Reviewed,
UniProtKB/Swiss-Prot O95861 (BPNT1_HUMAN)
Last modified
June 16, 2009.
Version 69.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 3'(2'),5'-bisphosphate nucleotidase 1 EC=3.1.3.7 Alternative name(s): Bisphosphate 3'-nucleotidase 1 PAP-inositol-1,4-phosphatase Short name=PIP | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 308 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins1P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6. Ref.1 |
| Catalytic activity | Adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate. |
| Cofactor | Magnesium. |
| Enzyme regulation | Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol 1,4-bisphosphate. Ref.1 |
| Tissue specificity | Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle. Ref.1 |
| Sequence similarities | Belongs to the inositol monophosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Lithium Magnesium Metal-binding |
| Molecular function | Hydrolase |
| PTM | Acetylation |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | nervous system development Ref.1 Traceable author statement. Source: ProtInc nucleobase, nucleoside, nucleotide and nucleic acid metabolic process Ref.1Traceable author statement. Source: ProtInc |
| Cellular component | cytosol Ref.1 Inferred from Experiment. Source: Reactome |
| Molecular function | 3'(2'),5'-bisphosphate nucleotidase activity Ref.1 Inferred from Experiment. Source: Reactome inositol or phosphatidylinositol phosphatase activityInferred from electronic annotation. Source: InterPro lithium ion bindingInferred from electronic annotation. Source: UniProtKB-KW magnesium ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95861-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95861-2) The sequence of this isoform differs from the canonical sequence as follows: 277-308: KHMNSAGVLATLRNYDYYASRVPESIKNALVP → SHRTWPKPDF...VIIYAYETDL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 308 | 307 | 3'(2'),5'-bisphosphate nucleotidase 1 | PRO_0000142527 | |||||
Regions | |||||||||
| Region | 195 – 198 | 4 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Metal binding | 74 | 1 | Magnesium 1 By similarity | ||||||
| Metal binding | 117 | 1 | Magnesium 1 By similarity | ||||||
| Metal binding | 117 | 1 | Magnesium 2 By similarity | ||||||
| Metal binding | 119 | 1 | Magnesium 1; via carbonyl oxygen By similarity | ||||||
| Metal binding | 120 | 1 | Magnesium 2 By similarity | ||||||
| Metal binding | 247 | 1 | Magnesium 2 By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 277 – 308 | 32 | KHMNS…NALVP → SHRTWPKPDFFRAQFFLESH SCFSRNFKNVSTPIKNIYDV IIYAYETDL in isoform 2. | VSP_009937 | |||||
Experimental info | |||||||||
| Sequence conflict | 221 | 1 | A → V in AAH17801. Ref.3 | ||||||
| Sequence conflict | 260 | 1 | G → S in CAB65115. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a mammalian lithium-sensitive bisphosphate 3'-nucleotidase inhibited by inositol 1,4-bisphosphate." Spiegelberg B.D., Xiong J.-P., Smith J.J., Gu R.F., York J.D. J. Biol. Chem. 274:13619-13628(1999) [PubMed: 10224133] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, ENZYME REGULATION, TISSUE SPECIFICITY. |
| [2] | "Hydrolysis of inositol-1,4-bisphosphate by human and yeast lithium sensitive 3'-phosphoadenosine 5'-phosphate nucleotidases." Yenush L., Gil-Mascarell M., Serrano R., Rodriguez P.L. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: B-cell. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skeletal muscle. |
| [4] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF125042 mRNA. Translation: AAD17329.1. AJ249339 mRNA. Translation: CAB65115.1. BC017801 mRNA. Translation: AAH17801.1. | |||||||||||||
| IPI | IPI00410214. IPI00410215. | ||||||||||||
| RefSeq | NP_006076.4. | ||||||||||||
| UniGene | Hs.406134 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | O95861. Positions 5-308. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O95861. 2 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O95861. | ||||||||||||
2-D gel databases | |||||||||||||
| REPRODUCTION-2DPAGE | IPI00410214. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O95861. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000162813. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 10380. | ||||||||||||
| KEGG | hsa:10380. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC01M218297. | ||||||||||||
| H-InvDB | HIX0001601. HIX0044973. | ||||||||||||
| HGNC | HGNC:1096. BPNT1. | ||||||||||||
| MIM | 604053. gene. | ||||||||||||
| PharmGKB | PA25407. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | O95861. | ||||||||||||
| OMA | O95861. GFQLKEA. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 3.1.3.7. 247. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O95861. | ||||||||||||
| Bgee | O95861. | ||||||||||||
| CleanEx | HS_BPNT1. | ||||||||||||
| GermOnline | ENSG00000162813. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000760. Inositol_P. [Graphical view] | ||||||||||||
| PANTHER | PTHR20854. Inositol_P. 1 hit. | ||||||||||||
| Pfam | PF00459. Inositol_P. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00378. INOSPHPHTASE. | ||||||||||||
| ProDom | PD023420. Inositol_P. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||
| PROSITE | PS00629. IMP_1. 1 hit. PS00630. IMP_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 39323. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | BPNT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95861 Secondary accession number(s): Q8WVL5, Q9UGJ3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


