Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95704

- APBB3_HUMAN

UniProt

O95704 - APBB3_HUMAN

Protein

Amyloid beta A4 precursor protein-binding family B member 3

Gene

APBB3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 2 (30 Nov 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May modulate the internalization of beta-amyloid precursor protein.

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    Enzyme and pathway databases

    SignaLinkiO95704.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Amyloid beta A4 precursor protein-binding family B member 3
    Alternative name(s):
    Protein Fe65-like 2
    Short name:
    Fe65L2
    Gene namesi
    Name:APBB3
    Synonyms:FE65L2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:20708. APBB3.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication

    GO - Cellular componenti

    1. actin cytoskeleton Source: HPA
    2. cytoplasm Source: HPA
    3. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134958636.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 486486Amyloid beta A4 precursor protein-binding family B member 3PRO_0000076054Add
    BLAST

    Proteomic databases

    PaxDbiO95704.
    PRIDEiO95704.

    PTM databases

    PhosphoSiteiO95704.

    Expressioni

    Tissue specificityi

    Expressed in various tissues, highest expression in brain.1 Publication

    Gene expression databases

    ArrayExpressiO95704.
    BgeeiO95704.
    CleanExiHS_APBB3.
    GenevestigatoriO95704.

    Organism-specific databases

    HPAiHPA005571.

    Interactioni

    Subunit structurei

    Binds to the intracellular domain of the beta-amyloid precursor protein. Also binds to APP-like proteins.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    EGFRP005332EBI-286427,EBI-297353

    Protein-protein interaction databases

    BioGridi115593. 6 interactions.
    IntActiO95704. 5 interactions.
    MINTiMINT-1493083.
    STRINGi9606.ENSP00000346378.

    Structurei

    Secondary structure

    1
    486
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi35 – 406
    Beta strandi43 – 519
    Beta strandi54 – 574
    Beta strandi292 – 30413
    Helixi307 – 31812
    Beta strandi327 – 3337
    Beta strandi335 – 3428
    Beta strandi354 – 3585
    Helixi359 – 3613
    Beta strandi362 – 3676
    Beta strandi373 – 3797
    Beta strandi381 – 3833
    Beta strandi385 – 3917
    Helixi397 – 41519

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2DYQX-ray3.10A281-417[»]
    2YSCNMR-A30-61[»]
    ProteinModelPortaliO95704.
    SMRiO95704. Positions 31-61, 115-253, 288-417.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO95704.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini29 – 6133WWPROSITE-ProRule annotationAdd
    BLAST
    Domaini113 – 280168PID 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini285 – 440156PID 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 PID domains.PROSITE-ProRule annotation
    Contains 1 WW domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG80991.
    HOGENOMiHOG000033983.
    HOVERGENiHBG050524.
    OMAiGTVWGES.
    OrthoDBiEOG79W94P.
    PhylomeDBiO95704.
    TreeFamiTF314331.

