Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor of activated T-cells, cytoplasmic 1

Gene

NFATC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells (PubMed:10358178). Required for osteoclastogenesis and regulates many genes important for osteoclast differentiation and function (By similarity).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi439 – 4468

GO - Molecular functioni

GO - Biological processi

  • calcineurin-NFAT signaling cascade Source: UniProtKB
  • Fc-epsilon receptor signaling pathway Source: Reactome
  • intracellular signal transduction Source: MGI
  • negative regulation of Wnt signaling pathway Source: ParkinsonsUK-UCL
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • transcription from RNA polymerase II promoter Source: ProtInc
  • Wnt signaling pathway, calcium modulating pathway Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000131196-MONOMER.
ReactomeiR-HSA-2871809. FCERI mediated Ca+2 mobilization.
R-HSA-4086398. Ca2+ pathway.
R-HSA-5607763. CLEC7A (Dectin-1) induces NFAT activation.
SIGNORiO95644.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 1
Short name:
NF-ATc1
Short name:
NFATc1
Alternative name(s):
NFAT transcription complex cytosolic component
Short name:
NF-ATc
Short name:
NFATc
Gene namesi
Name:NFATC1
Synonyms:NFAT2, NFATC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:7775. NFATC1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: BHF-UCL
  • cytosol Source: Reactome
  • nuclear chromatin Source: BHF-UCL
  • nucleoplasm Source: Reactome
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi169S → A: No effect on subcellular localization. 1
Mutagenesisi172S → A: Partial nuclear translocation. 1 Publication1
Mutagenesisi187S → A: No effect on subcellular localization. 1 Publication1

Organism-specific databases

DisGeNETi4772.
OpenTargetsiENSG00000131196.
PharmGKBiPA31582.

Chemistry databases

ChEMBLiCHEMBL3876.
DrugBankiDB00852. Pseudoephedrine.

Polymorphism and mutation databases

BioMutaiNFATC1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000303291 – 943Nuclear factor of activated T-cells, cytoplasmic 1Add BLAST943

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei233PhosphoserineCombined sources1
Modified residuei237PhosphoserineBy similarity1
Modified residuei245Phosphoserine; by PKA1 Publication1
Modified residuei269Phosphoserine; by PKA1 Publication1
Modified residuei294Phosphoserine; by PKA1 Publication1

Post-translational modificationi

Phosphorylated by NFATC-kinase and GSK3B; phosphorylation induces NFATC1 nuclear exit and dephosphorylation by calcineurin promotes nuclear import. Phosphorylation by PKA and DYRK2 negatively modulates nuclear accumulation, and promotes subsequent phosphorylation by GSK3B or casein kinase 1.3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO95644.
PaxDbiO95644.
PeptideAtlasiO95644.
PRIDEiO95644.

PTM databases

iPTMnetiO95644.
PhosphoSitePlusiO95644.

Expressioni

Tissue specificityi

Expressed in thymus, peripheral leukocytes as T-cells and spleen. Isoforms A are preferentially expressed in effector T-cells (thymus and peripheral leukocytes) whereas isoforms B and isoforms C are preferentially expressed in naive T-cells (spleen). Isoforms B are expressed in naive T-cells after first antigen exposure and isoforms A are expressed in effector T-cells after second antigen exposure. Isoforms IA are widely expressed but not detected in liver nor pancreas, neural expression is strongest in corpus callosum. Isoforms IB are expressed mostly in muscle, cerebellum, placenta and thymus, neural expression in fetal and adult brain, strongest in corpus callosum.1 Publication

Inductioni

Only isoforms A are inducibly expressed in T lymphocytes upon activation of the T-cell receptor (TCR) complex. Induced after co-addition of phorbol 12-myristate 13-acetate (PMA) and ionomycin. Also induced after co-addition of 12-O-tetradecanoylphorbol-13-acetate (TPA) and ionomycin. Weakly induced with PMA, ionomycin and cyclosporin A.

