Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95644

- NFAC1_HUMAN

UniProt

O95644 - NFAC1_HUMAN

Protein

Nuclear factor of activated T-cells, cytoplasmic 1

Gene

NFATC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 157 (01 Oct 2014)
      Sequence version 3 (01 Dec 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi439 – 4468

    GO - Molecular functioni

    1. FK506 binding Source: ProtInc
    2. mitogen-activated protein kinase p38 binding Source: BHF-UCL
    3. protein binding Source: UniProtKB
    4. RNA polymerase II distal enhancer sequence-specific DNA binding Source: BHF-UCL
    5. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity Source: BHF-UCL
    6. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
    7. RNA polymerase II transcription factor binding Source: BHF-UCL
    8. sequence-specific DNA binding transcription factor activity Source: ProtInc
    9. transcription regulatory region DNA binding Source: UniProtKB

    GO - Biological processi

    1. calcium ion transport Source: Ensembl
    2. epithelial to mesenchymal transition Source: Ensembl
    3. Fc-epsilon receptor signaling pathway Source: Reactome
    4. G1/S transition of mitotic cell cycle Source: Ensembl
    5. heart development Source: Ensembl
    6. innate immune response Source: Reactome
    7. intracellular signal transduction Source: MGI
    8. osteoclast differentiation Source: Ensembl
    9. positive regulation of transcription, DNA-templated Source: UniProtKB
    10. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    11. transcription from RNA polymerase II promoter Source: ProtInc

    Keywords - Molecular functioni

    Activator, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_163834. FCERI mediated Ca+2 mobilization.
    REACT_172761. Ca2+ pathway.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear factor of activated T-cells, cytoplasmic 1
    Short name:
    NF-ATc1
    Short name:
    NFATc1
    Alternative name(s):
    NFAT transcription complex cytosolic component
    Short name:
    NF-ATc
    Short name:
    NFATc
    Gene namesi
    Name:NFATC1
    Synonyms:NFAT2, NFATC
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 18

    Organism-specific databases

    HGNCiHGNC:7775. NFATC1.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

    GO - Cellular componenti

    1. cytoplasm Source: BHF-UCL
    2. cytosol Source: Reactome
    3. nuclear chromatin Source: BHF-UCL
    4. nucleoplasm Source: Reactome
    5. transcription factor complex Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi169 – 1691S → A: No effect on subcellular localization.
    Mutagenesisi172 – 1721S → A: Partial nuclear translocation. 1 Publication
    Mutagenesisi187 – 1871S → A: No effect on subcellular localization. 1 Publication

    Organism-specific databases

    PharmGKBiPA31582.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 943943Nuclear factor of activated T-cells, cytoplasmic 1PRO_0000030329Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei245 – 2451Phosphoserine; by PKA1 Publication
    Modified residuei269 – 2691Phosphoserine; by PKA1 Publication
    Modified residuei294 – 2941Phosphoserine; by PKA1 Publication

    Post-translational modificationi

    Phosphorylated by NFATC-kinase and GSK3B; phosphorylation induces NFATC1 nuclear exit and dephosphorylation by calcineurin promotes nuclear import. Phosphorylation by PKA and DYRK2 negatively modulates nuclear accumulation, and promotes subsequent phosphorylation by GSK3B or casein kinase 1.3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO95644.
    PaxDbiO95644.
    PRIDEiO95644.

    PTM databases

    PhosphoSiteiO95644.

    Expressioni

    Tissue specificityi

    Expressed in thymus, peripheral leukocytes as T-cells and spleen. Isoforms A are preferentially expressed in effector T-cells (thymus and peripheral leukocytes) whereas isoforms B and isoforms C are preferentially expressed in naive T-cells (spleen). Isoforms B are expressed in naive T-cells after first antigen exposure and isoforms A are expressed in effector T-cells after second antigen exposure. Isoforms IA are widely expressed but not detected in liver nor pancreas, neural expression is strongest in corpus callosum. Isoforms IB are expressed mostly in muscle, cerebellum, placenta and thymus, neural expression in fetal and adult brain, strongest in corpus callosum.1 Publication

    Inductioni

    Only isoforms A are inducibly expressed in T lymphocytes upon activation of the T-cell receptor (TCR) complex. Induced after co-addition of phorbol 12-myristate 13-acetate (PMA) and ionomycin. Also induced after co-addition of 12-O-tetradecanoylphorbol-13-acetate (TPA) and ionomycin. Weakly induced with PMA, ionomycin and cyclosporin A.