    Family and domain databases

    Gene3Di2.30.29.30. 2 hits.
    InterProiIPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    IPR001202. WW_dom.
    [Graphical view]
    PfamiPF00640. PID. 2 hits.
    PF00397. WW. 1 hit.
    [Graphical view]
    SMARTiSM00462. PTB. 2 hits.
    SM00456. WW. 1 hit.
    [Graphical view]
    SUPFAMiSSF51045. SSF51045. 1 hit.
    PROSITEiPS01179. PID. 2 hits.
    PS01159. WW_DOMAIN_1. 1 hit.
    PS50020. WW_DOMAIN_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform II (identifier: O95704-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLGKDYMLAI ILVNCDDDLW GDHSLEVEAG LPPGWRKIHD AAGTYYWHVP    50
    SGSTQWQRPT WELGDAEDPG TGTEGIWGLR PPKGRSFSSL ESSLDRSNSL 100
    SWYGGESYIQ SMEPGAKCFA VRSLGWVEVP EEDLAPGKSS IAVNNCIQQL 150
    AQTRSRSQPP DGAWGEGQNM LMILKKDAMS LVNPLDHSLI HCQPLVHIRV 200
    WGVGSSKGRD RDFAFVASDK DSCMLKCHVF CCDVPAKAIA SALHGLCAQI 250
    LSERVEVSGD ASCCSPDPIS PEDLPRQVEL LDAVSQAAQK YEALYMGTLP 300
    VTKAMGMDVL NEAIGTLTAR GDRNAWVPTM LSVSDSLMTA HPIQAEASTE 350
    EEPLWQCPVR LVTFIGVGRD PHTFGLIADL GRQSFQCAAF WCQPHAGGLS 400
    EAVQAACMVQ YQKCLVASAA RGKAWGAQAR ARLRLKRTSS MDSPGGPLPL 450
    PLLKGGVGGA GATPRKRGVF SFLDAFRLKP SLLHMP 486
    Length:486
    Mass (Da):52,585
    Last modified:November 30, 2010 - v2
    Checksum:i553DFB4D8655EFA1
    GO
    Isoform I (identifier: O95704-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         210-211: Missing.

    Show »
    Length:484
    Mass (Da):52,314
    Checksum:i2A57615AAA0CF980
    GO
    Isoform III (identifier: O95704-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         210-210: D → PISAPA

    Show »
    Length:491
    Mass (Da):53,007
    Checksum:i054A8696C11578E2
    GO
    Isoform IV (identifier: O95704-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         210-210: D → DSPISAPA

    Show »
    Length:493
    Mass (Da):53,209
    Checksum:i5EC279FAAE2EEF96
    GO
    Isoform I-214 (identifier: O95704-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         196-214: VHIRVWGVGSSKGRDRDFA → AVIPTDADPQYLNPWTQIL
         215-486: Missing.

    Note: Increased expression upon apoptotic stimuli.

    Show »
    Length:214
    Mass (Da):23,634
    Checksum:iFD469DC121C73E6C
    GO
    Isoform I-245 (identifier: O95704-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         210-245: DRDFAFVASDKDSCMLKCHVFCCDVPAKAIASALHG → SSDVDPGLLPLPGPALVGEGGPSSAGTVWGESERLG
         246-486: Missing.

    Show »
    Length:245
    Mass (Da):26,460
    Checksum:i7F460206E4157F6C
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti165 – 1651G → R.
    Corresponds to variant rs7715021 [ dbSNP | Ensembl ].
    VAR_029518
    Natural varianti231 – 2311C → R.5 Publications
    Corresponds to variant rs250430 [ dbSNP | Ensembl ].
    VAR_024702

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei196 – 21419VHIRV…DRDFA → AVIPTDADPQYLNPWTQIL in isoform I-214. 1 PublicationVSP_047811Add
    BLAST
    Alternative sequencei210 – 24536DRDFA…SALHG → SSDVDPGLLPLPGPALVGEG GPSSAGTVWGESERLG in isoform I-245. 1 PublicationVSP_047812Add
    BLAST
    Alternative sequencei210 – 2112Missing in isoform I. 2 PublicationsVSP_006799
    Alternative sequencei210 – 2101D → PISAPA in isoform III. 1 PublicationVSP_006800
    Alternative sequencei210 – 2101D → DSPISAPA in isoform IV. 1 PublicationVSP_006801
    Alternative sequencei215 – 486272Missing in isoform I-214. 1 PublicationVSP_047813Add
    BLAST
    Alternative sequencei246 – 486241Missing in isoform I-245. 1 PublicationVSP_047814Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB018247 mRNA. Translation: BAA35188.1.
    AB024745 Genomic DNA. Translation: BAA78674.1.
    AB049618 mRNA. Translation: BAB40806.1.
    AB061224 mRNA. Translation: BAB71767.1.
    AF224708 mRNA. Translation: AAF65172.1.
    AF224709 mRNA. Translation: AAF65173.1.
    AF224710 mRNA. Translation: AAF65174.1.
    AF224711 mRNA. Translation: AAF65175.1.
    AK075280 mRNA. Translation: BAG52101.1.
    AC011399 Genomic DNA. No translation available.
    AC116353 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW62041.1.
    BC125187 mRNA. Translation: AAI25188.1.
    CCDSiCCDS4227.1. [O95704-4]
    CCDS4228.1. [O95704-3]
    CCDS4229.1. [O95704-1]
    CCDS47279.1. [O95704-2]
    RefSeqiNP_006042.3. NM_006051.3. [O95704-4]
    NP_573418.2. NM_133172.2. [O95704-3]
    NP_573419.2. NM_133173.2. [O95704-1]
    NP_573420.2. NM_133174.2. [O95704-2]
    UniGeneiHs.529449.

