression is found in liver followed by brain, lung, heart, and retina. A lower level is found in breast tumor when compared with normal tissues; lowest levels were found in patients with poor prognostic index.3 Publications

    Developmental stagei

    Found in fetal heart.

    Inductioni

    Repressed by dietary highly unsaturated fatty acids.2 Publications

    Gene expression databases

    ArrayExpressiO95864.
    BgeeiO95864.
    CleanExiHS_FADS2.
    GenevestigatoriO95864.

    Organism-specific databases

    HPAiHPA006741.

    Interactioni

    Protein-protein interaction databases

    BioGridi114810. 4 interactions.
    MINTiMINT-2866355.
    STRINGi9606.ENSP00000278840.

    Structurei

    3D structure databases

    ProteinModelPortaliO95864.
    SMRiO95864. Positions 17-98.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 131131CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini153 – 1575LumenalSequence Analysis
    Topological domaini179 – 26486CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini286 – 30520LumenalSequence AnalysisAdd
    BLAST
    Topological domaini327 – 444118CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei132 – 15221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei158 – 17821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei265 – 28521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei306 – 32621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini18 – 9578Cytochrome b5 heme-bindingPROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi180 – 1845Histidine box-1
    Motifi217 – 2215Histidine box-2
    Motifi382 – 3865Histidine box-3

    Domaini

    The histidine box domains may contain the active site and/or be involved in metal ion binding.

    Sequence similaritiesi

    Belongs to the fatty acid desaturase family.Curated
    Contains 1 cytochrome b5 heme-binding domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5274.
    HOVERGENiHBG002839.
    InParanoidiO95864.
    KOiK10226.
    OMAiGHPITGQ.
    PhylomeDBiO95864.
    TreeFamiTF313604.

    Family and domain databases

    Gene3Di3.10.120.10. 1 hit.
    InterProiIPR001199. Cyt_B5-like_heme/steroid-bd.
    IPR012171. Fatty_acid/sphinglp_desaturase.
    IPR005804. Fatty_acid_desaturase-1.
    [Graphical view]
    PfamiPF00173. Cyt-b5. 1 hit.
    PF00487. FA_desaturase. 1 hit.
    [Graphical view]
    PIRSFiPIRSF015921. FA_sphinglp_des. 1 hit.
    SUPFAMiSSF55856. SSF55856. 1 hit.
    PROSITEiPS50255. CYTOCHROME_B5_2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95864-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGKGGNQGEG AAEREVSVPT FSWEEIQKHN LRTDRWLVID RKVYNITKWS    50
    IQHPGGQRVI GHYAGEDATD AFRAFHPDLE FVGKFLKPLL IGELAPEEPS 100
    QDHGKNSKIT EDFRALRKTA EDMNLFKTNH VFFLLLLAHI IALESIAWFT 150
    VFYFGNGWIP TLITAFVLAT SQAQAGWLQH DYGHLSVYRK PKWNHLVHKF 200
    VIGHLKGASA NWWNHRHFQH HAKPNIFHKD PDVNMLHVFV LGEWQPIEYG 250
    KKKLKYLPYN HQHEYFFLIG PPLLIPMYFQ YQIIMTMIVH KNWVDLAWAV 300
    SYYIRFFITY IPFYGILGAL LFLNFIRFLE SHWFVWVTQM NHIVMEIDQE 350
    AYRDWFSSQL TATCNVEQSF FNDWFSGHLN FQIEHHLFPT MPRHNLHKIA 400
    PLVKSLCAKH GIEYQEKPLL RALLDIIRSL KKSGKLWLDA YLHK 444
    Length:444
    Mass (Da):52,259
    Last modified:May 1, 1999 - v1
    Checksum:iF65CE58076961A7A
    GO
    Isoform 2 (identifier: O95864-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: MGKGGNQGEG...IGHYAGEDAT → MHGREAGPFV...SAGHPITGQQ

    Show »
    Length:422
    Mass (Da):49,326
    Checksum:iA4A7EB76FBF1FFA4
    GO
    Isoform 3 (identifier: O95864-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         386-444: HLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLKKSGKLWLDAYLHK → Q

    Note: No experimental confirmation available.

