SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95741

- CPNE6_HUMAN

UniProt

O95741 - CPNE6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Copine-6

Gene
CPNE6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties. May have a role in synaptic plasticity By similarity.

GO - Molecular functioni

  1. calcium ion binding Source: ProtInc
  2. phosphatidylserine binding Source: Ensembl
  3. transporter activity Source: ProtInc

GO - Biological processi

  1. lipid metabolic process Source: ProtInc
  2. nervous system development Source: ProtInc
  3. synaptic transmission Source: ProtInc
  4. vesicle-mediated transport Source: ProtInc
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Copine-6
Alternative name(s):
Copine VI
Neuronal-copine
Short name:
N-copine
Gene namesi
Name:CPNE6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:2319. CPNE6.

Subcellular locationi

GO - Cellular componenti

  1. axon Source: Ensembl
  2. dendrite Source: Ensembl
  3. membrane Source: Ensembl
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26836.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 557557Copine-6PRO_0000144845Add
BLAST

Proteomic databases

PaxDbiO95741.
PeptideAtlasiO95741.
PRIDEiO95741.

PTM databases

PhosphoSiteiO95741.

Expressioni

Gene expression databases

ArrayExpressiO95741.
BgeeiO95741.
CleanExiHS_CPNE6.
GenevestigatoriO95741.

Organism-specific databases

HPAiHPA031636.

Interactioni

Protein-protein interaction databases

BioGridi114763. 10 interactions.
IntActiO95741. 10 interactions.
MINTiMINT-1419837.

Structurei

3D structure databases

ProteinModelPortaliO95741.
SMRiO95741. Positions 151-285.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 11188C2 1Add
BLAST
Domaini138 – 243106C2 2Add
BLAST
Domaini306 – 526221VWFAAdd
BLAST

Sequence similaritiesi

Belongs to the copine family.
Contains 2 C2 domains.
Contains 1 VWFA domain.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG240062.
HOVERGENiHBG066841.
InParanoidiO95741.
OrthoDBiEOG77DJ57.
PhylomeDBiO95741.
TreeFamiTF316419.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
3.40.50.410. 1 hit.
InterProiIPR000008. C2_dom.
IPR010734. Copine.
IPR002035. VWF_A.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF07002. Copine. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF53300. SSF53300. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50234. VWFA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95741-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSDPEMGWVP EPPTMTLGAS RVELRVSCHG LLDRDTLTKP HPCVLLKLYS    50
DEQWVEVERT EVLRSCSSPV FSRVLALEYF FEEKQPLQFH VFDAEDGATS 100
PRNDTFLGST ECTLGQIVSQ TKVTKPLLLK NGKTAGKSTI TIVAEEVSGT 150
NDYVQLTFRA YKLDNKDLFS KSDPFMEIYK TNEDQSDQLV WRTEVVKNNL 200
NPSWEPFRLS LHSLCSCDVH RPLKFLVYDY DSSGKHDFIG EFTSTFQEMQ 250
EGTANPGQEM QWDCINPKYR DKKKNYKSSG TVVLAQCTVE KVHTFLDYIM 300
GGCQISFTVA IDFTASNGDP RSSQSLHCLS PRQPNHYLQA LRAVGGICQD 350
YDSDKRFPAF GFGARIPPNF EVSHDFAINF DPENPECEEI SGVIASYRRC 400
LPQIQLYGPT NVAPIINRVA EPAQREQSTG QATKYSVLLV LTDGVVSDMA 450
ETRTAIVRAS RLPMSIIIVG VGNADFSDMR LLDGDDGPLR CPRGVPAARD 500
IVQFVPFRDF KDAAPSALAK CVLAEVPRQV VEYYASQGIS PGAPRPCTLA 550
TTPSPSP 557
Length:557
Mass (Da):61,991
Last modified:June 7, 2005 - v3
Checksum:iCA1ECA3560926FC2
GO
Isoform 2 (identifier: O95741-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAFKEHGKITSCCIPGPINSSRAGAGAGASGWSSKGVRARAREPERGAPDREPSDM

Show »
Length:612
Mass (Da):67,641
Checksum:i8D7C57B24D117C26
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MAFKEHGKITSCCIPGPINS SRAGAGAGASGWSSKGVRAR AREPERGAPDREPSDM in isoform 2. VSP_054806