    Gene expression databases

    ArrayExpressiO95644.
    BgeeiO95644.
    CleanExiHS_NFATC1.
    GenevestigatoriO95644.

    Organism-specific databases

    HPAiCAB004513.

    Interactioni

    Subunit structurei

    Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    OGTO152942EBI-6907210,EBI-539828

    Protein-protein interaction databases

    BioGridi110845. 24 interactions.
    DIPiDIP-44311N.
    IntActiO95644. 4 interactions.
    MINTiMINT-3319641.
    STRINGi9606.ENSP00000327850.

    Structurei

    Secondary structure

    1
    943
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi426 – 4327
    Beta strandi443 – 4453
    Beta strandi454 – 4563
    Beta strandi460 – 4656
    Beta strandi468 – 4703
    Beta strandi472 – 4809
    Beta strandi483 – 4853
    Beta strandi509 – 5113
    Beta strandi514 – 5218
    Beta strandi523 – 5253
    Helixi541 – 5455
    Beta strandi551 – 5533
    Beta strandi559 – 57012
    Turni571 – 5733
    Beta strandi574 – 58613

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1A66NMR-A414-591[»]
    1NFANMR-A416-591[»]
    ProteinModelPortaliO95644.
    SMRiO95644. Positions 415-695.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO95644.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati203 – 219171Add
    BLAST
    Repeati233 – 249172Add
    BLAST
    Repeati282 – 298173Add
    BLAST
    Domaini410 – 592183RHDPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni118 – 1236Calcineurin-binding
    Regioni126 – 21893Trans-activation domain A (TAD-A)Add
    BLAST
    Regioni203 – 298963 X SP repeatsAdd
    BLAST
    Regioni703 – 943241Trans-activation domain B (TAD-B)Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi265 – 2673Nuclear localization signal
    Motifi310 – 32112Nuclear export signalAdd
    BLAST
    Motifi682 – 6843Nuclear localization signal
    Motifi924 – 93310Nuclear export signal

    Domaini

    Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.
    The N-terminal transactivation domain (TAD-A) binds to and is activated by Cbp/p300. The dephosphorylated form contains two unmasked nuclear localization signals (NLS), which allow translocation of the protein to the nucleus.
    Isoforms C have a C-terminal part with an additional trans-activation domain, TAD-B, which acts as a transcriptional activator. Isoforms B have a shorter C-terminal part without complete TAD-B which acts as a transcriptional repressor.

    Sequence similaritiesi

    Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG87292.
    HOGENOMiHOG000231780.
    HOVERGENiHBG069754.
    KOiK04446.
    OMAiHNNNQFF.
    OrthoDBiEOG79PJND.
    PhylomeDBiO95644.
    TreeFamiTF326480.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    2.60.40.340. 1 hit.
    InterProiIPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR008366. NFAT.
    IPR015647. NFAT1.
    IPR008967. p53-like_TF_DNA-bd.
    IPR011539. RHD.
    [Graphical view]
    PANTHERiPTHR12533. PTHR12533. 1 hit.
    PTHR12533:SF5. PTHR12533:SF5. 1 hit.
    PfamiPF00554. RHD. 1 hit.
    PF01833. TIG. 1 hit.
    [Graphical view]
    PRINTSiPR01789. NUCFACTORATC.
    SMARTiSM00429. IPT. 1 hit.
    [Graphical view]
    SUPFAMiSSF49417. SSF49417. 1 hit.
    SSF81296. SSF81296. 1 hit.
    PROSITEiPS50254. REL_2. 1 hit.
    [Graphical view]

    Sequences (10)i

    Sequence statusi: Complete.

