O95861 (BPNT1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 3'(2'),5'-bisphosphate nucleotidase 1 EC=3.1.3.7 Alternative name(s): Bisphosphate 3'-nucleotidase 1 PAP-inositol 1,4-phosphatase Short name=PIP | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 308 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins1P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6. Ref.1 |
| Catalytic activity | Adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate. |
| Cofactor | Magnesium. |
| Enzyme regulation | Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol 1,4-bisphosphate. Ref.1 |
| Tissue specificity | Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle. Ref.1 |
| Sequence similarities | Belongs to the inositol monophosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Lithium Magnesium Metal-binding |
| Molecular function | Hydrolase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | 3'-phosphoadenosine 5'-phosphosulfate metabolic process Traceable author statement. Source: Reactome nervous system developmentTraceable author statement Ref.1. Source: ProtInc phosphatidylinositol phosphorylationInferred from electronic annotation. Source: InterPro xenobiotic metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | 3'(2'),5'-bisphosphate nucleotidase activity Traceable author statement Ref.1. Source: ProtInc inositol-1,4-bisphosphate 1-phosphatase activityInferred from electronic annotation. Source: Compara magnesium ion bindingInferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95861-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95861-2) The sequence of this isoform differs from the canonical sequence as follows: 277-308: KHMNSAGVLATLRNYDYYASRVPESIKNALVP → SHRTWPKPDF...VIIYAYETDL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 308 | 307 | 3'(2'),5'-bisphosphate nucleotidase 1 | PRO_0000142527 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 119 – 122 | 4 | Substrate binding | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 195 – 198 | 4 | Substrate binding | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 74 | 1 | Magnesium 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 117 | 1 | Magnesium 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 117 | 1 | Magnesium 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 119 | 1 | Magnesium 1; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 120 | 1 | Magnesium 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 247 | 1 | Magnesium 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 74 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 247 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 277 – 308 | 32 | KHMNS…NALVP → SHRTWPKPDFFRAQFFLESH SCFSRNFKNVSTPIKNIYDV IIYAYETDL in isoform 2. | VSP_009937 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 221 | 1 | A → V in AAH17801. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 260 | 1 | G → S in CAB65115. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 7 – 32 | 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 38 – 42 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 45 – 47 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 49 – 65 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 75 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 84 – 86 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 93 – 96 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 102 – 104 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 111 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 112 – 120 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 122 – 126 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 130 – 132 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 141 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 144 – 152 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 153 – 158 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 167 – 172 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 173 – 175 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 176 – 180 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 191 – 194 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 196 – 198 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 201 – 208 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 213 – 217 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 221 – 229 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 234 – 238 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 245 – 257 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 261 – 263 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 289 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 291 – 295 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 300 – 305 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a mammalian lithium-sensitive bisphosphate 3'-nucleotidase inhibited by inositol 1,4-bisphosphate." Spiegelberg B.D., Xiong J.-P., Smith J.J., Gu R.F., York J.D. J. Biol. Chem. 274:13619-13628(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, ENZYME REGULATION, TISSUE SPECIFICITY. |
| [2] | "Hydrolysis of inositol-1,4-bisphosphate by human and yeast lithium sensitive 3'-phosphoadenosine 5'-phosphate nucleotidases." Yenush L., Gil-Mascarell M., Serrano R., Rodriguez P.L. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: B-cell. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skeletal muscle. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1) in complex with AMP, PO4 and magnesium." Structural genomics consortium (SGC) Submitted (APR-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 6-308 IN COMPLEX WITH MAGNESIUM IONS AND AMP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF125042 mRNA. Translation: AAD17329.1. AJ249339 mRNA. Translation: CAB65115.1. AK291943 mRNA. Translation: BAF84632.1. CH471100 Genomic DNA. Translation: EAW93306.1. CH471100 Genomic DNA. Translation: EAW93308.1. BC017801 mRNA. Translation: AAH17801.1. | ||||||||||||
| IPI | IPI00410214. IPI00410215. | ||||||||||||
| RefSeq | NP_006076.4. NM_006085.4. | ||||||||||||
| UniGene | Hs.406134. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O95861. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O95861. 1 interaction. | ||||||||||||
| STRING | 9606.ENSP00000318852. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O95861. | ||||||||||||
2D gel databases | |||||||||||||
| REPRODUCTION-2DPAGE | IPI00410214. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O95861. | ||||||||||||
| PRIDE | O95861. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000322067; ENSP00000318852; ENSG00000162813. ENST00000469520; ENSP00000446828; ENSG00000162813. | ||||||||||||
| GeneID | 10380. | ||||||||||||
| KEGG | hsa:10380. | ||||||||||||
| UCSC | uc001hma.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10380. | ||||||||||||
| GeneCards | GC01M220230. | ||||||||||||
| H-InvDB | HIX0001601. | ||||||||||||
| HGNC | HGNC:1096. BPNT1. | ||||||||||||
| HPA | HPA048461. | ||||||||||||
| MIM | 604053. gene. | ||||||||||||
| neXtProt | NX_O95861. | ||||||||||||
| PharmGKB | PA25407. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0483. | ||||||||||||
| HOGENOM | HOG000293205. | ||||||||||||
| HOVERGEN | HBG050719. | ||||||||||||
| KO | K01082. | ||||||||||||
| OMA | AHAYVFA. | ||||||||||||
| OrthoDB | EOG4GXFND. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 3.1.3.7. 2681. | ||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O95861. | ||||||||||||
| Bgee | O95861. | ||||||||||||
| CleanEx | HS_BPNT1. | ||||||||||||
| Genevestigator | O95861. | ||||||||||||
| GermOnline | ENSG00000162813. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR020583. Inositol_monoP_metal-BS. IPR000760. Inositol_monophosphatase. IPR020550. Inositol_monophosphatase_CS. [Graphical view] | ||||||||||||
| PANTHER | PTHR20854. PTHR20854. 1 hit. | ||||||||||||
| Pfam | PF00459. Inositol_P. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00629. IMP_1. 1 hit. PS00630. IMP_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | O95861. | ||||||||||||
| GenomeRNAi | 10380. | ||||||||||||
| NextBio | 39323. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | BPNT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95861 Secondary accession number(s): A8K7C8 Q9UGJ3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
