Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Copine-6

Gene

CPNE6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties. May have a role in synaptic plasticity (By similarity).By similarity

GO - Molecular functioni

  1. calcium ion binding Source: ProtInc
  2. phosphatidylserine binding Source: Ensembl
  3. transporter activity Source: ProtInc

GO - Biological processi

  1. lipid metabolic process Source: ProtInc
  2. nervous system development Source: ProtInc
  3. synaptic transmission Source: ProtInc
  4. vesicle-mediated transport Source: ProtInc
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Copine-6
Alternative name(s):
Copine VI
Neuronal-copine
Short name:
N-copine
Gene namesi
Name:CPNE6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:2319. CPNE6.

Subcellular locationi

GO - Cellular componenti

  1. axon Source: Ensembl
  2. dendrite Source: Ensembl
  3. extracellular vesicular exosome Source: UniProtKB
  4. membrane Source: Ensembl
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26836.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 557557Copine-6PRO_0000144845Add
BLAST

Proteomic databases

PaxDbiO95741.
PeptideAtlasiO95741.
PRIDEiO95741.

PTM databases

PhosphoSiteiO95741.

Expressioni

Gene expression databases

BgeeiO95741.
CleanExiHS_CPNE6.
ExpressionAtlasiO95741. baseline and differential.
GenevestigatoriO95741.

Organism-specific databases

HPAiHPA031636.

Interactioni

Protein-protein interaction databases

BioGridi114763. 11 interactions.
IntActiO95741. 10 interactions.
MINTiMINT-1419837.

Structurei

3D structure databases

ProteinModelPortaliO95741.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 11188C2 1PROSITE-ProRule annotationAdd
BLAST
Domaini138 – 243106C2 2PROSITE-ProRule annotationAdd
BLAST
Domaini306 – 526221VWFAPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the copine family.Curated
Contains 2 C2 domains.PROSITE-ProRule annotation
Contains 1 VWFA domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG240062.
GeneTreeiENSGT00760000119085.
HOVERGENiHBG066841.
InParanoidiO95741.
OMAiDMSDPEM.
OrthoDBiEOG77DJ57.
PhylomeDBiO95741.
TreeFamiTF316419.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
3.40.50.410. 1 hit.
InterProiIPR000008. C2_dom.
IPR010734. Copine.
IPR002035. VWF_A.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF07002. Copine. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF53300. SSF53300. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50234. VWFA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95741-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDPEMGWVP EPPTMTLGAS RVELRVSCHG LLDRDTLTKP HPCVLLKLYS
60 70 80 90 100
DEQWVEVERT EVLRSCSSPV FSRVLALEYF FEEKQPLQFH VFDAEDGATS
110 120 130 140 150
PRNDTFLGST ECTLGQIVSQ TKVTKPLLLK NGKTAGKSTI TIVAEEVSGT
160 170 180 190 200
NDYVQLTFRA YKLDNKDLFS KSDPFMEIYK TNEDQSDQLV WRTEVVKNNL
210 220 230 240 250
NPSWEPFRLS LHSLCSCDVH RPLKFLVYDY DSSGKHDFIG EFTSTFQEMQ
260 270 280 290 300
EGTANPGQEM QWDCINPKYR DKKKNYKSSG TVVLAQCTVE KVHTFLDYIM
310 320 330 340 350
GGCQISFTVA IDFTASNGDP RSSQSLHCLS PRQPNHYLQA LRAVGGICQD
360 370 380 390 400
YDSDKRFPAF GFGARIPPNF EVSHDFAINF DPENPECEEI SGVIASYRRC
410 420 430 440 450
LPQIQLYGPT NVAPIINRVA EPAQREQSTG QATKYSVLLV LTDGVVSDMA
460 470 480 490 500
ETRTAIVRAS RLPMSIIIVG VGNADFSDMR LLDGDDGPLR CPRGVPAARD
510 520 530 540 550
IVQFVPFRDF KDAAPSALAK CVLAEVPRQV VEYYASQGIS PGAPRPCTLA

TTPSPSP
Length:557
Mass (Da):61,991
Last modified:June 7, 2005 - v3
Checksum:iCA1ECA3560926FC2
GO
Isoform 2 (identifier: O95741-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAFKEHGKITSCCIPGPINSSRAGAGAGASGWSSKGVRARAREPERGAPDREPSDM