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti13 – 131P → Q in AAH18046. 1 Publication
Sequence conflicti87 – 871L → V in AAH18046. 1 Publication
Sequence conflicti198 – 1981N → S in BAH11559. 1 Publication
Sequence conflicti331 – 3311P → H in BAD96395. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009288 mRNA. Translation: BAA75899.1.
AK222675 mRNA. Translation: BAD96395.1.
AK314182 mRNA. Translation: BAG36863.1.
AK293655 mRNA. Translation: BAH11559.1.
AL136295 Genomic DNA. No translation available.
CH471078 Genomic DNA. Translation: EAW66119.1.
CH471078 Genomic DNA. Translation: EAW66120.1.
BC018046 mRNA. Translation: AAH18046.1.
CCDSiCCDS61413.1. [O95741-2]
CCDS9607.1. [O95741-1]
RefSeqiNP_001267487.1. NM_001280558.1. [O95741-2]
NP_006023.1. NM_006032.3. [O95741-1]
XP_005268273.1. XM_005268216.1. [O95741-1]
UniGeneiHs.6132.

Genome annotation databases

EnsembliENST00000216775; ENSP00000216775; ENSG00000100884.
ENST00000397016; ENSP00000380211; ENSG00000100884.
ENST00000537691; ENSP00000440077; ENSG00000100884.
GeneIDi9362.
KEGGihsa:9362.
UCSCiuc001wll.3. human. [O95741-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009288 mRNA. Translation: BAA75899.1 .
AK222675 mRNA. Translation: BAD96395.1 .
AK314182 mRNA. Translation: BAG36863.1 .
AK293655 mRNA. Translation: BAH11559.1 .
AL136295 Genomic DNA. No translation available.
CH471078 Genomic DNA. Translation: EAW66119.1 .
CH471078 Genomic DNA. Translation: EAW66120.1 .
BC018046 mRNA. Translation: AAH18046.1 .
CCDSi CCDS61413.1. [O95741-2 ]
CCDS9607.1. [O95741-1 ]
RefSeqi NP_001267487.1. NM_001280558.1. [O95741-2 ]
NP_006023.1. NM_006032.3. [O95741-1 ]
XP_005268273.1. XM_005268216.1. [O95741-1 ]
UniGenei Hs.6132.

3D structure databases

ProteinModelPortali O95741.
SMRi O95741. Positions 151-285.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114763. 10 interactions.
IntActi O95741. 10 interactions.
MINTi MINT-1419837.

PTM databases

PhosphoSitei O95741.

Proteomic databases

PaxDbi O95741.
PeptideAtlasi O95741.
PRIDEi O95741.

Protocols and materials databases

DNASUi 9362.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000216775 ; ENSP00000216775 ; ENSG00000100884 .
ENST00000397016 ; ENSP00000380211 ; ENSG00000100884 .
ENST00000537691 ; ENSP00000440077 ; ENSG00000100884 .
GeneIDi 9362.
KEGGi hsa:9362.
UCSCi uc001wll.3. human. [O95741-1 ]

Organism-specific databases

CTDi 9362.
GeneCardsi GC14P024540.
HGNCi HGNC:2319. CPNE6.
HPAi HPA031636.
MIMi 605688. gene.
neXtProti NX_O95741.
PharmGKBi PA26836.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG240062.
HOVERGENi HBG066841.
InParanoidi O95741.
OrthoDBi EOG77DJ57.
PhylomeDBi O95741.
TreeFami TF316419.

Miscellaneous databases

GeneWikii CPNE6.
GenomeRNAii 9362.
NextBioi 35059.
PROi O95741.
SOURCEi Search...

Gene expression databases

ArrayExpressi O95741.
Bgeei O95741.
CleanExi HS_CPNE6.
Genevestigatori O95741.

Family and domain databases

Gene3Di 2.60.40.150. 2 hits.
3.40.50.410. 1 hit.
InterProi IPR000008. C2_dom.
IPR010734. Copine.
IPR002035. VWF_A.
[Graphical view ]
Pfami PF00168. C2. 2 hits.
PF07002. Copine. 1 hit.
[Graphical view ]
SMARTi SM00239. C2. 2 hits.
SM00327. VWA. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 2 hits.
SSF53300. SSF53300. 1 hit.
PROSITEi PS50004. C2. 1 hit.
PS50234. VWFA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "N-copine: a novel two C2-domain-containing protein with neuronal activity-regulated expression."
    Nakayama T., Yaoi T., Yasui M., Kuwajima G.
    FEBS Lett. 428:80-84(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiCPNE6_HUMAN
AccessioniPrimary (citable) accession number: O95741
Secondary accession number(s): B2RAG6
, B7Z1M3, D3DS55, F5GXN1, Q53HA6, Q8WVG1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: June 7, 2005
Last modified: September 3, 2014
This is version 116 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi