Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Amyloid beta A4 precursor protein-binding family B member 3

Gene

APBB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May modulate the internalization of beta-amyloid precursor protein.

GO - Molecular functioni

  1. beta-amyloid binding Source: GO_Central
  2. transcription factor binding Source: GO_Central

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: GO_Central
Complete GO annotation...

Enzyme and pathway databases

SignaLinkiO95704.

Names & Taxonomyi

Protein namesi
Recommended name:
Amyloid beta A4 precursor protein-binding family B member 3
Alternative name(s):
Protein Fe65-like 2
Short name:
Fe65L2
Gene namesi
Name:APBB3
Synonyms:FE65L2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:20708. APBB3.

Subcellular locationi

  1. Cytoplasm 1 Publication
  2. Nucleus 1 Publication

GO - Cellular componenti

  1. actin cytoskeleton Source: HPA
  2. cytoplasm Source: HPA
  3. nucleus Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134958636.

Polymorphism and mutation databases

BioMutaiAPBB3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 486486Amyloid beta A4 precursor protein-binding family B member 3PRO_0000076054Add
BLAST

Proteomic databases

PaxDbiO95704.
PRIDEiO95704.

PTM databases

PhosphoSiteiO95704.

Expressioni

Tissue specificityi

Expressed in various tissues, highest expression in brain.1 Publication

Gene expression databases

BgeeiO95704.
CleanExiHS_APBB3.
ExpressionAtlasiO95704. baseline and differential.
GenevestigatoriO95704.

Organism-specific databases

HPAiHPA005571.

Interactioni

Subunit structurei

Binds to the intracellular domain of the beta-amyloid precursor protein. Also binds to APP-like proteins.

Binary interactionsi

WithEntry#Exp.IntActNotes
EGFRP005332EBI-286427,EBI-297353

Protein-protein interaction databases

BioGridi115593. 6 interactions.
IntActiO95704. 5 interactions.
MINTiMINT-1493083.
STRINGi9606.ENSP00000346378.

Structurei

Secondary structure

1
486
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi35 – 406Combined sources
Beta strandi43 – 519Combined sources
Beta strandi54 – 574Combined sources
Beta strandi292 – 30413Combined sources
Helixi307 – 31812Combined sources
Beta strandi327 – 3337Combined sources
Beta strandi335 – 3428Combined sources
Beta strandi354 – 3585Combined sources
Helixi359 – 3613Combined sources
Beta strandi362 – 3676Combined sources
Beta strandi373 – 3797Combined sources
Beta strandi381 – 3833Combined sources
Beta strandi385 – 3917Combined sources
Helixi397 – 41519Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DYQX-ray3.10A281-417[»]
2YSCNMR-A30-61[»]
ProteinModelPortaliO95704.
SMRiO95704. Positions 31-61, 115-478.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95704.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini29 – 6133WWPROSITE-ProRule annotationAdd
BLAST
Domaini113 – 280168PID 1PROSITE-ProRule annotationAdd
BLAST
Domaini285 – 440156PID 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 PID domains.PROSITE-ProRule annotation
Contains 1 WW domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG80991.
GeneTreeiENSGT00390000000002.
HOGENOMiHOG000033983.
HOVERGENiHBG050524.
InParanoidiO95704.
OMAiDRNAWVP.
OrthoDBiEOG79W94P.
PhylomeDBiO95704.
TreeFamiTF314331.

Family and domain databases

Gene3Di2.30.29.30. 2 hits.
InterProiIPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00640. PID. 2 hits.
PF00397. WW. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 2 hits.
SM00456. WW. 1 hit.
[Graphical view]
SUPFAMiSSF51045. SSF51045. 1 hit.
PROSITEiPS01179. PID. 2 hits.
PS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform II (identifier: O95704-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLGKDYMLAI ILVNCDDDLW GDHSLEVEAG LPPGWRKIHD AAGTYYWHVP
60 70 80 90 100
SGSTQWQRPT WELGDAEDPG TGTEGIWGLR PPKGRSFSSL ESSLDRSNSL
110 120 130 140 150
SWYGGESYIQ SMEPGAKCFA VRSLGWVEVP EEDLAPGKSS IAVNNCIQQL
160 170 180 190 200
AQTRSRSQPP DGAWGEGQNM LMILKKDAMS LVNPLDHSLI HCQPLVHIRV
210 220 230 240 250
WGVGSSKGRD RDFAFVASDK DSCMLKCHVF CCDVPAKAIA SALHGLCAQI
260 270 280 290 300
LSERVEVSGD ASCCSPDPIS PEDLPRQVEL LDAVSQAAQK YEALYMGTLP
310 320 330 340 350
VTKAMGMDVL NEAIGTLTAR GDRNAWVPTM LSVSDSLMTA HPIQAEASTE
360 370 380 390 400
EEPLWQCPVR LVTFIGVGRD PHTFGLIADL GRQSFQCAAF WCQPHAGGLS
410 420 430 440 450
EAVQAACMVQ YQKCLVASAA RGKAWGAQAR ARLRLKRTSS MDSPGGPLPL
460 470 480
PLLKGGVGGA GATPRKRGVF SFLDAFRLKP SLLHMP
Length:486
Mass (Da):52,585
Last modified:November 30, 2010 - v2
Checksum:i553DFB4D8655EFA1
GO
Isoform I (identifier: O95704-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-211: Missing.

Show »
Length:484
Mass (Da):52,314
Checksum:i2A57615AAA0CF980
GO
Isoform III (identifier: O95704-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-210: D → PISAPA

Show »
Length:491
Mass (Da):53,007
Checksum:i054A8696C11578E2
GO
Isoform IV (identifier: O95704-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-210: D → DSPISAPA

Show »
Length:493
Mass (Da):53,209
Checksum:i5EC279FAAE2EEF96
GO
Isoform I-214 (identifier: O95704-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-214: VHIRVWGVGSSKGRDRDFA → AVIPTDADPQYLNPWTQIL
     215-486: Missing.

Note: Increased expression upon apoptotic stimuli.

Show »
Length:214
Mass (Da):23,634
Checksum:iFD469DC121C73E6C
GO
Isoform I-245 (identifier: O95704-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-245: DRDFAFVASDKDSCMLKCHVFCCDVPAKAIASALHG → SSDVDPGLLPLPGPALVGEGGPSSAGTVWGESERLG
     246-486: Missing.

Show »
Length:245
Mass (Da):26,460
Checksum:i7F460206E4157F6C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti165 – 1651G → R.
Corresponds to variant rs7715021 [ dbSNP | Ensembl ].
VAR_029518
Natural varianti231 – 2311C → R.5 Publications
Corresponds to variant rs250430 [ dbSNP | Ensembl ].
VAR_024702

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei196 – 21419VHIRV…DRDFA → AVIPTDADPQYLNPWTQIL in isoform I-214. 1 PublicationVSP_047811Add
BLAST
Alternative sequencei210 – 24536DRDFA…SALHG → SSDVDPGLLPLPGPALVGEG GPSSAGTVWGESERLG in isoform I-245. 1 PublicationVSP_047812Add
BLAST
Alternative sequencei210 – 2112Missing in isoform I. 2 PublicationsVSP_006799
Alternative sequencei210 – 2101D → PISAPA in isoform III. 1 PublicationVSP_006800
Alternative sequencei210 – 2101D → DSPISAPA in isoform IV. 1 PublicationVSP_006801
Alternative sequencei215 – 486272Missing in isoform I-214. 1 PublicationVSP_047813Add
BLAST
Alternative sequencei246 – 486241Missing in isoform I-245. 1 PublicationVSP_047814Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018247 mRNA. Translation: BAA35188.1.
AB024745 Genomic DNA. Translation: BAA78674.1.
AB049618 mRNA. Translation: BAB40806.1.
AB061224 mRNA. Translation: BAB71767.1.
AF224708 mRNA. Translation: AAF65172.1.
AF224709 mRNA. Translation: AAF65173.1.
AF224710 mRNA. Translation: AAF65174.1.
AF224711 mRNA. Translation: AAF65175.1.
AK075280 mRNA. Translation: BAG52101.1.
AC011399 Genomic DNA. No translation available.
AC116353 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW62041.1.
BC125187 mRNA. Translation: AAI25188.1.
CCDSiCCDS4227.1. [O95704-4]
CCDS4228.1. [O95704-3]
CCDS4229.1. [O95704-1]
CCDS47279.1. [O95704-2]
RefSeqiNP_006042.3. NM_006051.3. [O95704-4]
NP_573418.2. NM_133172.2. [O95704-3]
NP_573419.2. NM_133173.2. [O95704-1]
NP_573420.2. NM_133174.2. [O95704-2]
UniGeneiHs.529449.

Genome annotation databases

EnsembliENST00000354402; ENSP00000346378; ENSG00000113108. [O95704-4]
ENST00000356738; ENSP00000349177; ENSG00000113108. [O95704-3]
ENST00000357560; ENSP00000350171; ENSG00000113108. [O95704-1]
ENST00000412920; ENSP00000402591; ENSG00000113108. [O95704-2]
ENST00000467078; ENSP00000422718; ENSG00000113108. [O95704-6]
ENST00000509914; ENSP00000426107; ENSG00000113108. [O95704-5]
GeneIDi10307.
KEGGihsa:10307.
UCSCiuc003lgb.1. human. [O95704-1]
uc003lgd.1. human. [O95704-3]
uc003lge.1. human. [O95704-2]
uc021yeg.1. human. [O95704-4]