    This entry describes 10 isoformsi produced by alternative splicing and alternative initiation. Align

    Note: Isoform C-alpha and isoform C-beta are the strongest activator of gene transcription, followed by isoform A-alpha and isoform A-beta, whereas isoform B-alpha and isoform B-beta are the weakest. Isoform B-alpha, isoform B-beta, isoform C-alpha and isoform C-beta, both present in T-cells, can modulate their transcriptional activity.

    Isoform C-alpha (identifier: O95644-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPSTSFPVPS KFPLGPAAAV FGRGETLGPA PRAGGTMKSA EEEHYGYASS    50
    NVSPALPLPT AHSTLPAPCH NLQTSTPGII PPADHPSGYG AALDGGPAGY 100
    FLSSGHTRPD GAPALESPRI EITSCLGLYH NNNQFFHDVE VEDVLPSSKR 150
    SPSTATLSLP SLEAYRDPSC LSPASSLSSR SCNSEASSYE SNYSYPYASP 200
    QTSPWQSPCV SPKTTDPEEG FPRGLGACTL LGSPRHSPST SPRASVTEES 250
    WLGARSSRPA SPCNKRKYSL NGRQPPYSPH HSPTPSPHGS PRVSVTDDSW 300
    LGNTTQYTSS AIVAAINALT TDSSLDLGDG VPVKSRKTTL EQPPSVALKV 350
    EPVGEDLGSP PPPADFAPED YSSFQHIRKG GFCDQYLAVP QHPYQWAKPK 400
    PLSPTSYMSP TLPALDWQLP SHSGPYELRI EVQPKSHHRA HYETEGSRGA 450
    VKASAGGHPI VQLHGYLENE PLMLQLFIGT ADDRLLRPHA FYQVHRITGK 500
    TVSTTSHEAI LSNTKVLEIP LLPENSMRAV IDCAGILKLR NSDIELRKGE 550
    TDIGRKNTRV RLVFRVHVPQ PSGRTLSLQV ASNPIECSQR SAQELPLVEK 600
    QSTDSYPVVG GKKMVLSGHN FLQDSKVIFV EKAPDGHHVW EMEAKTDRDL 650
    CKPNSLVVEI PPFRNQRITS PVHVSFYVCN GKRKRSQYQR FTYLPANVPI 700
    IKTEPTDDYE PAPTCGPVSQ GLSPLPRPYY SQQLAMPPDP SSCLVAGFPP 750
    CPQRSTLMPA APGVSPKLHD LSPAAYTKGV ASPGHCHLGL PQPAGEAPAV 800
    QDVPRPVATH PGSPGQPPPA LLPQQVSAPP SSSCPPGLEH SLCPSSPSPP 850
    LPPATQEPTC LQPCSPACPP ATGRPQHLPS TVRRDESPTA GPRLLPEVHE 900
    DGSPNLAPIP VTVKREPEEL DQLYLDDVNE IIRNDLSSTS THS 943
    Length:943
    Mass (Da):101,243
    Last modified:December 1, 2000 - v3
    Checksum:iE72FAB10ECEB2D66
    GO
    Isoform A-alpha (identifier: O95644-2) [UniParc]FASTAAdd to Basket

    Also known as: IA-VIII

    The sequence of this isoform differs from the canonical sequence as follows:
         698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
         717-943: Missing.

    Show »
    Length:716
    Mass (Da):77,785
    Checksum:iC02F3B03F2019BB1
    GO
    Isoform A-beta (identifier: O95644-3) [UniParc]FASTAAdd to Basket

    Also known as: IB-VIII

    The sequence of this isoform differs from the canonical sequence as follows:
         1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
         698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
         717-943: Missing.

    Show »
    Length:703
    Mass (Da):76,879
    Checksum:i57650B6E2A9A219C
    GO
    Isoform B-alpha (identifier: O95644-4) [UniParc]FASTAAdd to Basket

    Also known as: IA-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         826-943: Missing.

    Show »
    Length:825
    Mass (Da):88,763
    Checksum:i28469C5BE89B00CC
    GO
    Isoform B-beta (identifier: O95644-5) [UniParc]FASTAAdd to Basket

    Also known as: IB-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
         826-943: Missing.

