Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95741

- CPNE6_HUMAN

UniProt

O95741 - CPNE6_HUMAN

Protein

Copine-6

Gene

CPNE6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 3 (07 Jun 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties. May have a role in synaptic plasticity By similarity.By similarity

    GO - Molecular functioni

    1. calcium ion binding Source: ProtInc
    2. phosphatidylserine binding Source: Ensembl
    3. transporter activity Source: ProtInc

    GO - Biological processi

    1. lipid metabolic process Source: ProtInc
    2. nervous system development Source: ProtInc
    3. synaptic transmission Source: ProtInc
    4. vesicle-mediated transport Source: ProtInc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Copine-6
    Alternative name(s):
    Copine VI
    Neuronal-copine
    Short name:
    N-copine
    Gene namesi
    Name:CPNE6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:2319. CPNE6.

    Subcellular locationi

    GO - Cellular componenti

    1. axon Source: Ensembl
    2. dendrite Source: Ensembl
    3. membrane Source: Ensembl

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26836.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 557557Copine-6PRO_0000144845Add
    BLAST

    Proteomic databases

    PaxDbiO95741.
    PeptideAtlasiO95741.
    PRIDEiO95741.

    PTM databases

    PhosphoSiteiO95741.

    Expressioni

    Gene expression databases

    ArrayExpressiO95741.
    BgeeiO95741.
    CleanExiHS_CPNE6.
    GenevestigatoriO95741.

    Organism-specific databases

    HPAiHPA031636.

    Interactioni

    Protein-protein interaction databases

    BioGridi114763. 10 interactions.
    IntActiO95741. 10 interactions.
    MINTiMINT-1419837.

    Structurei

    3D structure databases

    ProteinModelPortaliO95741.
    SMRiO95741. Positions 151-285.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini24 – 11188C2 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini138 – 243106C2 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini306 – 526221VWFAPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the copine family.Curated
    Contains 2 C2 domains.PROSITE-ProRule annotation
    Contains 1 VWFA domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG240062.
    HOVERGENiHBG066841.
    InParanoidiO95741.
    OrthoDBiEOG77DJ57.
    PhylomeDBiO95741.
    TreeFamiTF316419.

    Family and domain databases

    Gene3Di2.60.40.150. 2 hits.
    3.40.50.410. 1 hit.
    InterProiIPR000008. C2_dom.
    IPR010734. Copine.
    IPR002035. VWF_A.
    [Graphical view]
    PfamiPF00168. C2. 2 hits.
    PF07002. Copine. 1 hit.
    [Graphical view]
    SMARTiSM00239. C2. 2 hits.
    SM00327. VWA. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 2 hits.
    SSF53300. SSF53300. 1 hit.
    PROSITEiPS50004. C2. 1 hit.
    PS50234. VWFA. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95741-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSDPEMGWVP EPPTMTLGAS RVELRVSCHG LLDRDTLTKP HPCVLLKLYS    50
    DEQWVEVERT EVLRSCSSPV FSRVLALEYF FEEKQPLQFH VFDAEDGATS 100
    PRNDTFLGST ECTLGQIVSQ TKVTKPLLLK NGKTAGKSTI TIVAEEVSGT 150
    NDYVQLTFRA YKLDNKDLFS KSDPFMEIYK TNEDQSDQLV WRTEVVKNNL 200
    NPSWEPFRLS LHSLCSCDVH RPLKFLVYDY DSSGKHDFIG EFTSTFQEMQ 250
    EGTANPGQEM QWDCINPKYR DKKKNYKSSG TVVLAQCTVE KVHTFLDYIM 300
    GGCQISFTVA IDFTASNGDP RSSQSLHCLS PRQPNHYLQA LRAVGGICQD 350
    YDSDKRFPAF GFGARIPPNF EVSHDFAINF DPENPECEEI SGVIASYRRC 400
    LPQIQLYGPT NVAPIINRVA EPAQREQSTG QATKYSVLLV LTDGVVSDMA 450
    ETRTAIVRAS RLPMSIIIVG VGNADFSDMR LLDGDDGPLR CPRGVPAARD 500
    IVQFVPFRDF KDAAPSALAK CVLAEVPRQV VEYYASQGIS PGAPRPCTLA 550
    TTPSPSP 557
    Length:557
    Mass (Da):61,991
    Last modified:June 7, 2005 - v3
    Checksum:iCA1ECA3560926FC2
    GO
    Isoform 2 (identifier: O95741-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAFKEHGKITSCCIPGPINSSRAGAGAGASGWSSKGVRARAREPERGAPDREPSDM

    Show »
    Length:612
    Mass (Da):67,641
    Checksum:i8D7C57B24D117C26
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti13 – 131P → Q in AAH18046. (PubMed:15489334)Curated
    Sequence conflicti87 – 871L → V in AAH18046. (PubMed:15489334)Curated
    Sequence conflicti198 – 1981N → S in BAH11559. (PubMed:14702039)Curated
    Sequence conflicti331 – 3311P → H in BAD96395. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MAFKEHGKITSCCIPGPINS SRAGAGAGASGWSSKGVRAR AREPERGAPDREPSDM in isoform 2. 1 PublicationVSP_054806

