O95644 (NFAC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 130.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear factor of activated T-cells, cytoplasmic 1 Short name=NF-ATc1 Short name=NFATc1 Alternative name(s): NFAT transcription complex cytosolic component Short name=NF-ATc Short name=NFATc | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 943 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells. |
| Subunit structure | Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers. |
| Subcellular location | Cytoplasm. Nucleus. Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. |
| Tissue specificity | Expressed in thymus, peripheral leukocytes as T-cells and spleen. Isoforms A are preferentially expressed in effector T-cells (thymus and peripheral leukocytes) whereas isoforms B and isoforms C are preferentially expressed in naive T-cells (spleen). Isoforms B are expressed in naive T-cells after first antigen exposure and isoforms A are expressed in effector T-cells after second antigen exposure. |
| Induction | Only isoforms A are inducibly expressed in T lymphocytes upon activation of the T-cell receptor (TCR) complex. Induced after co-addition of phorbol 12-myristate 13-acetate (PMA) and ionomycin. Also induced after co-addition of 12-O-tetradecanoylphorbol-13-acetate (TPA) and ionomycin. Weakly induced with PMA, ionomycin and cyclosporin A. |
| Domain | Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors. The N-terminal transactivation domain (TAD-A) binds to and is activated by Cbp/p300. The dephosphorylated form contains two unmasked nuclear localization signals (NLS), which allow translocation of the protein to the nucleus. Isoforms C have a C-terminal part with an additional trans-activation domain, TAD-B, which acts as a transcriptional activator. Isoforms B have a shorter C-terminal part without complete TAD-B which acts as a transcriptional repressor. |
| Post-translational modification | Phosphorylated by NFATC-kinase and GSK3B; phosphorylation induces NFATC1 nuclear exit and dephosphorylation by calcineurin promotes nuclear import. Ref.5 Ref.9 |
| Sequence similarities | Contains 1 RHD (Rel-like) domain. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] Note: Isoform C-alpha and isoform C-beta are the strongest activator of gene transcription, followed by isoform A-alpha and isoform A-beta, whereas isoform B-alpha and isoform B-beta are the weakest. Isoform B-alpha, isoform B-beta, isoform C-alpha and isoform C-beta, both present in T-cells, can modulate their transcriptional activity. | ||||||
| Isoform C-alpha (identifier: O95644-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A-alpha (identifier: O95644-2) The sequence of this isoform differs from the canonical sequence as follows: 698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF 717-943: Missing. | ||||||
| Isoform A-beta (identifier: O95644-3) The sequence of this isoform differs from the canonical sequence as follows: 1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP 698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF 717-943: Missing. | ||||||
| Isoform B-alpha (identifier: O95644-4) The sequence of this isoform differs from the canonical sequence as follows: 826-943: Missing. | ||||||
| Isoform B-beta (identifier: O95644-5) The sequence of this isoform differs from the canonical sequence as follows: 1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP 826-943: Missing. | ||||||
| Isoform C-beta (identifier: O95644-6) The sequence of this isoform differs from the canonical sequence as follows: 1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP | ||||||
| Isoform C-alpha' (identifier: O95644-7) The sequence of this isoform differs from the canonical sequence as follows: 1-36: Missing. | ||||||
| Note: Produced by alternative initiation at Met-37 of isoform C-alpha. No experimental confirmation available. | ||||||
| Isoform A-alpha' (identifier: O95644-8) The sequence of this isoform differs from the canonical sequence as follows: 1-36: Missing. 698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF 717-943: Missing. | ||||||
| Note: Produced by alternative initiation at Met-37 of isoform A-alpha. No experimental confirmation available. | ||||||
| Isoform B-alpha' (identifier: O95644-9) The sequence of this isoform differs from the canonical sequence as follows: 1-36: Missing. 826-943: Missing. | ||||||
| Note: Produced by alternative initiation at Met-37 of isoform B-alpha. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 943 | 943 | Nuclear factor of activated T-cells, cytoplasmic 1 | PRO_0000030329 | |||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||
| Repeat | 203 – 219 | 17 | 1 | ||||||||||||||||||||||||||||||||
| Repeat | 233 – 249 | 17 | 2 | ||||||||||||||||||||||||||||||||
| Repeat | 282 – 298 | 17 | 3 | ||||||||||||||||||||||||||||||||
