O95864 (FADS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fatty acid desaturase 2 EC=1.14.19.- Alternative name(s): Delta(6) fatty acid desaturase Short name=D6D Short name=Delta(6) desaturase Short name=Delta-6 desaturase | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 444 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleic acid (GLA) (18:3n-6) and stearidonic acid (18:4n-3) respectively and other desaturation steps. Highly unsaturated fatty acids (HUFA) play pivotal roles in many biological functions. It catalizes as well the introduction of a cis double bond in palmitate to produce the mono-unsaturated fatty acid sapienate, the most abundant fatty acid in sebum. Ref.1 Ref.10 |
| Pathway | |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein Potential. |
| Tissue specificity | Expressed in a wide array of tissues, highest expression is found in liver followed by brain, lung, heart, and retina. A lower level is found in breast tumor when compared with normal tissues; lowest levels were found in patients with poor prognostic index. Ref.1 Ref.2 Ref.13 |
| Developmental stage | Found in fetal heart. |
| Induction | Repressed by dietary highly unsaturated fatty acids. Ref.9 Ref.12 |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Sequence similarities | Belongs to the fatty acid desaturase family. Contains 1 cytochrome b5 heme-binding domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Electron transport Fatty acid biosynthesis Lipid synthesis Transport |
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Oxidoreductase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | electron transport chain Inferred from electronic annotation. Source: UniProtKB-KW transportInferred from electronic annotation. Source: UniProtKB-KW unsaturated fatty acid biosynthetic processTraceable author statement. Source: ProtInc |
| Cellular component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneTraceable author statement. Source: ProtInc membrane fractionTraceable author statement. Source: ProtInc |
| Molecular function | heme binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95864-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95864-2) The sequence of this isoform differs from the canonical sequence as follows: 1-69: MGKGGNQGEG...IGHYAGEDAT → MHGREAGPFV...SAGHPITGQQ | ||||||
| Isoform 3 (identifier: O95864-3) The sequence of this isoform differs from the canonical sequence as follows: 386-444: HLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLKKSGKLWLDAYLHK → Q | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 444 | 444 | Fatty acid desaturase 2 | PRO_0000307101 | |||||
Regions | |||||||||
| Topological domain | 1 – 131 | 131 | Cytoplasmic Potential | ||||||
| Transmembrane | 132 – 152 | 21 | Helical; Potential | ||||||
| Topological domain | 153 – 157 | 5 | Lumenal Potential | ||||||
| Transmembrane | 158 – 178 | 21 | Helical; Potential | ||||||
| Topological domain | 179 – 264 | 86 | Cytoplasmic Potential | ||||||
| Transmembrane | 265 – 285 | 21 | Helical; Potential | ||||||
| Topological domain | 286 – 305 | 20 | Lumenal Potential | ||||||
| Transmembrane | 306 – 326 | 21 | Helical; Potential | ||||||
| Topological domain | 327 – 444 | 118 | Cytoplasmic Potential | ||||||
| Domain | 18 – 95 | 78 | Cytochrome b5 heme-binding | ||||||
| Motif | 180 – 184 | 5 | Histidine box-1 | ||||||
| Motif | 217 – 221 | 5 | Histidine box-2 | ||||||
| Motif | 382 – 386 | 5 | Histidine box-3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 69 | 69 | MGKGG…GEDAT → MHGREAGPFVCVCVLLASIP TPQTPLLQASLPPFHPASAG HPITGQQ in isoform 2. | VSP_028568 | |||||
| Alternative sequence | 386 – 444 | 59 | HLFPT…AYLHK → Q in isoform 3. | VSP_028569 | |||||
Experimental info | |||||||||
| Sequence conflict | 134 – 137 | 4 | LLLL → RTRG in CAB43280. Ref.8 | ||||||
| Sequence conflict | 380 – 381 | 2 | NF → SL in BAB55167. Ref.4 | ||||||
| Sequence conflict | 429 – 431 | 3 | SLK → DLM in CAB43280. Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, expression, and nutritional regulation of the mammalian Delta-6 desaturase." Cho H.P., Nakamura M.T., Clarke S.D. J. Biol. Chem. 274:471-477(1999) [PubMed: 9867867] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "cDNA cloning, genomic structure, and chromosomal localization of three members of the human fatty acid desaturase family." Marquardt A., Stoehr H., White K., Weber B.H. Genomics 66:175-183(2000) [PubMed: 10860662] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [3] | Zhang J.S.S., Reddel R.R. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Mesothelium. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 277-444 (ISOFORMS 1/2). Tissue: Tongue. |