    Show »
    Length:812
    Mass (Da):87,857
    Checksum:iDBF68E35846E998D
    GO
    Isoform C-beta (identifier: O95644-6) [UniParc]FASTAAdd to Basket

    Also known as: IB-IXL

    The sequence of this isoform differs from the canonical sequence as follows:
         1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP

    Show »
    Length:930
    Mass (Da):100,336
    Checksum:i8708706F1C8938AC
    GO
    Isoform A-alpha' (identifier: O95644-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: Missing.
         698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
         717-943: Missing.

    Note: Produced by alternative initiation at Met-37 of isoform A-alpha. No experimental confirmation available.

    Show »
    Length:680
    Mass (Da):74,276
    Checksum:iD9D7060FEB4E81DF
    GO
    Isoform IA-deltaIX (identifier: O95644-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         698-927: Missing.

    Show »
    Length:713
    Mass (Da):77,376
    Checksum:iB797CFCFF28F8976
    GO
    Isoform IB-deltaIX (identifier: O95644-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
         698-927: Missing.

    Show »
    Length:700
    Mass (Da):76,469
    Checksum:i4A4F5475DF755F89
    GO
    Isoform 10 (identifier: O95644-17) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-472: Missing.
         826-943: Missing.

    Note: No experimental evidence available.

    Show »
    Length:353
    Mass (Da):38,626
    Checksum:iAB8DEB0C451190DD
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti232 – 2321G → S in AAC50869. (PubMed:8702849)Curated
    Sequence conflicti235 – 2351R → Q in AAA19601. (PubMed:8202141)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti68 – 681P → T.
    Corresponds to variant rs1051978 [ dbSNP | Ensembl ].
    VAR_057145
    Natural varianti315 – 3151A → T in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_036529
    Natural varianti751 – 7511C → G.
    Corresponds to variant rs754093 [ dbSNP | Ensembl ].
    VAR_057146

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 472472Missing in isoform 10. CuratedVSP_053806Add
    BLAST
    Alternative sequencei1 – 4242MPSTS…KSAEE → MTGLEDQEFDFEFLFEFNQR DEGAAAAAP in isoform A-beta, isoform B-beta, isoform C-beta and isoform IB-deltaIX. 3 PublicationsVSP_005590Add
    BLAST
    Alternative sequencei1 – 3636Missing in isoform A-alpha'. CuratedVSP_018978Add
    BLAST
    Alternative sequencei698 – 927230Missing in isoform IA-deltaIX and isoform IB-deltaIX. 1 PublicationVSP_047820Add
    BLAST
    Alternative sequencei698 – 71619VPIIK…APTCG → GNAIFLTVSREHERVGCFF in isoform A-alpha, isoform A-alpha' and isoform A-beta. 3 PublicationsVSP_005591Add
    BLAST
    Alternative sequencei717 – 943227Missing in isoform A-alpha, isoform A-alpha' and isoform A-beta. 3 PublicationsVSP_005592Add
    BLAST
    Alternative sequencei826 – 943118Missing in isoform B-alpha, isoform B-beta and isoform 10. 2 PublicationsVSP_005593Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U08015 mRNA. Translation: AAA19601.1.
    U59736 mRNA. Translation: AAC50869.1.
    U80917 mRNA. Translation: AAD00450.1.
    U80918 mRNA. Translation: AAD00451.1.
    U80919 mRNA. Translation: AAD00452.1.
    EU887559 mRNA. Translation: ACG55579.1.
    EU887560 mRNA. Translation: ACG55580.1.
    EU887561 mRNA. Translation: ACG55581.1.
    EU887562 mRNA. Translation: ACG55582.1.
    EU887563 mRNA. Translation: ACG55583.1.
    EU887564 mRNA. Translation: ACG55584.1.
    EU887565 mRNA. Translation: ACG55585.1.
    EU887566 mRNA. Translation: ACG55586.1.
    AC018445 Genomic DNA. No translation available.
    AC023090 Genomic DNA. No translation available.
    CH471117 Genomic DNA. Translation: EAW66621.1.
    CH471117 Genomic DNA. Translation: EAW66622.1.
    BC104753 mRNA. Translation: AAI04754.1.
    BC112243 mRNA. Translation: AAI12244.1.
    CCDSiCCDS12015.1. [O95644-4]
    CCDS12016.1. [O95644-17]
    CCDS32850.1. [O95644-6]
    CCDS59326.1. [O95644-2]
    CCDS59327.1. [O95644-5]
    CCDS62467.1. [O95644-1]
    CCDS62468.1. [O95644-10]
    CCDS62469.1. [O95644-11]
    CCDS62470.1. [O95644-3]
    PIRiS45262.
    RefSeqiNP_001265598.1. NM_001278669.1. [O95644-1]
    NP_001265599.1. NM_001278670.1. [O95644-10]
    NP_001265601.1. NM_001278672.1. [O95644-11]
    NP_001265602.1. NM_001278673.1.
    NP_001265604.1. NM_001278675.1. [O95644-3]
    NP_006153.2. NM_006162.4. [O95644-4]
    NP_765975.1. NM_172387.2. [O95644-6]
    NP_765976.1. NM_172388.2. [O95644-17]
    NP_765977.1. NM_172389.2. [O95644-5]
    NP_765978.1. NM_172390.2. [O95644-2]
    UniGeneiHs.534074.
    Hs.701518.