Gene expression databases

BgeeiENSG00000131196.
CleanExiHS_NFATC1.
ExpressionAtlasiO95644. baseline and differential.
GenevisibleiO95644. HS.

Organism-specific databases

HPAiCAB004513.

Interactioni

Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ATF1P188463EBI-6907210,EBI-852794
ATF2P153362EBI-6907210,EBI-1170906
ATF3P188472EBI-6907210,EBI-712767
CREB1P162203EBI-6907210,EBI-711855
HOXC13P312762EBI-6907210,EBI-2293590
JUNP054125EBI-6907210,EBI-852823
OGTO152942EBI-6907210,EBI-539828

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110845. 78 interactors.
DIPiDIP-44311N.
IntActiO95644. 46 interactors.
MINTiMINT-3319641.
STRINGi9606.ENSP00000327850.

Structurei

Secondary structure

1943
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi426 – 432Combined sources7
Beta strandi443 – 445Combined sources3
Beta strandi454 – 456Combined sources3
Beta strandi460 – 465Combined sources6
Beta strandi468 – 470Combined sources3
Beta strandi472 – 480Combined sources9
Beta strandi483 – 485Combined sources3
Beta strandi509 – 511Combined sources3
Beta strandi514 – 521Combined sources8
Beta strandi523 – 525Combined sources3
Helixi541 – 545Combined sources5
Beta strandi551 – 553Combined sources3
Beta strandi559 – 570Combined sources12
Turni571 – 573Combined sources3
Beta strandi574 – 586Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A66NMR-A414-591[»]
1NFANMR-A416-591[»]
ProteinModelPortaliO95644.
SMRiO95644.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95644.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati203 – 2191Add BLAST17
Repeati233 – 2492Add BLAST17
Repeati282 – 2983Add BLAST17
Domaini410 – 592RHDPROSITE-ProRule annotationAdd BLAST183

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni118 – 123Calcineurin-binding6
Regioni126 – 218Trans-activation domain A (TAD-A)Add BLAST93
Regioni203 – 2983 X SP repeatsAdd BLAST96
Regioni703 – 943Trans-activation domain B (TAD-B)Add BLAST241

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi265 – 267Nuclear localization signal3
Motifi310 – 321Nuclear export signalAdd BLAST12
Motifi682 – 684Nuclear localization signal3
Motifi924 – 933Nuclear export signal10

Domaini

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.
The N-terminal transactivation domain (TAD-A) binds to and is activated by Cbp/p300. The dephosphorylated form contains two unmasked nuclear localization signals (NLS), which allow translocation of the protein to the nucleus.
Isoforms C have a C-terminal part with an additional trans-activation domain, TAD-B, which acts as a transcriptional activator. Isoforms B have a shorter C-terminal part without complete TAD-B which acts as a transcriptional repressor.

Sequence similaritiesi

Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IHFR. Eukaryota.
ENOG41105U2. LUCA.
GeneTreeiENSGT00550000074562.
HOGENOMiHOG000231780.
HOVERGENiHBG069754.
InParanoidiO95644.
KOiK04446.
OMAiHNNNQFF.
OrthoDBiEOG091G01QP.
PhylomeDBiO95644.
TreeFamiTF326480.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR015647. NFAT1.
IPR008967. p53-like_TF_DNA-bd.
IPR032397. RHD_dimer.
IPR011539. RHD_DNA_bind_dom.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PTHR12533:SF5. PTHR12533:SF5. 1 hit.
PfamiPF16179. RHD_dimer. 1 hit.
PF00554. RHD_DNA_bind. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