| [5] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed: 16303743] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [8] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 134-444 (ISOFORMS 1/2). Tissue: Uterus. |
| [9] | "The E-box like sterol regulatory element mediates the suppression of human Delta-6 desaturase gene by highly unsaturated fatty acids." Nara T.Y., He W.S., Tang C., Clarke S.D., Nakamura M.T. Biochem. Biophys. Res. Commun. 296:111-117(2002) [PubMed: 12147235] [Abstract] Cited for: INDUCTION. |
| [10] | "Identification of the delta-6 desaturase of human sebaceous glands: expression and enzyme activity." Ge L., Gordon J.S., Hsuan C., Stenn K., Prouty S.M. J. Invest. Dermatol. 120:707-714(2003) [PubMed: 12713571] [Abstract] Cited for: FUNCTION. |
| [11] | Erratum Ge L., Gordon J.S., Hsuan C., Stenn K., Prouty S.M. J. Invest. Dermatol. 121:434-434(2003) |
| [12] | "Regulation of human delta-6 desaturase gene transcription: identification of a functional direct repeat-1 element." Tang C., Cho H.P., Nakamura M.T., Clarke S.D. J. Lipid Res. 44:686-695(2003) [PubMed: 12562861] [Abstract] Cited for: INDUCTION. |
| [13] | "Expression of human delta-6-desaturase is associated with aggressiveness of human breast cancer." Lane J., Mansel R.E., Jiang W.G. Int. J. Mol. Med. 12:253-257(2003) [PubMed: 12851727] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF126799 mRNA. Translation: AAD20018.1. AF084559 mRNA. Translation: AAG23121.1. AF108658 mRNA. Translation: AAG43192.1. AK027513 mRNA. Translation: BAB55167.1. AK290291 mRNA. Translation: BAF82980.1. AK074939 mRNA. Translation: BAC11305.1. CH471076 Genomic DNA. Translation: EAW73975.1. BC009011 mRNA. Translation: AAH09011.1. AL050118 mRNA. Translation: CAB43280.1. BX640945 mRNA. Translation: CAE45971.1. |
| IPI | IPI00023484. IPI00183786. IPI00867558. |
| PIR | T13155. |
| RefSeq | NP_004256.1. NM_004265.2. |
| UniGene | Hs.502745. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1SH4 based on UniProtKB P00171. |
| ProteinModelPortal | O95864. |
| SMR | O95864. Positions 12-99. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-2866355. |
| STRING | O95864. |
Proteomic databases | |
| PeptideAtlas | O95864. |
| PRIDE | O95864. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000278840; ENSP00000278840; ENSG00000134824. |
| GeneID | 9415. |
| KEGG | hsa:9415. |
| NMPDR | fig|9606.3.peg.5827. |
| UCSC | uc001nsj.2. human. uc001nsk.2. human. uc001nsl.1. human. |
Organism-specific databases | |
| CTD | 9415. |
| GeneCards | GC11P061583. |
| H-InvDB | HIX0009701. |
| HGNC | HGNC:3575. FADS2. |
| HPA | HPA006741. |
| MIM | 606149. gene. |
| neXtProt | NX_O95864. |
| PharmGKB | PA27974. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG07192. |
| GeneTree | ENSGT00510000046574. |
| HOGENOM | HBG283658. |
| HOVERGEN | HBG002839. |
| InParanoid | O95864. |
| OMA | WIPTVIT. |
| PhylomeDB | O95864. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:ENSG00000134824-MONOMER. MetaCyc:HS05918-MONOMER. |
Gene expression databases | |
| ArrayExpress | O95864. |
| Bgee | O95864. |
| CleanEx | HS_FADS2. |
| Genevestigator | O95864. |
Family and domain databases | |
| InterPro | IPR001199. Cyt_B5. IPR012171. Fatty_acid/sphinglp_desaturase. IPR005804. Fatty_acid_desaturase-1. [Graphical view] |
| Gene3D | G3DSA:3.10.120.10. Cyt_B5. 1 hit. |
| KO | K10226. |
| Pfam | PF00173. Cyt-b5. 1 hit. PF00487. FA_desaturase. 1 hit. [Graphical view] |
| PIRSF | PIRSF015921. FA_sphinglp_des. 1 hit. |
| SUPFAM | SSF55856. Cyt_B5. 1 hit. |
| PROSITE | PS00191. CYTOCHROME_B5_1. False negative. PS50255. CYTOCHROME_B5_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00132. Alpha-Linolenic Acid. |
| NextBio | 35274. |
| SOURCE | Search... |
Entry information
| Entry name | FADS2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95864 Secondary accession number(s): A8K2M6 Q9Y3X4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with