    Genome annotation databases

    EnsembliENST00000253506; ENSP00000253506; ENSG00000131196. [O95644-4]
    ENST00000318065; ENSP00000316553; ENSG00000131196. [O95644-5]
    ENST00000329101; ENSP00000327850; ENSG00000131196. [O95644-6]
    ENST00000397790; ENSP00000380892; ENSG00000131196. [O95644-17]
    ENST00000427363; ENSP00000389377; ENSG00000131196. [O95644-1]
    ENST00000542384; ENSP00000442435; ENSG00000131196. [O95644-10]
    ENST00000586434; ENSP00000466489; ENSG00000131196. [O95644-11]
    ENST00000591814; ENSP00000466194; ENSG00000131196. [O95644-2]
    ENST00000592223; ENSP00000467181; ENSG00000131196. [O95644-3]
    GeneIDi4772.
    KEGGihsa:4772.
    UCSCiuc002lnc.1. human.
    uc002lnd.3. human. [O95644-1]

    Keywords - Coding sequence diversityi

    Alternative initiation, Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U08015 mRNA. Translation: AAA19601.1 .
    U59736 mRNA. Translation: AAC50869.1 .
    U80917 mRNA. Translation: AAD00450.1 .
    U80918 mRNA. Translation: AAD00451.1 .
    U80919 mRNA. Translation: AAD00452.1 .
    EU887559 mRNA. Translation: ACG55579.1 .
    EU887560 mRNA. Translation: ACG55580.1 .
    EU887561 mRNA. Translation: ACG55581.1 .
    EU887562 mRNA. Translation: ACG55582.1 .
    EU887563 mRNA. Translation: ACG55583.1 .
    EU887564 mRNA. Translation: ACG55584.1 .
    EU887565 mRNA. Translation: ACG55585.1 .
    EU887566 mRNA. Translation: ACG55586.1 .
    AC018445 Genomic DNA. No translation available.
    AC023090 Genomic DNA. No translation available.
    CH471117 Genomic DNA. Translation: EAW66621.1 .
    CH471117 Genomic DNA. Translation: EAW66622.1 .
    BC104753 mRNA. Translation: AAI04754.1 .
    BC112243 mRNA. Translation: AAI12244.1 .
    CCDSi CCDS12015.1. [O95644-4 ]
    CCDS12016.1. [O95644-17 ]
    CCDS32850.1. [O95644-6 ]
    CCDS59326.1. [O95644-2 ]
    CCDS59327.1. [O95644-5 ]
    CCDS62467.1. [O95644-1 ]
    CCDS62468.1. [O95644-10 ]
    CCDS62469.1. [O95644-11 ]
    CCDS62470.1. [O95644-3 ]
    PIRi S45262.
    RefSeqi NP_001265598.1. NM_001278669.1. [O95644-1 ]
    NP_001265599.1. NM_001278670.1. [O95644-10 ]
    NP_001265601.1. NM_001278672.1. [O95644-11 ]
    NP_001265602.1. NM_001278673.1.
    NP_001265604.1. NM_001278675.1. [O95644-3 ]
    NP_006153.2. NM_006162.4. [O95644-4 ]
    NP_765975.1. NM_172387.2. [O95644-6 ]
    NP_765976.1. NM_172388.2. [O95644-17 ]
    NP_765977.1. NM_172389.2. [O95644-5 ]
    NP_765978.1. NM_172390.2. [O95644-2 ]
    UniGenei Hs.534074.
    Hs.701518.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1A66 NMR - A 414-591 [» ]
    1NFA NMR - A 416-591 [» ]
    ProteinModelPortali O95644.
    SMRi O95644. Positions 415-695.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110845. 24 interactions.
    DIPi DIP-44311N.
    IntActi O95644. 4 interactions.
    MINTi MINT-3319641.
    STRINGi 9606.ENSP00000327850.

