Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95741 (CPNE6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Copine-6
Alternative name(s):
Copine VI
Neuronal-copine
Short name=N-copine
Gene names
Name:CPNE6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length557 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties. May have a role in synaptic plasticity By similarity.

Sequence similarities

Belongs to the copine family.

Contains 2 C2 domains.

Contains 1 VWFA domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O95741-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O95741-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAFKEHGKITSCCIPGPINSSRAGAGAGASGWSSKGVRARAREPERGAPDREPSDM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 557557Copine-6
PRO_0000144845

Regions

Domain24 – 11188C2 1
Domain138 – 243106C2 2
Domain306 – 526221VWFA

Natural variations

Alternative sequence11M → MAFKEHGKITSCCIPGPINS SRAGAGAGASGWSSKGVRAR AREPERGAPDREPSDM in isoform 2.
VSP_054806

Experimental info

Sequence conflict131P → Q in AAH18046. Ref.6
Sequence conflict871L → V in AAH18046. Ref.6
Sequence conflict1981N → S in BAH11559. Ref.2
Sequence conflict3311P → H in BAD96395. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 7, 2005. Version 3.
Checksum: CA1ECA3560926FC2

FASTA55761,991
        10         20         30         40         50         60 
MSDPEMGWVP EPPTMTLGAS RVELRVSCHG LLDRDTLTKP HPCVLLKLYS DEQWVEVERT 

        70         80         90        100        110        120 
EVLRSCSSPV FSRVLALEYF FEEKQPLQFH VFDAEDGATS PRNDTFLGST ECTLGQIVSQ 

       130        140        150        160        170        180 
TKVTKPLLLK NGKTAGKSTI TIVAEEVSGT NDYVQLTFRA YKLDNKDLFS KSDPFMEIYK 

       190        200        210        220        230        240 
TNEDQSDQLV WRTEVVKNNL NPSWEPFRLS LHSLCSCDVH RPLKFLVYDY DSSGKHDFIG 

       250        260        270        280        290        300 
EFTSTFQEMQ EGTANPGQEM QWDCINPKYR DKKKNYKSSG TVVLAQCTVE KVHTFLDYIM 

       310        320        330        340        350        360 
GGCQISFTVA IDFTASNGDP RSSQSLHCLS PRQPNHYLQA LRAVGGICQD YDSDKRFPAF 

       370        380        390        400        410        420 
GFGARIPPNF EVSHDFAINF DPENPECEEI SGVIASYRRC LPQIQLYGPT NVAPIINRVA 

       430        440        450        460        470        480 
EPAQREQSTG QATKYSVLLV LTDGVVSDMA ETRTAIVRAS RLPMSIIIVG VGNADFSDMR 

       490        500        510        520        530        540 
LLDGDDGPLR CPRGVPAARD IVQFVPFRDF KDAAPSALAK CVLAEVPRQV VEYYASQGIS 

       550 
PGAPRPCTLA TTPSPSP 

« Hide

Isoform 2 [UniParc].

Checksum: 8D7C57B24D117C26
Show »

FASTA61267,641

References

« Hide 'large scale' references
[1]"N-copine: a novel two C2-domain-containing protein with neuronal activity-regulated expression."
Nakayama T., Yaoi T., Yasui M., Kuwajima G.
FEBS Lett. 428:80-84(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain.
[3]Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB009288 mRNA. Translation: BAA75899.1.
AK222675 mRNA. Translation: BAD96395.1.
AK314182 mRNA. Translation: BAG36863.1.
AK293655 mRNA. Translation: BAH11559.1.
AL136295 Genomic DNA. No translation available.
CH471078 Genomic DNA. Translation: EAW66119.1.
CH471078 Genomic DNA. Translation: EAW66120.1.
BC018046 mRNA. Translation: AAH18046.1.
CCDSCCDS9607.1.
RefSeqNP_001267487.1. NM_001280558.1. [O95741-2]
NP_006023.1. NM_006032.3. [O95741-1]
XP_005268273.1. XM_005268216.1. [O95741-1]
UniGeneHs.6132.

3D structure databases

ProteinModelPortalO95741.
SMRO95741. Positions 151-285.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114763. 10 interactions.
IntActO95741. 10 interactions.
MINTMINT-1419837.

PTM databases

PhosphoSiteO95741.

Proteomic databases

PaxDbO95741.
PeptideAtlasO95741.
PRIDEO95741.

Protocols and materials databases

DNASU9362.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000216775; ENSP00000216775; ENSG00000100884.
ENST00000397016; ENSP00000380211; ENSG00000100884.
ENST00000537691; ENSP00000440077; ENSG00000100884.
GeneID9362.
KEGGhsa:9362.
UCSCuc001wll.3. human. [O95741-1]

Organism-specific databases

CTD9362.
GeneCardsGC14P024540.
HGNCHGNC:2319. CPNE6.
HPAHPA031636.
MIM605688. gene.
neXtProtNX_O95741.
PharmGKBPA26836.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG240062.
HOVERGENHBG066841.
InParanoidO95741.
OrthoDBEOG77DJ57.
PhylomeDBO95741.
TreeFamTF316419.

Gene expression databases

ArrayExpressO95741.
BgeeO95741.
CleanExHS_CPNE6.
GenevestigatorO95741.

Family and domain databases

Gene3D2.60.40.150. 2 hits.
3.40.50.410. 1 hit.
InterProIPR000008. C2_dom.
IPR010734. Copine.
IPR002035. VWF_A.
[Graphical view]
PfamPF00168. C2. 2 hits.
PF07002. Copine. 1 hit.
[Graphical view]
SMARTSM00239. C2. 2 hits.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMSSF49562. SSF49562. 2 hits.
SSF53300. SSF53300. 1 hit.
PROSITEPS50004. C2. 1 hit.
PS50234. VWFA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCPNE6.
GenomeRNAi9362.
NextBio35059.
PROO95741.
SOURCESearch...

Entry information

Entry nameCPNE6_HUMAN
AccessionPrimary (citable) accession number: O95741
Secondary accession number(s): B2RAG6 expand/collapse secondary AC list , B7Z1M3, D3DS55, F5GXN1, Q53HA6, Q8WVG1
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: June 7, 2005
Last modified: July 9, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM