Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

3'(2'),5'-bisphosphate nucleotidase 1

Gene

BPNT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins1P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.1 Publication

Catalytic activityi

Adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate.

Cofactori

Enzyme regulationi

Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol 1,4-bisphosphate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi74Magnesium 11
Binding sitei74SubstrateBy similarity1
Metal bindingi117Magnesium 11
Metal bindingi117Magnesium 21
Metal bindingi119Magnesium 1; via carbonyl oxygen1
Metal bindingi120Magnesium 21
Metal bindingi247Magnesium 21
Binding sitei247Substrate1

GO - Molecular functioni

GO - Biological processi

  • 3'-phosphoadenosine 5'-phosphosulfate metabolic process Source: Reactome
  • nervous system development Source: ProtInc
  • nucleobase-containing compound metabolic process Source: ProtInc
  • phosphatidylinositol phosphorylation Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Lithium, Magnesium, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:HS08743-MONOMER.
BRENDAi3.1.3.7. 2681.
ReactomeiR-HSA-156584. Cytosolic sulfonation of small molecules.

Names & Taxonomyi

Protein namesi
Recommended name:
3'(2'),5'-bisphosphate nucleotidase 1 (EC:3.1.3.7)
Alternative name(s):
Bisphosphate 3'-nucleotidase 1
PAP-inositol 1,4-phosphatase
Short name:
PIP
Gene namesi
Name:BPNT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:1096. BPNT1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: GO_Central
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi10380.
OpenTargetsiENSG00000162813.
PharmGKBiPA25407.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001425272 – 3083'(2'),5'-bisphosphate nucleotidase 1Add BLAST307

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei122PhosphothreonineCombined sources1
Modified residuei240PhosphoserineCombined sources1
Modified residuei244N6-succinyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO95861.
PaxDbiO95861.
PeptideAtlasiO95861.
PRIDEiO95861.

2D gel databases

REPRODUCTION-2DPAGEIPI00410214.

PTM databases

DEPODiO95861.
iPTMnetiO95861.
PhosphoSitePlusiO95861.

Expressioni

Tissue specificityi

Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000162813.
CleanExiHS_BPNT1.
ExpressionAtlasiO95861. baseline and differential.
GenevisibleiO95861. HS.

Organism-specific databases

HPAiHPA048461.

Interactioni

Protein-protein interaction databases

BioGridi115653. 55 interactors.
IntActiO95861. 3 interactors.
MINTiMINT-5002343.
STRINGi9606.ENSP00000318852.

Structurei

Secondary structure

1308
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi7 – 32Combined sources26
Beta strandi38 – 42Combined sources5
Beta strandi45 – 47Combined sources3
Helixi49 – 65Combined sources17
Beta strandi70 – 75Combined sources6
Helixi84 – 86Combined sources3
Helixi93 – 96Combined sources4
Helixi102 – 104Combined sources3
Helixi109 – 111Combined sources3
Beta strandi112 – 120Combined sources9
Helixi122 – 126Combined sources5
Helixi130 – 132Combined sources3
Beta strandi134 – 141Combined sources8
Beta strandi144 – 152Combined sources9
Turni153 – 158Combined sources6
Beta strandi167 – 172Combined sources6
Turni173 – 175Combined sources3
Beta strandi176 – 180Combined sources5
Beta strandi191 – 194Combined sources4
Beta strandi196 – 198Combined sources3
Helixi201 – 208Combined sources8
Beta strandi213 – 217Combined sources5
Helixi221 – 229Combined sources9
Beta strandi234 – 238Combined sources5
Helixi245 – 257Combined sources13
Beta strandi261 – 263Combined sources3
Beta strandi284 – 289Combined sources6
Helixi291 – 295Combined sources5
Helixi300 – 305Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WEFX-ray1.80A6-308[»]
ProteinModelPortaliO95861.
SMRiO95861.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95861.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni119 – 122Substrate binding4
Regioni195 – 198Substrate binding4

Sequence similaritiesi

Belongs to the inositol monophosphatase family.Curated

Phylogenomic databases

eggNOGiKOG3099. Eukaryota.
ENOG410XNMV. LUCA.
GeneTreeiENSGT00530000063462.
HOGENOMiHOG000293205.
HOVERGENiHBG050719.
KOiK01082.
OMAiEEELVVW.
OrthoDBiEOG091G0CFP.
PhylomeDBiO95861.
TreeFamiTF314300.