Note: Isoform C-alpha and isoform C-beta are the strongest activator of gene transcription, followed by isoform A-alpha and isoform A-beta, whereas isoform B-alpha and isoform B-beta are the weakest. Isoform B-alpha, isoform B-beta, isoform C-alpha and isoform C-beta, both present in T-cells, can modulate their transcriptional activity.
Isoform C-alpha (identifier: O95644-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSTSFPVPS KFPLGPAAAV FGRGETLGPA PRAGGTMKSA EEEHYGYASS
60 70 80 90 100
NVSPALPLPT AHSTLPAPCH NLQTSTPGII PPADHPSGYG AALDGGPAGY
110 120 130 140 150
FLSSGHTRPD GAPALESPRI EITSCLGLYH NNNQFFHDVE VEDVLPSSKR
160 170 180 190 200
SPSTATLSLP SLEAYRDPSC LSPASSLSSR SCNSEASSYE SNYSYPYASP
210 220 230 240 250
QTSPWQSPCV SPKTTDPEEG FPRGLGACTL LGSPRHSPST SPRASVTEES
260 270 280 290 300
WLGARSSRPA SPCNKRKYSL NGRQPPYSPH HSPTPSPHGS PRVSVTDDSW
310 320 330 340 350
LGNTTQYTSS AIVAAINALT TDSSLDLGDG VPVKSRKTTL EQPPSVALKV
360 370 380 390 400
EPVGEDLGSP PPPADFAPED YSSFQHIRKG GFCDQYLAVP QHPYQWAKPK
410 420 430 440 450
PLSPTSYMSP TLPALDWQLP SHSGPYELRI EVQPKSHHRA HYETEGSRGA
460 470 480 490 500
VKASAGGHPI VQLHGYLENE PLMLQLFIGT ADDRLLRPHA FYQVHRITGK
510 520 530 540 550
TVSTTSHEAI LSNTKVLEIP LLPENSMRAV IDCAGILKLR NSDIELRKGE
560 570 580 590 600
TDIGRKNTRV RLVFRVHVPQ PSGRTLSLQV ASNPIECSQR SAQELPLVEK
610 620 630 640 650
QSTDSYPVVG GKKMVLSGHN FLQDSKVIFV EKAPDGHHVW EMEAKTDRDL
660 670 680 690 700
CKPNSLVVEI PPFRNQRITS PVHVSFYVCN GKRKRSQYQR FTYLPANVPI
710 720 730 740 750
IKTEPTDDYE PAPTCGPVSQ GLSPLPRPYY SQQLAMPPDP SSCLVAGFPP
760 770 780 790 800
CPQRSTLMPA APGVSPKLHD LSPAAYTKGV ASPGHCHLGL PQPAGEAPAV
810 820 830 840 850
QDVPRPVATH PGSPGQPPPA LLPQQVSAPP SSSCPPGLEH SLCPSSPSPP
860 870 880 890 900
LPPATQEPTC LQPCSPACPP ATGRPQHLPS TVRRDESPTA GPRLLPEVHE
910 920 930 940
DGSPNLAPIP VTVKREPEEL DQLYLDDVNE IIRNDLSSTS THS
Length:943
Mass (Da):101,243
Last modified:December 1, 2000 - v3
Checksum:iE72FAB10ECEB2D66
GO
Isoform A-alpha (identifier: O95644-2) [UniParc]FASTAAdd to basket
Also known as: IA-VIII

The sequence of this isoform differs from the canonical sequence as follows:
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.

Show »
Length:716
Mass (Da):77,785
Checksum:iC02F3B03F2019BB1
GO
Isoform A-beta (identifier: O95644-3) [UniParc]FASTAAdd to basket
Also known as: IB-VIII

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.

Show »
Length:703
Mass (Da):76,879
Checksum:i57650B6E2A9A219C
GO
Isoform B-alpha (identifier: O95644-4) [UniParc]FASTAAdd to basket
Also known as: IA-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     826-943: Missing.

Show »
Length:825
Mass (Da):88,763
Checksum:i28469C5BE89B00CC
GO
Isoform B-beta (identifier: O95644-5) [UniParc]FASTAAdd to basket
Also known as: IB-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     826-943: Missing.