    Genome annotation databases

    EnsembliENST00000354402; ENSP00000346378; ENSG00000113108. [O95704-4]
    ENST00000356738; ENSP00000349177; ENSG00000113108. [O95704-3]
    ENST00000357560; ENSP00000350171; ENSG00000113108. [O95704-1]
    ENST00000412920; ENSP00000402591; ENSG00000113108. [O95704-2]
    ENST00000467078; ENSP00000422718; ENSG00000113108. [O95704-6]
    ENST00000509914; ENSP00000426107; ENSG00000113108. [O95704-5]
    GeneIDi10307.
    KEGGihsa:10307.
    UCSCiuc003lgb.1. human. [O95704-1]
    uc003lgd.1. human. [O95704-3]
    uc003lge.1. human. [O95704-2]
    uc021yeg.1. human. [O95704-4]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB018247 mRNA. Translation: BAA35188.1 .
    AB024745 Genomic DNA. Translation: BAA78674.1 .
    AB049618 mRNA. Translation: BAB40806.1 .
    AB061224 mRNA. Translation: BAB71767.1 .
    AF224708 mRNA. Translation: AAF65172.1 .
    AF224709 mRNA. Translation: AAF65173.1 .
    AF224710 mRNA. Translation: AAF65174.1 .
    AF224711 mRNA. Translation: AAF65175.1 .
    AK075280 mRNA. Translation: BAG52101.1 .
    AC011399 Genomic DNA. No translation available.
    AC116353 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW62041.1 .
    BC125187 mRNA. Translation: AAI25188.1 .
    CCDSi CCDS4227.1. [O95704-4 ]
    CCDS4228.1. [O95704-3 ]
    CCDS4229.1. [O95704-1 ]
    CCDS47279.1. [O95704-2 ]
    RefSeqi NP_006042.3. NM_006051.3. [O95704-4 ]
    NP_573418.2. NM_133172.2. [O95704-3 ]
    NP_573419.2. NM_133173.2. [O95704-1 ]
    NP_573420.2. NM_133174.2. [O95704-2 ]
    UniGenei Hs.529449.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2DYQ X-ray 3.10 A 281-417 [» ]
    2YSC NMR - A 30-61 [» ]
    ProteinModelPortali O95704.
    SMRi O95704. Positions 31-61, 115-253, 288-417.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115593. 6 interactions.
    IntActi O95704. 5 interactions.
    MINTi MINT-1493083.
    STRINGi 9606.ENSP00000346378.

    PTM databases

    PhosphoSitei O95704.