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009288 mRNA. Translation: BAA75899.1.
    AK222675 mRNA. Translation: BAD96395.1.
    AK314182 mRNA. Translation: BAG36863.1.
    AK293655 mRNA. Translation: BAH11559.1.
    AL136295 Genomic DNA. No translation available.
    CH471078 Genomic DNA. Translation: EAW66119.1.
    CH471078 Genomic DNA. Translation: EAW66120.1.
    BC018046 mRNA. Translation: AAH18046.1.
    CCDSiCCDS61413.1. [O95741-2]
    CCDS9607.1. [O95741-1]
    RefSeqiNP_001267487.1. NM_001280558.1. [O95741-2]
    NP_006023.1. NM_006032.3. [O95741-1]
    XP_005268273.1. XM_005268216.1. [O95741-1]
    UniGeneiHs.6132.

    Genome annotation databases

    EnsembliENST00000397016; ENSP00000380211; ENSG00000100884. [O95741-1]
    ENST00000537691; ENSP00000440077; ENSG00000100884. [O95741-2]
    GeneIDi9362.
    KEGGihsa:9362.
    UCSCiuc001wll.3. human. [O95741-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009288 mRNA. Translation: BAA75899.1 .
    AK222675 mRNA. Translation: BAD96395.1 .
    AK314182 mRNA. Translation: BAG36863.1 .
    AK293655 mRNA. Translation: BAH11559.1 .
    AL136295 Genomic DNA. No translation available.
    CH471078 Genomic DNA. Translation: EAW66119.1 .
    CH471078 Genomic DNA. Translation: EAW66120.1 .
    BC018046 mRNA. Translation: AAH18046.1 .
    CCDSi CCDS61413.1. [O95741-2 ]
    CCDS9607.1. [O95741-1 ]
    RefSeqi NP_001267487.1. NM_001280558.1. [O95741-2 ]
    NP_006023.1. NM_006032.3. [O95741-1 ]
    XP_005268273.1. XM_005268216.1. [O95741-1 ]
    UniGenei Hs.6132.

    3D structure databases

    ProteinModelPortali O95741.
    SMRi O95741. Positions 151-285.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114763. 10 interactions.
    IntActi O95741. 10 interactions.
    MINTi MINT-1419837.

    PTM databases

    PhosphoSitei O95741.

    Proteomic databases

    PaxDbi O95741.
    PeptideAtlasi O95741.
    PRIDEi O95741.

    Protocols and materials databases

    DNASUi 9362.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000397016 ; ENSP00000380211 ; ENSG00000100884 . [O95741-1 ]
    ENST00000537691 ; ENSP00000440077 ; ENSG00000100884 . [O95741-2 ]
    GeneIDi 9362.
    KEGGi hsa:9362.
    UCSCi uc001wll.3. human. [O95741-1 ]

    Organism-specific databases

    CTDi 9362.
    GeneCardsi GC14P024540.
    HGNCi HGNC:2319. CPNE6.
    HPAi HPA031636.
    MIMi 605688. gene.
    neXtProti NX_O95741.
    PharmGKBi PA26836.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG240062.
    HOVERGENi HBG066841.
    InParanoidi O95741.
    OrthoDBi EOG77DJ57.
    PhylomeDBi O95741.
    TreeFami TF316419.

    Miscellaneous databases

    GeneWikii CPNE6.
    GenomeRNAii 9362.
    NextBioi 35059.
    PROi O95741.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95741.
    Bgeei O95741.
    CleanExi HS_CPNE6.
    Genevestigatori O95741.

    Family and domain databases

    Gene3Di 2.60.40.150. 2 hits.
    3.40.50.410. 1 hit.
    InterProi IPR000008. C2_dom.
    IPR010734. Copine.
    IPR002035. VWF_A.
    [Graphical view ]
    Pfami PF00168. C2. 2 hits.
    PF07002. Copine. 1 hit.
    [Graphical view ]
    SMARTi SM00239. C2. 2 hits.
    SM00327. VWA. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 2 hits.
    SSF53300. SSF53300. 1 hit.
    PROSITEi PS50004. C2. 1 hit.
    PS50234. VWFA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "N-copine: a novel two C2-domain-containing protein with neuronal activity-regulated expression."
      Nakayama T., Yaoi T., Yasui M., Kuwajima G.
      FEBS Lett. 428:80-84(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    4. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiCPNE6_HUMAN
    AccessioniPrimary (citable) accession number: O95741
    Secondary accession number(s): B2RAG6
    , B7Z1M3, D3DS55, F5GXN1, Q53HA6, Q8WVG1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: June 7, 2005
    Last modified: October 1, 2014
    This is version 117 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3