Show »
Length:612
Mass (Da):67,641
Checksum:i8D7C57B24D117C26
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti13 – 131P → Q in AAH18046. (PubMed:15489334)Curated
Sequence conflicti87 – 871L → V in AAH18046. (PubMed:15489334)Curated
Sequence conflicti198 – 1981N → S in BAH11559. (PubMed:14702039)Curated
Sequence conflicti331 – 3311P → H in BAD96395. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MAFKEHGKITSCCIPGPINS SRAGAGAGASGWSSKGVRAR AREPERGAPDREPSDM in isoform 2. 1 PublicationVSP_054806

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009288 mRNA. Translation: BAA75899.1.
AK222675 mRNA. Translation: BAD96395.1.
AK314182 mRNA. Translation: BAG36863.1.
AK293655 mRNA. Translation: BAH11559.1.
AL136295 Genomic DNA. No translation available.
CH471078 Genomic DNA. Translation: EAW66119.1.
CH471078 Genomic DNA. Translation: EAW66120.1.
BC018046 mRNA. Translation: AAH18046.1.
CCDSiCCDS61413.1. [O95741-2]
CCDS9607.1. [O95741-1]
RefSeqiNP_001267487.1. NM_001280558.1. [O95741-2]
NP_006023.1. NM_006032.3. [O95741-1]
XP_005268273.1. XM_005268216.1. [O95741-1]
UniGeneiHs.6132.

Genome annotation databases

EnsembliENST00000397016; ENSP00000380211; ENSG00000100884. [O95741-1]
ENST00000537691; ENSP00000440077; ENSG00000100884. [O95741-2]
GeneIDi9362.
KEGGihsa:9362.
UCSCiuc001wll.3. human. [O95741-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009288 mRNA. Translation: BAA75899.1.
AK222675 mRNA. Translation: BAD96395.1.
AK314182 mRNA. Translation: BAG36863.1.
AK293655 mRNA. Translation: BAH11559.1.
AL136295 Genomic DNA. No translation available.
CH471078 Genomic DNA. Translation: EAW66119.1.
CH471078 Genomic DNA. Translation: EAW66120.1.
BC018046 mRNA. Translation: AAH18046.1.
CCDSiCCDS61413.1. [O95741-2]
CCDS9607.1. [O95741-1]
RefSeqiNP_001267487.1. NM_001280558.1. [O95741-2]
NP_006023.1. NM_006032.3. [O95741-1]
XP_005268273.1. XM_005268216.1. [O95741-1]
UniGeneiHs.6132.

3D structure databases

ProteinModelPortaliO95741.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114763. 11 interactions.
IntActiO95741. 10 interactions.
MINTiMINT-1419837.

PTM databases

PhosphoSiteiO95741.

Proteomic databases

PaxDbiO95741.
PeptideAtlasiO95741.
PRIDEiO95741.

Protocols and materials databases

DNASUi9362.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397016; ENSP00000380211; ENSG00000100884. [O95741-1]
ENST00000537691; ENSP00000440077; ENSG00000100884. [O95741-2]
GeneIDi9362.
KEGGihsa:9362.
UCSCiuc001wll.3. human. [O95741-1]

Organism-specific databases

CTDi9362.
GeneCardsiGC14P024540.
HGNCiHGNC:2319. CPNE6.
HPAiHPA031636.
MIMi605688. gene.
neXtProtiNX_O95741.
PharmGKBiPA26836.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG240062.
GeneTreeiENSGT00760000119085.
HOVERGENiHBG066841.
InParanoidiO95741.
OMAiDMSDPEM.
OrthoDBiEOG77DJ57.
PhylomeDBiO95741.
TreeFamiTF316419.

Miscellaneous databases

GeneWikiiCPNE6.
GenomeRNAii9362.
NextBioi35059.
PROiO95741.
SOURCEiSearch...

Gene expression databases

BgeeiO95741.
CleanExiHS_CPNE6.
ExpressionAtlasiO95741. baseline and differential.
GenevestigatoriO95741.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
3.40.50.410. 1 hit.
InterProiIPR000008. C2_dom.
IPR010734. Copine.
IPR002035. VWF_A.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF07002. Copine. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF53300. SSF53300. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50234. VWFA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "N-copine: a novel two C2-domain-containing protein with neuronal activity-regulated expression."
    Nakayama T., Yaoi T., Yasui M., Kuwajima G.
    FEBS Lett. 428:80-84(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiCPNE6_HUMAN
AccessioniPrimary (citable) accession number: O95741
Secondary accession number(s): B2RAG6
, B7Z1M3, D3DS55, F5GXN1, Q53HA6, Q8WVG1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: June 7, 2005
Last modified: February 4, 2015
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.