    Proteomic databases

    PaxDbi O95704.
    PRIDEi O95704.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000354402 ; ENSP00000346378 ; ENSG00000113108 . [O95704-4 ]
    ENST00000356738 ; ENSP00000349177 ; ENSG00000113108 . [O95704-3 ]
    ENST00000357560 ; ENSP00000350171 ; ENSG00000113108 . [O95704-1 ]
    ENST00000412920 ; ENSP00000402591 ; ENSG00000113108 . [O95704-2 ]
    ENST00000467078 ; ENSP00000422718 ; ENSG00000113108 . [O95704-6 ]
    ENST00000509914 ; ENSP00000426107 ; ENSG00000113108 . [O95704-5 ]
    GeneIDi 10307.
    KEGGi hsa:10307.
    UCSCi uc003lgb.1. human. [O95704-1 ]
    uc003lgd.1. human. [O95704-3 ]
    uc003lge.1. human. [O95704-2 ]
    uc021yeg.1. human. [O95704-4 ]

    Organism-specific databases

    CTDi 10307.
    GeneCardsi GC05M139937.
    HGNCi HGNC:20708. APBB3.
    HPAi HPA005571.
    MIMi 602711. gene.
    neXtProti NX_O95704.
    PharmGKBi PA134958636.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG80991.
    HOGENOMi HOG000033983.
    HOVERGENi HBG050524.
    OMAi GTVWGES.
    OrthoDBi EOG79W94P.
    PhylomeDBi O95704.
    TreeFami TF314331.

    Enzyme and pathway databases

    SignaLinki O95704.

    Miscellaneous databases

    ChiTaRSi APBB3. human.
    EvolutionaryTracei O95704.
    GeneWikii APBB3.
    GenomeRNAii 10307.
    NextBioi 39057.
    PROi O95704.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95704.
    Bgeei O95704.
    CleanExi HS_APBB3.
    Genevestigatori O95704.

    Family and domain databases

    Gene3Di 2.30.29.30. 2 hits.
    InterProi IPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    IPR001202. WW_dom.
    [Graphical view ]
    Pfami PF00640. PID. 2 hits.
    PF00397. WW. 1 hit.
    [Graphical view ]
    SMARTi SM00462. PTB. 2 hits.
    SM00456. WW. 1 hit.
    [Graphical view ]
    SUPFAMi SSF51045. SSF51045. 1 hit.
    PROSITEi PS01179. PID. 2 hits.
    PS01159. WW_DOMAIN_1. 1 hit.
    PS50020. WW_DOMAIN_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of human Fe65L2 and its interaction with the Alzheimer's beta-amyloid precursor protein."
      Tanahashi H.
      Neurosci. Lett. 261:143-146(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I AND II), VARIANT ARG-231.
      Tissue: Brain.
    2. "Genome structure and chromosomal mapping of the gene for Fe65L2 interacting with Alzheimer's beta-amyloid precursor protein."
      Tanahashi H., Tabira T.
      Biochem. Biophys. Res. Commun. 258:385-389(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ARG-231.
    3. "Characterization of an amyloid precursor protein-binding protein Fe65L2 and its novel isoforms lacking phosphotyrosine-interaction domains."
      Tanahashi H., Tabira T.
      Biochem. J. 367:687-695(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I-214 AND I-245), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Brain.
    4. "Molecular cloning of the full-length cDNA and novel splicing isoforms of Fe65L2 gene."
      Mao Y.M., Xie Y., Sun Z., Chen X.M., Ying K., Dai J.L., Lin S., Wu C.Q., Li Y.
      Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I; II; III AND IV), VARIANT ARG-231.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM II), VARIANT ARG-231.
    6. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-231.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM II).
    9. "Solution structure of the WW domain from the human amyloid beta A4 precursor protein-binding family B member 3, APBB3."
      RIKEN structural genomics initiative (RSGI)
      Submitted (APR-2008) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 30-61.

    Entry informationi

    Entry nameiAPBB3_HUMAN
    AccessioniPrimary (citable) accession number: O95704
    Secondary accession number(s): B3KQN9
    , Q08AG4, Q96Q18, Q9BYD4, Q9NYX6, Q9NYX7, Q9NYX8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: November 30, 2010
    Last modified: October 1, 2014
    This is version 117 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3