    Show »
    Length:386
    Mass (Da):45,524
    Checksum:i2A18FA9CBFBFE432
    GO
    Isoform 4 (identifier: O95864-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: MGKGGNQGEG...IGHYAGEDAT → MTREPPGCRR...HPERWATSSQ

    Show »
    Length:413
    Mass (Da):48,883
    Checksum:i3A9CD17C669AE834
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti134 – 1374LLLL → RTRG in CAB43280. (PubMed:17974005)Curated
    Sequence conflicti380 – 3812NF → SL in BAB55167. (PubMed:14702039)Curated
    Sequence conflicti429 – 4313SLK → DLM in CAB43280. (PubMed:17974005)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6969MGKGG…GEDAT → MHGREAGPFVCVCVLLASIP TPQTPLLQASLPPFHPASAG HPITGQQ in isoform 2. 2 PublicationsVSP_028568Add
    BLAST
    Alternative sequencei1 – 6969MGKGG…GEDAT → MTREPPGCRRVNSLMLYTLR SITSHRSSHPERWATSSQ in isoform 4. 1 PublicationVSP_054809Add
    BLAST
    Alternative sequencei386 – 44459HLFPT…AYLHK → Q in isoform 3. 1 PublicationVSP_028569Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF126799 mRNA. Translation: AAD20018.1.
    AF084559 mRNA. Translation: AAG23121.1.
    AF108658 mRNA. Translation: AAG43192.1.
    AK027513 mRNA. Translation: BAB55167.1.
    AK290291 mRNA. Translation: BAF82980.1.
    AK299762 mRNA. Translation: BAH13120.1.
    AK074939 mRNA. Translation: BAC11305.1.
    AP002380 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW73975.1.
    BC009011 mRNA. Translation: AAH09011.1.
    AL050118 mRNA. Translation: CAB43280.1.
    BX640945 mRNA. Translation: CAE45971.1.
    CCDSiCCDS60807.1. [O95864-2]
    CCDS60808.1. [O95864-4]
    CCDS8012.1. [O95864-1]
    PIRiT13155.
    RefSeqiNP_001268430.1. NM_001281501.1. [O95864-2]
    NP_001268431.1. NM_001281502.1. [O95864-4]
    NP_004256.1. NM_004265.3. [O95864-1]
    UniGeneiHs.502745.

    Genome annotation databases

    EnsembliENST00000257261; ENSP00000257261; ENSG00000134824. [O95864-2]
    ENST00000278840; ENSP00000278840; ENSG00000134824. [O95864-1]
    ENST00000521849; ENSP00000431091; ENSG00000134824. [O95864-3]
    ENST00000522056; ENSP00000429500; ENSG00000134824. [O95864-4]
    GeneIDi9415.
    KEGGihsa:9415.
    UCSCiuc001nsj.2. human. [O95864-2]
    uc001nsk.3. human. [O95864-3]
    uc001nsl.1. human. [O95864-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF126799 mRNA. Translation: AAD20018.1 .
    AF084559 mRNA. Translation: AAG23121.1 .
    AF108658 mRNA. Translation: AAG43192.1 .
    AK027513 mRNA. Translation: BAB55167.1 .
    AK290291 mRNA. Translation: BAF82980.1 .
    AK299762 mRNA. Translation: BAH13120.1 .
    AK074939 mRNA. Translation: BAC11305.1 .
    AP002380 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW73975.1 .
    BC009011 mRNA. Translation: AAH09011.1 .
    AL050118 mRNA. Translation: CAB43280.1 .
    BX640945 mRNA. Translation: CAE45971.1 .
    CCDSi CCDS60807.1. [O95864-2 ]
    CCDS60808.1. [O95864-4 ]
    CCDS8012.1. [O95864-1 ]
    PIRi T13155.
    RefSeqi NP_001268430.1. NM_001281501.1. [O95864-2 ]
    NP_001268431.1. NM_001281502.1. [O95864-4 ]
    NP_004256.1. NM_004265.3. [O95864-1 ]
    UniGenei Hs.502745.

    3D structure databases

    ProteinModelPortali O95864.
    SMRi O95864. Positions 17-98.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114810. 4 interactions.
    MINTi MINT-2866355.
    STRINGi 9606.ENSP00000278840.

    Chemistry

    BindingDBi O95864.
    ChEMBLi CHEMBL6097.
    DrugBanki DB00132. Alpha-Linolenic Acid.

    PTM databases

    PhosphoSitei O95864.