Family and domain databases

InterProiIPR020583. Inositol_monoP_metal-BS.
IPR000760. Inositol_monophosphatase-like.
IPR020550. Inositol_monophosphatase_CS.
[Graphical view]
PANTHERiPTHR20854. PTHR20854. 1 hit.
PfamiPF00459. Inositol_P. 1 hit.
[Graphical view]
PROSITEiPS00629. IMP_1. 1 hit.
PS00630. IMP_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95861-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSNTVLMR LVASAYSIAQ KAGMIVRRVI AEGDLGIVEK TCATDLQTKA
60 70 80 90 100
DRLAQMSICS SLARKFPKLT IIGEEDLPSE EVDQELIEDS QWEEILKQPC
110 120 130 140 150
PSQYSAIKEE DLVVWVDPLD GTKEYTEGLL DNVTVLIGIA YEGKAIAGVI
160 170 180 190 200
NQPYYNYEAG PDAVLGRTIW GVLGLGAFGF QLKEVPAGKH IITTTRSHSN
210 220 230 240 250
KLVTDCVAAM NPDAVLRVGG AGNKIIQLIE GKASAYVFAS PGCKKWDTCA
260 270 280 290 300
PEVILHAVGG KLTDIHGNVL QYHKDVKHMN SAGVLATLRN YDYYASRVPE

SIKNALVP
Length:308
Mass (Da):33,392
Last modified:May 1, 1999 - v1
Checksum:iA5952F5E31C8CFCB
GO
Isoform 2 (identifier: O95861-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     277-308: KHMNSAGVLATLRNYDYYASRVPESIKNALVP → SHRTWPKPDF...VIIYAYETDL

Note: No experimental confirmation available.
Show »
Length:325
Mass (Da):35,744
Checksum:i87527CD609009E68
GO
Isoform 3 (identifier: O95861-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:253
Mass (Da):27,543
Checksum:i6253BEF5F96A25E1
GO
Isoform 4 (identifier: O95861-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-111: Missing.

Show »
Length:272
Mass (Da):29,189
Checksum:iFC6456F98BDED5AC
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti221A → V in AAH17801 (PubMed:15489334).Curated1
Sequence conflicti260G → S in CAB65115 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0548071 – 55Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_05480876 – 111Missing in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_009937277 – 308KHMNS…NALVP → SHRTWPKPDFFRAQFFLESH SCFSRNFKNVSTPIKNIYDV IIYAYETDL in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF125042 mRNA. Translation: AAD17329.1.
AJ249339 mRNA. Translation: CAB65115.1.
AK291943 mRNA. Translation: BAF84632.1.
AK298476 mRNA. Translation: BAG60687.1.
AK300777 mRNA. Translation: BAG62441.1.
AC103590 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93306.1.
CH471100 Genomic DNA. Translation: EAW93308.1.
BC017801 mRNA. Translation: AAH17801.1.
CCDSiCCDS41469.1. [O95861-1]
CCDS65787.1. [O95861-3]
CCDS65788.1. [O95861-4]
RefSeqiNP_001273078.1. NM_001286149.1. [O95861-3]
NP_001273079.1. NM_001286150.1. [O95861-4]
NP_001273080.1. NM_001286151.1. [O95861-3]
NP_006076.4. NM_006085.5. [O95861-1]
XP_005273057.1. XM_005273000.4. [O95861-1]
XP_016855532.1. XM_017000043.1. [O95861-4]
UniGeneiHs.406134.