    Chemistry

    BindingDBi O95644.
    ChEMBLi CHEMBL3876.

    PTM databases

    PhosphoSitei O95644.

    Proteomic databases

    MaxQBi O95644.
    PaxDbi O95644.
    PRIDEi O95644.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000253506 ; ENSP00000253506 ; ENSG00000131196 . [O95644-4 ]
    ENST00000318065 ; ENSP00000316553 ; ENSG00000131196 . [O95644-5 ]
    ENST00000329101 ; ENSP00000327850 ; ENSG00000131196 . [O95644-6 ]
    ENST00000397790 ; ENSP00000380892 ; ENSG00000131196 . [O95644-17 ]
    ENST00000427363 ; ENSP00000389377 ; ENSG00000131196 . [O95644-1 ]
    ENST00000542384 ; ENSP00000442435 ; ENSG00000131196 . [O95644-10 ]
    ENST00000586434 ; ENSP00000466489 ; ENSG00000131196 . [O95644-11 ]
    ENST00000591814 ; ENSP00000466194 ; ENSG00000131196 . [O95644-2 ]
    ENST00000592223 ; ENSP00000467181 ; ENSG00000131196 . [O95644-3 ]
    GeneIDi 4772.
    KEGGi hsa:4772.
    UCSCi uc002lnc.1. human.
    uc002lnd.3. human. [O95644-1 ]

    Organism-specific databases

    CTDi 4772.
    GeneCardsi GC18P077155.
    HGNCi HGNC:7775. NFATC1.
    HPAi CAB004513.
    MIMi 600489. gene.
    neXtProti NX_O95644.
    PharmGKBi PA31582.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG87292.
    HOGENOMi HOG000231780.
    HOVERGENi HBG069754.
    KOi K04446.
    OMAi HNNNQFF.
    OrthoDBi EOG79PJND.
    PhylomeDBi O95644.
    TreeFami TF326480.

    Enzyme and pathway databases

    Reactomei REACT_163834. FCERI mediated Ca+2 mobilization.
    REACT_172761. Ca2+ pathway.