    Proteomic databases

    MaxQBi O95864.
    PaxDbi O95864.
    PeptideAtlasi O95864.
    PRIDEi O95864.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000257261 ; ENSP00000257261 ; ENSG00000134824 . [O95864-2 ]
    ENST00000278840 ; ENSP00000278840 ; ENSG00000134824 . [O95864-1 ]
    ENST00000521849 ; ENSP00000431091 ; ENSG00000134824 . [O95864-3 ]
    ENST00000522056 ; ENSP00000429500 ; ENSG00000134824 . [O95864-4 ]
    GeneIDi 9415.
    KEGGi hsa:9415.
    UCSCi uc001nsj.2. human. [O95864-2 ]
    uc001nsk.3. human. [O95864-3 ]
    uc001nsl.1. human. [O95864-1 ]

    Organism-specific databases

    CTDi 9415.
    GeneCardsi GC11P061583.
    HGNCi HGNC:3575. FADS2.
    HPAi HPA006741.
    MIMi 606149. gene.
    neXtProti NX_O95864.
    PharmGKBi PA27974.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5274.
    HOVERGENi HBG002839.
    InParanoidi O95864.
    KOi K10226.
    OMAi GHPITGQ.
    PhylomeDBi O95864.
    TreeFami TF313604.

    Enzyme and pathway databases

    UniPathwayi UPA00658 .
    BioCyci MetaCyc:HS05918-MONOMER.
    Reactomei REACT_121100. Linoleic acid (LA) metabolism.
    REACT_121147. alpha-linolenic acid (ALA) metabolism.

    Miscellaneous databases

    ChiTaRSi FADS2. human.
    GeneWikii FADS2.
    GenomeRNAii 9415.
    NextBioi 35274.
    PROi O95864.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95864.
    Bgeei O95864.
    CleanExi HS_FADS2.
    Genevestigatori O95864.

    Family and domain databases

    Gene3Di 3.10.120.10. 1 hit.
    InterProi IPR001199. Cyt_B5-like_heme/steroid-bd.
    IPR012171. Fatty_acid/sphinglp_desaturase.
    IPR005804. Fatty_acid_desaturase-1.
    [Graphical view ]
    Pfami PF00173. Cyt-b5. 1 hit.
    PF00487. FA_desaturase. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF015921. FA_sphinglp_des. 1 hit.
    SUPFAMi SSF55856. SSF55856. 1 hit.
    PROSITEi PS50255. CYTOCHROME_B5_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, expression, and nutritional regulation of the mammalian Delta-6 desaturase."
      Cho H.P., Nakamura M.T., Clarke S.D.
      J. Biol. Chem. 274:471-477(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
    2. "cDNA cloning, genomic structure, and chromosomal localization of three members of the human fatty acid desaturase family."
      Marquardt A., Stoehr H., White K., Weber B.H.
      Genomics 66:175-183(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    3. Zhang J.S.S., Reddel R.R.
      Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Mesothelium.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 277-444 (ISOFORMS 1/2).
      Tissue: Tongue.
    5. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
      Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
      , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
      DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 134-444 (ISOFORMS 1/2).
      Tissue: Uterus.
    10. "The E-box like sterol regulatory element mediates the suppression of human Delta-6 desaturase gene by highly unsaturated fatty acids."
      Nara T.Y., He W.S., Tang C., Clarke S.D., Nakamura M.T.
      Biochem. Biophys. Res. Commun. 296:111-117(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    11. "Identification of the delta-6 desaturase of human sebaceous glands: expression and enzyme activity."
      Ge L., Gordon J.S., Hsuan C., Stenn K., Prouty S.M.
      J. Invest. Dermatol. 120:707-714(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    12. Erratum
      Ge L., Gordon J.S., Hsuan C., Stenn K., Prouty S.M.
      J. Invest. Dermatol. 121:434-434(2003)
    13. "Regulation of human delta-6 desaturase gene transcription: identification of a functional direct repeat-1 element."
      Tang C., Cho H.P., Nakamura M.T., Clarke S.D.
      J. Lipid Res. 44:686-695(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    14. "Expression of human delta-6-desaturase is associated with aggressiveness of human breast cancer."
      Lane J., Mansel R.E., Jiang W.G.
      Int. J. Mol. Med. 12:253-257(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiFADS2_HUMAN
    AccessioniPrimary (citable) accession number: O95864
    Secondary accession number(s): A8K2M6
    , B7Z634, Q6MZQ7, Q96H07, Q96SV8, Q9H3G3, Q9Y3X4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 2, 2007
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 115 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3