Genome annotation databases

EnsembliENST00000322067; ENSP00000318852; ENSG00000162813. [O95861-1]
ENST00000414869; ENSP00000410348; ENSG00000162813. [O95861-4]
ENST00000469520; ENSP00000446828; ENSG00000162813. [O95861-1]
ENST00000544404; ENSP00000444398; ENSG00000162813. [O95861-3]
GeneIDi10380.
KEGGihsa:10380.
UCSCiuc010puh.3. human. [O95861-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF125042 mRNA. Translation: AAD17329.1.
AJ249339 mRNA. Translation: CAB65115.1.
AK291943 mRNA. Translation: BAF84632.1.
AK298476 mRNA. Translation: BAG60687.1.
AK300777 mRNA. Translation: BAG62441.1.
AC103590 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93306.1.
CH471100 Genomic DNA. Translation: EAW93308.1.
BC017801 mRNA. Translation: AAH17801.1.
CCDSiCCDS41469.1. [O95861-1]
CCDS65787.1. [O95861-3]
CCDS65788.1. [O95861-4]
RefSeqiNP_001273078.1. NM_001286149.1. [O95861-3]
NP_001273079.1. NM_001286150.1. [O95861-4]
NP_001273080.1. NM_001286151.1. [O95861-3]
NP_006076.4. NM_006085.5. [O95861-1]
XP_005273057.1. XM_005273000.4. [O95861-1]
XP_016855532.1. XM_017000043.1. [O95861-4]
UniGeneiHs.406134.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WEFX-ray1.80A6-308[»]
ProteinModelPortaliO95861.
SMRiO95861.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115653. 55 interactors.
IntActiO95861. 3 interactors.
MINTiMINT-5002343.
STRINGi9606.ENSP00000318852.

PTM databases

DEPODiO95861.
iPTMnetiO95861.
PhosphoSitePlusiO95861.

2D gel databases

REPRODUCTION-2DPAGEIPI00410214.

Proteomic databases

EPDiO95861.
PaxDbiO95861.
PeptideAtlasiO95861.
PRIDEiO95861.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000322067; ENSP00000318852; ENSG00000162813. [O95861-1]
ENST00000414869; ENSP00000410348; ENSG00000162813. [O95861-4]
ENST00000469520; ENSP00000446828; ENSG00000162813. [O95861-1]
ENST00000544404; ENSP00000444398; ENSG00000162813. [O95861-3]
GeneIDi10380.
KEGGihsa:10380.
UCSCiuc010puh.3. human. [O95861-1]

Organism-specific databases

CTDi10380.
DisGeNETi10380.
GeneCardsiBPNT1.
H-InvDBHIX0001601.
HGNCiHGNC:1096. BPNT1.
HPAiHPA048461.
MIMi604053. gene.
neXtProtiNX_O95861.
OpenTargetsiENSG00000162813.
PharmGKBiPA25407.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3099. Eukaryota.
ENOG410XNMV. LUCA.
GeneTreeiENSGT00530000063462.
HOGENOMiHOG000293205.
HOVERGENiHBG050719.
KOiK01082.
OMAiEEELVVW.
OrthoDBiEOG091G0CFP.
PhylomeDBiO95861.
TreeFamiTF314300.

Enzyme and pathway databases

BioCyciZFISH:HS08743-MONOMER.
BRENDAi3.1.3.7. 2681.
ReactomeiR-HSA-156584. Cytosolic sulfonation of small molecules.

Miscellaneous databases

EvolutionaryTraceiO95861.
GenomeRNAii10380.
PROiO95861.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162813.
CleanExiHS_BPNT1.
ExpressionAtlasiO95861. baseline and differential.
GenevisibleiO95861. HS.

Family and domain databases

InterProiIPR020583. Inositol_monoP_metal-BS.
IPR000760. Inositol_monophosphatase-like.
IPR020550. Inositol_monophosphatase_CS.
[Graphical view]
PANTHERiPTHR20854. PTHR20854. 1 hit.
PfamiPF00459. Inositol_P. 1 hit.
[Graphical view]
PROSITEiPS00629. IMP_1. 1 hit.
PS00630. IMP_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBPNT1_HUMAN
AccessioniPrimary (citable) accession number: O95861
Secondary accession number(s): A8K7C8
, B4DPS5, B4DUS9, D3DTA9, Q8WVL5, Q9UGJ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: May 1, 1999
Last modified: November 30, 2016
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.