| Domain | 410 – 592 | 183 | RHD | ||||||||||||||||||||||||||||||||
| DNA binding | 439 – 446 | 8 | |||||||||||||||||||||||||||||||||
| Region | 118 – 123 | 6 | Calcineurin-binding | ||||||||||||||||||||||||||||||||
| Region | 126 – 218 | 93 | Trans-activation domain A (TAD-A) | ||||||||||||||||||||||||||||||||
| Region | 203 – 298 | 96 | 3 X SP repeats | ||||||||||||||||||||||||||||||||
| Region | 703 – 943 | 241 | Trans-activation domain B (TAD-B) | ||||||||||||||||||||||||||||||||
| Motif | 265 – 267 | 3 | Nuclear localization signal | ||||||||||||||||||||||||||||||||
| Motif | 310 – 321 | 12 | Nuclear export signal | ||||||||||||||||||||||||||||||||
| Motif | 682 – 684 | 3 | Nuclear localization signal | ||||||||||||||||||||||||||||||||
| Motif | 924 – 933 | 10 | Nuclear export signal | ||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||
| Modified residue | 233 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 42 | 42 | MPSTS…KSAEE → MTGLEDQEFDFEFLFEFNQR DEGAAAAAP in isoform A-beta, isoform B-beta and isoform C-beta. | VSP_005590 | |||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 36 | 36 | Missing in isoform A-alpha', isoform B-alpha' and isoform C-alpha'. | VSP_018978 | |||||||||||||||||||||||||||||||
| Alternative sequence | 698 – 716 | 19 | VPIIK…APTCG → GNAIFLTVSREHERVGCFF in isoform A-alpha, isoform A-alpha' and isoform A-beta. | VSP_005591 | |||||||||||||||||||||||||||||||
| Alternative sequence | 717 – 943 | 227 | Missing in isoform A-alpha, isoform A-alpha' and isoform A-beta. | VSP_005592 | |||||||||||||||||||||||||||||||
| Alternative sequence | 826 – 943 | 118 | Missing in isoform B-alpha, isoform B-alpha' and isoform B-beta. | VSP_005593 | |||||||||||||||||||||||||||||||
| Natural variant | 68 | 1 | P → T. Corresponds to variant rs1051978 [ dbSNP | Ensembl ]. | VAR_057145 | |||||||||||||||||||||||||||||||
| Natural variant | 315 | 1 | A → T in a colorectal cancer sample; somatic mutation. Ref.12 | VAR_036529 | |||||||||||||||||||||||||||||||
| Natural variant | 751 | 1 | C → G. Corresponds to variant rs754093 [ dbSNP | Ensembl ]. | VAR_057146 | |||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 169 | 1 | S → A: No effect on subcellular localization. | ||||||||||||||||||||||||||||||||
| Mutagenesis | 172 | 1 | S → A: Partial nuclear translocation. Ref.8 | ||||||||||||||||||||||||||||||||
| Mutagenesis | 187 | 1 | S → A: No effect on subcellular localization. Ref.8 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 232 | 1 | G → S in AAC50869. Ref.2 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 235 | 1 | R → Q in AAA19601. Ref.1 | ||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||
| Beta strand | 426 – 432 | 7 | |||||||||||||||||||||||||||||||||
| Beta strand | 443 – 445 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 454 – 456 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 460 – 465 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 468 – 470 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 472 – 480 | 9 | |||||||||||||||||||||||||||||||||
| Beta strand | 483 – 485 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 509 – 511 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 514 – 521 | 8 | |||||||||||||||||||||||||||||||||
| Beta strand | 523 – 525 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 541 – 545 | 5 | |||||||||||||||||||||||||||||||||
| Beta strand | 559 – 570 | 12 | |||||||||||||||||||||||||||||||||
| Turn | 571 – 573 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 574 – 586 | 13 | |||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "NF-AT components define a family of transcription factors targeted in T-cell activation." Northrop J.P., Ho S.N., Chen L., Thomas D.J., Timmerman L.A., Nolan G.P., Admon A., Crabtree G.R. Nature 369:497-502(1994) [PubMed: 8202141] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A-ALPHA). Tissue: Peripheral blood lymphocyte and T-cell. |
| [2] | "Characterization of a new isoform of the NFAT (nuclear factor of activated T cells) gene family member NFATc." Park J., Takeuchi A., Sharma S. J. Biol. Chem. 271:20914-20921(1996) [PubMed: 8702849] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B-BETA). Tissue: B-cell. |
| [3] | Erratum Park J., Takeuchi A., Sharma S. J. Biol. Chem. 271:33705-33705(1996) |
| [4] | "Alternative polyadenylation events contribute to the induction of NF-ATc in effector T cells." Chuvpilo S., Zimmer M., Kerstan A., Gloeckner J., Avots A., Escher C., Fischer C., Inashkina I., Jankevics E., Berberich-Siebelt F., Schmitt E., Serfling E. Immunity 10:261-269(1999) [PubMed: 10072078] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A-ALPHA; B-ALPHA AND C-BETA). Tissue: B-cell lymphoma. |
| [5] | "Nuclear export of NF-ATc enhanced by glycogen synthase kinase-3." Beals C.R., Sheridan C.M., Turck C.W., Gardner P., Crabtree G.R. Science 275:1930-1934(1997) [PubMed: 9072970] [Abstract] Cited for: PHOSPHORYLATION BY GSK3B. |