Polymorphism and mutation databases

BioMutaiAPBB3.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018247 mRNA. Translation: BAA35188.1.
AB024745 Genomic DNA. Translation: BAA78674.1.
AB049618 mRNA. Translation: BAB40806.1.
AB061224 mRNA. Translation: BAB71767.1.
AF224708 mRNA. Translation: AAF65172.1.
AF224709 mRNA. Translation: AAF65173.1.
AF224710 mRNA. Translation: AAF65174.1.
AF224711 mRNA. Translation: AAF65175.1.
AK075280 mRNA. Translation: BAG52101.1.
AC011399 Genomic DNA. No translation available.
AC116353 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW62041.1.
BC125187 mRNA. Translation: AAI25188.1.
CCDSiCCDS4227.1. [O95704-4]
CCDS4228.1. [O95704-3]
CCDS4229.1. [O95704-1]
CCDS47279.1. [O95704-2]
RefSeqiNP_006042.3. NM_006051.3. [O95704-4]
NP_573418.2. NM_133172.2. [O95704-3]
NP_573419.2. NM_133173.2. [O95704-1]
NP_573420.2. NM_133174.2. [O95704-2]
UniGeneiHs.529449.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DYQX-ray3.10A281-417[»]
2YSCNMR-A30-61[»]
ProteinModelPortaliO95704.
SMRiO95704. Positions 31-61, 115-478.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115593. 6 interactions.
IntActiO95704. 5 interactions.
MINTiMINT-1493083.
STRINGi9606.ENSP00000346378.

PTM databases

PhosphoSiteiO95704.

Polymorphism and mutation databases

BioMutaiAPBB3.

Proteomic databases

PaxDbiO95704.
PRIDEiO95704.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354402; ENSP00000346378; ENSG00000113108. [O95704-4]
ENST00000356738; ENSP00000349177; ENSG00000113108. [O95704-3]
ENST00000357560; ENSP00000350171; ENSG00000113108. [O95704-1]
ENST00000412920; ENSP00000402591; ENSG00000113108. [O95704-2]
ENST00000467078; ENSP00000422718; ENSG00000113108. [O95704-6]
ENST00000509914; ENSP00000426107; ENSG00000113108. [O95704-5]
GeneIDi10307.
KEGGihsa:10307.
UCSCiuc003lgb.1. human. [O95704-1]
uc003lgd.1. human. [O95704-3]
uc003lge.1. human. [O95704-2]
uc021yeg.1. human. [O95704-4]

Organism-specific databases

CTDi10307.
GeneCardsiGC05M139937.
HGNCiHGNC:20708. APBB3.
HPAiHPA005571.
MIMi602711. gene.
neXtProtiNX_O95704.
PharmGKBiPA134958636.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG80991.
GeneTreeiENSGT00390000000002.
HOGENOMiHOG000033983.
HOVERGENiHBG050524.
InParanoidiO95704.
OMAiDRNAWVP.
OrthoDBiEOG79W94P.
PhylomeDBiO95704.
TreeFamiTF314331.

Enzyme and pathway databases

SignaLinkiO95704.

Miscellaneous databases

ChiTaRSiAPBB3. human.
EvolutionaryTraceiO95704.
GeneWikiiAPBB3.
GenomeRNAii10307.
NextBioi39057.
PROiO95704.
SOURCEiSearch...

Gene expression databases

BgeeiO95704.
CleanExiHS_APBB3.
ExpressionAtlasiO95704. baseline and differential.
GenevestigatoriO95704.

Family and domain databases

Gene3Di2.30.29.30. 2 hits.
InterProiIPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00640. PID. 2 hits.
PF00397. WW. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 2 hits.
SM00456. WW. 1 hit.
[Graphical view]
SUPFAMiSSF51045. SSF51045. 1 hit.
PROSITEiPS01179. PID. 2 hits.
PS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of human Fe65L2 and its interaction with the Alzheimer's beta-amyloid precursor protein."
    Tanahashi H.
    Neurosci. Lett. 261:143-146(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I AND II), VARIANT ARG-231.
    Tissue: Brain.
  2. "Genome structure and chromosomal mapping of the gene for Fe65L2 interacting with Alzheimer's beta-amyloid precursor protein."
    Tanahashi H., Tabira T.
    Biochem. Biophys. Res. Commun. 258:385-389(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ARG-231.
  3. "Characterization of an amyloid precursor protein-binding protein Fe65L2 and its novel isoforms lacking phosphotyrosine-interaction domains."
    Tanahashi H., Tabira T.
    Biochem. J. 367:687-695(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I-214 AND I-245), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  4. "Molecular cloning of the full-length cDNA and novel splicing isoforms of Fe65L2 gene."
    Mao Y.M., Xie Y., Sun Z., Chen X.M., Ying K., Dai J.L., Lin S., Wu C.Q., Li Y.
    Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I; II; III AND IV), VARIANT ARG-231.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM II), VARIANT ARG-231.
  6. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-231.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM II).
  9. "Solution structure of the WW domain from the human amyloid beta A4 precursor protein-binding family B member 3, APBB3."
    RIKEN structural genomics initiative (RSGI)
    Submitted (APR-2008) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 30-61.

Entry informationi

Entry nameiAPBB3_HUMAN
AccessioniPrimary (citable) accession number: O95704
Secondary accession number(s): B3KQN9
, Q08AG4, Q96Q18, Q9BYD4, Q9NYX6, Q9NYX7, Q9NYX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: November 30, 2010
Last modified: April 29, 2015
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.