Show »
Length:812
Mass (Da):87,857
Checksum:iDBF68E35846E998D
GO
Isoform C-beta (identifier: O95644-6) [UniParc]FASTAAdd to basket
Also known as: IB-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP

Show »
Length:930
Mass (Da):100,336
Checksum:i8708706F1C8938AC
GO
Isoform A-alpha' (identifier: O95644-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.

Note: Produced by alternative initiation at Met-37 of isoform A-alpha. No experimental confirmation available.
Show »
Length:680
Mass (Da):74,276
Checksum:iD9D7060FEB4E81DF
GO
Isoform IA-deltaIX (identifier: O95644-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     698-927: Missing.

Show »
Length:713
Mass (Da):77,376
Checksum:iB797CFCFF28F8976
GO
Isoform IB-deltaIX (identifier: O95644-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     698-927: Missing.

Show »
Length:700
Mass (Da):76,469
Checksum:i4A4F5475DF755F89
GO
Isoform 10 (identifier: O95644-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-472: Missing.
     826-943: Missing.

Note: No experimental evidence available.
Show »
Length:353
Mass (Da):38,626
Checksum:iAB8DEB0C451190DD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti232G → S in AAC50869 (PubMed:8702849).Curated1
Sequence conflicti235R → Q in AAA19601 (PubMed:8202141).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05714568P → T.Corresponds to variant rs1051978dbSNPEnsembl.1
Natural variantiVAR_036529315A → T in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant rs779866756dbSNPEnsembl.1
Natural variantiVAR_057146751C → G.Corresponds to variant rs754093dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0538061 – 472Missing in isoform 10. CuratedAdd BLAST472
Alternative sequenceiVSP_0055901 – 42MPSTS…KSAEE → MTGLEDQEFDFEFLFEFNQR DEGAAAAAP in isoform A-beta, isoform B-beta, isoform C-beta and isoform IB-deltaIX. 3 PublicationsAdd BLAST42
Alternative sequenceiVSP_0189781 – 36Missing in isoform A-alpha'. CuratedAdd BLAST36
Alternative sequenceiVSP_047820698 – 927Missing in isoform IA-deltaIX and isoform IB-deltaIX. 1 PublicationAdd BLAST230
Alternative sequenceiVSP_005591698 – 716VPIIK…APTCG → GNAIFLTVSREHERVGCFF in isoform A-alpha, isoform A-alpha' and isoform A-beta. 3 PublicationsAdd BLAST19
Alternative sequenceiVSP_005592717 – 943Missing in isoform A-alpha, isoform A-alpha' and isoform A-beta. 3 PublicationsAdd BLAST227
Alternative sequenceiVSP_005593826 – 943Missing in isoform B-alpha, isoform B-beta and isoform 10. 2 PublicationsAdd BLAST118