| [6] | "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT." Crabtree G.R. Cell 96:611-614(1999) [PubMed: 10089876] [Abstract] Cited for: REVIEW. |
| [7] | "Multiple NF-ATc isoforms with individual transcriptional properties are synthesized in T lymphocytes." Chuvpilo S., Avots A., Berberich-Siebelt F., Gloeckner J., Fischer C., Kerstan A., Escher C., Inashkina I., Hlubek F., Jankevics E., Brabletz T., Serfling E. J. Immunol. 162:7294-7301(1999) [PubMed: 10358178] [Abstract] Cited for: ALTERNATIVE SPLICING, CHARACTERIZATION. |
| [8] | "Identification of amino acid residues and protein kinases involved in the regulation of NFATc subcellular localization." Porter C.M., Havens M.A., Clipstone N.A. J. Biol. Chem. 275:3543-3551(2000) [PubMed: 10652349] [Abstract] Cited for: MUTAGENESIS OF SER-172 AND SER-187. |
| [9] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-233, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [10] | "Unusual Rel-like architecture in the DNA-binding domain of the transcription factor NFATc." Wolfe S.A., Zhou P., Dotsch V., Chen L., You A., Ho S.N., Crabtree G.R., Wagner G., Verdine G.L. Nature 385:172-176(1997) [PubMed: 8990122] [Abstract] Cited for: STRUCTURE BY NMR OF 416-591. |
| [11] | "Solution structure of the core NFATC1/DNA complex." Zhou P., Sun L.J., Dotsch V., Wagner G., Verdine G.L. Cell 92:687-696(1998) [PubMed: 9506523] [Abstract] Cited for: STRUCTURE BY NMR OF 416-591 IN COMPLEX WITH DNA. |
| [12] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-315. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U08015 mRNA. Translation: AAA19601.1. U59736 mRNA. Translation: AAC50869.1. U80917 mRNA. Translation: AAD00450.1. U80918 mRNA. Translation: AAD00451.1. U80919 mRNA. Translation: AAD00452.1. | ||||||||||||||||||
| IPI | IPI00032069. IPI00221155. IPI00221156. IPI00221157. IPI00221158. IPI00336007. IPI00395394. IPI00759774. IPI00759791. | ||||||||||||||||||
| PIR | S45262. | ||||||||||||||||||
| RefSeq | NP_006153.2. NM_006162.3. NP_765975.1. NM_172387.1. NP_765976.1. NM_172388.1. NP_765977.1. NM_172389.1. NP_765978.1. NM_172390.1. | ||||||||||||||||||
| UniGene | Hs.534074. Hs.701518. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O95644. | ||||||||||||||||||
| SMR | O95644. Positions 415-695. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| MINT | MINT-3319641. | ||||||||||||||||||
| STRING | O95644. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O95644. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | O95644. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000415320; ENSP00000396667; ENSG00000131196. | ||||||||||||||||||
| GeneID | 4772. | ||||||||||||||||||
| KEGG | hsa:4772. | ||||||||||||||||||
| UCSC | uc002lnc.1. human. uc002lnd.1. human. uc002lnf.1. human. uc002lng.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 4772. | ||||||||||||||||||
| GeneCards | GC18P077208. | ||||||||||||||||||
| HGNC | HGNC:7775. NFATC1. | ||||||||||||||||||
| HPA | CAB004513. | ||||||||||||||||||
| MIM | 600489. gene. | ||||||||||||||||||
| neXtProt | NX_O95644. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG12664. | ||||||||||||||||||
| HOVERGEN | HBG069754. | ||||||||||||||||||
| OMA | HNNNQFF. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Pathway_Interaction_DB | bcr_5pathway. BCR signaling pathway. nfat_tfpathway. Calcineurin-regulated NFAT-dependent transcription in lymphocytes. tcrcalciumpathway. Calcium signaling in the CD4+ TCR pathway. cd8tcrdownstreampathway. Downstream signaling in naive CD8+ T cells. nfat_3pathway. Role of Calcineurin-dependent NFAT signaling in lymphocytes. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O95644. | ||||||||||||||||||
| Bgee | O95644. | ||||||||||||||||||
| CleanEx | HS_NFATC1. | ||||||||||||||||||
| Genevestigator | O95644. | ||||||||||||||||||
| GermOnline | ENSG00000131196. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR008366. NFAT. IPR015647. NFAT1. IPR008967. p53-like_TF_DNA-bd. IPR011539. RHD. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. G3DSA:2.60.40.340. RHD. 1 hit. | ||||||||||||||||||
| KO | K04446. | ||||||||||||||||||
| PANTHER | PTHR12533. NFAT. 1 hit. PTHR12533:SF5. NFAT1. 1 hit. | ||||||||||||||||||
| Pfam | PF00554. RHD. 1 hit. PF01833. TIG. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR01789. NUCFACTORATC. | ||||||||||||||||||
| SMART | SM00429. IPT. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF81296. Ig_E-set. 1 hit. SSF49417. P53_like_DNA_bnd. 1 hit. | ||||||||||||||||||
| PROSITE | PS01204. REL_1. False negative. PS50254. REL_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 18388. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | NFAC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95644 Secondary accession number(s): Q12865, Q15793 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with