    Miscellaneous databases

    ChiTaRSi NFATC1. human.
    EvolutionaryTracei O95644.
    GeneWikii NFATC1.
    GenomeRNAii 4772.
    NextBioi 18388.
    PROi O95644.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95644.
    Bgeei O95644.
    CleanExi HS_NFATC1.
    Genevestigatori O95644.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    2.60.40.340. 1 hit.
    InterProi IPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR008366. NFAT.
    IPR015647. NFAT1.
    IPR008967. p53-like_TF_DNA-bd.
    IPR011539. RHD.
    [Graphical view ]
    PANTHERi PTHR12533. PTHR12533. 1 hit.
    PTHR12533:SF5. PTHR12533:SF5. 1 hit.
    Pfami PF00554. RHD. 1 hit.
    PF01833. TIG. 1 hit.
    [Graphical view ]
    PRINTSi PR01789. NUCFACTORATC.
    SMARTi SM00429. IPT. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49417. SSF49417. 1 hit.
    SSF81296. SSF81296. 1 hit.
    PROSITEi PS50254. REL_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "NF-AT components define a family of transcription factors targeted in T-cell activation."
      Northrop J.P., Ho S.N., Chen L., Thomas D.J., Timmerman L.A., Nolan G.P., Admon A., Crabtree G.R.
      Nature 369:497-502(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A-ALPHA).
      Tissue: Peripheral blood lymphocyte and T-cell.
    2. "Characterization of a new isoform of the NFAT (nuclear factor of activated T cells) gene family member NFATc."
      Park J., Takeuchi A., Sharma S.
      J. Biol. Chem. 271:20914-20921(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B-BETA).
      Tissue: B-cell.
    3. Erratum
      Park J., Takeuchi A., Sharma S.
      J. Biol. Chem. 271:33705-33705(1996)
    4. "Alternative polyadenylation events contribute to the induction of NF-ATc in effector T cells."
      Chuvpilo S., Zimmer M., Kerstan A., Gloeckner J., Avots A., Escher C., Fischer C., Inashkina I., Jankevics E., Berberich-Siebelt F., Schmitt E., Serfling E.
      Immunity 10:261-269(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A-ALPHA; B-ALPHA AND C-BETA).
      Tissue: B-cell lymphoma.
    5. "Alternative splicing and expression of human and mouse NFAT genes."
      Vihma H., Pruunsild P., Timmusk T.
      Genomics 92:279-291(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS C-ALPHA; IA-DELTAIX AND IB-DELTAIX), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A-ALPHA).
      Tissue: Brain.
    9. "Expression of NFAT-family proteins in normal human T cells."
      Lyakh L., Ghosh P., Rice N.R.
      Mol. Cell. Biol. 17:2475-2484(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION OF ISOFORM A-ALPHA'.
    10. "Nuclear export of NF-ATc enhanced by glycogen synthase kinase-3."
      Beals C.R., Sheridan C.M., Turck C.W., Gardner P., Crabtree G.R.
      Science 275:1930-1934(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION BY GSK3B.
    11. "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT."
      Crabtree G.R.
      Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    12. "Multiple NF-ATc isoforms with individual transcriptional properties are synthesized in T lymphocytes."
      Chuvpilo S., Avots A., Berberich-Siebelt F., Gloeckner J., Fischer C., Kerstan A., Escher C., Inashkina I., Hlubek F., Jankevics E., Brabletz T., Serfling E.
      J. Immunol. 162:7294-7301(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, CHARACTERIZATION.
    13. "Identification of amino acid residues and protein kinases involved in the regulation of NFATc subcellular localization."
      Porter C.M., Havens M.A., Clipstone N.A.
      J. Biol. Chem. 275:3543-3551(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: MUTAGENESIS OF SER-172 AND SER-187.
    14. "Protein kinase A negatively modulates the nuclear accumulation of NF-ATc1 by priming for subsequent phosphorylation by glycogen synthase kinase-3."
      Sheridan C.M., Heist E.K., Beals C.R., Crabtree G.R., Gardner P.
      J. Biol. Chem. 277:48664-48676(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT SER-245; SER-269 AND SER-294.
    15. "A genome-wide Drosophila RNAi screen identifies DYRK-family kinases as regulators of NFAT."
      Gwack Y., Sharma S., Nardone J., Tanasa B., Iuga A., Srikanth S., Okamura H., Bolton D., Feske S., Hogan P.G., Rao A.
      Nature 441:646-650(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION.
    16. "Unusual Rel-like architecture in the DNA-binding domain of the transcription factor NFATc."
      Wolfe S.A., Zhou P., Dotsch V., Chen L., You A., Ho S.N., Crabtree G.R., Wagner G., Verdine G.L.
      Nature 385:172-176(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 416-591.
    17. "Solution structure of the core NFATC1/DNA complex."
      Zhou P., Sun L.J., Dotsch V., Wagner G., Verdine G.L.
      Cell 92:687-696(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 416-591 IN COMPLEX WITH DNA.
    18. Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-315.

    Entry informationi

    Entry nameiNFAC1_HUMAN
    AccessioniPrimary (citable) accession number: O95644
    Secondary accession number(s): B5B2M4
    , B5B2M5, B5B2M6, B5B2M7, B5B2M8, B5B2M9, B5B2N1, Q12865, Q15793, Q2M1S3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: December 1, 2000
    Last modified: October 1, 2014
    This is version 157 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 18
      Human chromosome 18: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3