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08015 mRNA. Translation: AAA19601.1.
U59736 mRNA. Translation: AAC50869.1.
U80917 mRNA. Translation: AAD00450.1.
U80918 mRNA. Translation: AAD00451.1.
U80919 mRNA. Translation: AAD00452.1.
EU887559 mRNA. Translation: ACG55579.1.
EU887560 mRNA. Translation: ACG55580.1.
EU887561 mRNA. Translation: ACG55581.1.
EU887562 mRNA. Translation: ACG55582.1.
EU887563 mRNA. Translation: ACG55583.1.
EU887564 mRNA. Translation: ACG55584.1.
EU887565 mRNA. Translation: ACG55585.1.
EU887566 mRNA. Translation: ACG55586.1.
AC018445 Genomic DNA. No translation available.
AC023090 Genomic DNA. No translation available.
CH471117 Genomic DNA. Translation: EAW66621.1.
CH471117 Genomic DNA. Translation: EAW66622.1.
BC104753 mRNA. Translation: AAI04754.1.
BC112243 mRNA. Translation: AAI12244.1.
CCDSiCCDS12015.1. [O95644-4]
CCDS12016.1. [O95644-17]
CCDS32850.1. [O95644-6]
CCDS59326.1. [O95644-2]
CCDS59327.1. [O95644-5]
CCDS62467.1. [O95644-1]
CCDS62468.1. [O95644-10]
CCDS62469.1. [O95644-11]
CCDS62470.1. [O95644-3]
PIRiS45262.
RefSeqiNP_001265598.1. NM_001278669.1. [O95644-1]
NP_001265599.1. NM_001278670.1. [O95644-10]
NP_001265601.1. NM_001278672.1. [O95644-11]
NP_001265602.1. NM_001278673.1.
NP_001265604.1. NM_001278675.1. [O95644-3]
NP_006153.2. NM_006162.4. [O95644-4]
NP_765975.1. NM_172387.2. [O95644-6]
NP_765976.1. NM_172388.2. [O95644-17]
NP_765977.1. NM_172389.2. [O95644-5]
NP_765978.1. NM_172390.2. [O95644-2]
UniGeneiHs.534074.
Hs.701518.

Genome annotation databases

EnsembliENST00000253506; ENSP00000253506; ENSG00000131196. [O95644-4]
ENST00000318065; ENSP00000316553; ENSG00000131196. [O95644-5]
ENST00000329101; ENSP00000327850; ENSG00000131196. [O95644-6]
ENST00000397790; ENSP00000380892; ENSG00000131196. [O95644-17]
ENST00000427363; ENSP00000389377; ENSG00000131196. [O95644-1]
ENST00000542384; ENSP00000442435; ENSG00000131196. [O95644-10]
ENST00000586434; ENSP00000466489; ENSG00000131196. [O95644-11]
ENST00000591814; ENSP00000466194; ENSG00000131196. [O95644-2]
ENST00000592223; ENSP00000467181; ENSG00000131196. [O95644-3]
GeneIDi4772.
KEGGihsa:4772.
UCSCiuc002lnc.3. human. [O95644-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08015 mRNA. Translation: AAA19601.1.
U59736 mRNA. Translation: AAC50869.1.
U80917 mRNA. Translation: AAD00450.1.
U80918 mRNA. Translation: AAD00451.1.
U80919 mRNA. Translation: AAD00452.1.
EU887559 mRNA. Translation: ACG55579.1.
EU887560 mRNA. Translation: ACG55580.1.
EU887561 mRNA. Translation: ACG55581.1.
EU887562 mRNA. Translation: ACG55582.1.
EU887563 mRNA. Translation: ACG55583.1.
EU887564 mRNA. Translation: ACG55584.1.
EU887565 mRNA. Translation: ACG55585.1.
EU887566 mRNA. Translation: ACG55586.1.
AC018445 Genomic DNA. No translation available.
AC023090 Genomic DNA. No translation available.
CH471117 Genomic DNA. Translation: EAW66621.1.
CH471117 Genomic DNA. Translation: EAW66622.1.
BC104753 mRNA. Translation: AAI04754.1.
BC112243 mRNA. Translation: AAI12244.1.
CCDSiCCDS12015.1. [O95644-4]
CCDS12016.1. [O95644-17]
CCDS32850.1. [O95644-6]
CCDS59326.1. [O95644-2]
CCDS59327.1. [O95644-5]
CCDS62467.1. [O95644-1]
CCDS62468.1. [O95644-10]
CCDS62469.1. [O95644-11]
CCDS62470.1. [O95644-3]
PIRiS45262.
RefSeqiNP_001265598.1. NM_001278669.1. [O95644-1]
NP_001265599.1. NM_001278670.1. [O95644-10]
NP_001265601.1. NM_001278672.1. [O95644-11]
NP_001265602.1. NM_001278673.1.
NP_001265604.1. NM_001278675.1. [O95644-3]
NP_006153.2. NM_006162.4. [O95644-4]
NP_765975.1. NM_172387.2. [O95644-6]
NP_765976.1. NM_172388.2. [O95644-17]
NP_765977.1. NM_172389.2. [O95644-5]
NP_765978.1. NM_172390.2. [O95644-2]
UniGeneiHs.534074.
Hs.701518.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A66NMR-A414-591[»]
1NFANMR-A416-591[»]
ProteinModelPortaliO95644.
SMRiO95644.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110845. 78 interactors.
DIPiDIP-44311N.
IntActiO95644. 46 interactors.
MINTiMINT-3319641.
STRINGi9606.ENSP00000327850.

Chemistry databases

ChEMBLiCHEMBL3876.
DrugBankiDB00852. Pseudoephedrine.

PTM databases

iPTMnetiO95644.
PhosphoSitePlusiO95644.

Polymorphism and mutation databases

BioMutaiNFATC1.

Proteomic databases

MaxQBiO95644.
PaxDbiO95644.
PeptideAtlasiO95644.
PRIDEiO95644.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000253506; ENSP00000253506; ENSG00000131196. [O95644-4]
ENST00000318065; ENSP00000316553; ENSG00000131196. [O95644-5]
ENST00000329101; ENSP00000327850; ENSG00000131196. [O95644-6]
ENST00000397790; ENSP00000380892; ENSG00000131196. [O95644-17]
ENST00000427363; ENSP00000389377; ENSG00000131196. [O95644-1]
ENST00000542384; ENSP00000442435; ENSG00000131196. [O95644-10]
ENST00000586434; ENSP00000466489; ENSG00000131196. [O95644-11]
ENST00000591814; ENSP00000466194; ENSG00000131196. [O95644-2]
ENST00000592223; ENSP00000467181; ENSG00000131196. [O95644-3]
GeneIDi4772.
KEGGihsa:4772.
UCSCiuc002lnc.3. human. [O95644-1]

Organism-specific databases

CTDi4772.
DisGeNETi4772.
GeneCardsiNFATC1.
HGNCiHGNC:7775. NFATC1.
HPAiCAB004513.
MIMi600489. gene.
neXtProtiNX_O95644.
OpenTargetsiENSG00000131196.
PharmGKBiPA31582.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHFR. Eukaryota.
ENOG41105U2. LUCA.
GeneTreeiENSGT00550000074562.
HOGENOMiHOG000231780.
HOVERGENiHBG069754.
InParanoidiO95644.
KOiK04446.
OMAiHNNNQFF.
OrthoDBiEOG091G01QP.
PhylomeDBiO95644.
TreeFamiTF326480.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000131196-MONOMER.
ReactomeiR-HSA-2871809. FCERI mediated Ca+2 mobilization.
R-HSA-4086398. Ca2+ pathway.
R-HSA-5607763. CLEC7A (Dectin-1) induces NFAT activation.
SIGNORiO95644.

Miscellaneous databases

ChiTaRSiNFATC1. human.
EvolutionaryTraceiO95644.
GeneWikiiNFATC1.
GenomeRNAii4772.
PROiO95644.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000131196.
CleanExiHS_NFATC1.
ExpressionAtlasiO95644. baseline and differential.
GenevisibleiO95644. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR015647. NFAT1.
IPR008967. p53-like_TF_DNA-bd.
IPR032397. RHD_dimer.
IPR011539. RHD_DNA_bind_dom.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PTHR12533:SF5. PTHR12533:SF5. 1 hit.
PfamiPF16179. RHD_dimer. 1 hit.
PF00554. RHD_DNA_bind. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNFAC1_HUMAN
AccessioniPrimary (citable) accession number: O95644
Secondary accession number(s): B5B2M4
, B5B2M5, B5B2M6, B5B2M7, B5B2M8, B5B2M9, B5B2N1, Q12865, Q15793, Q2M1S3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: December 1, 2000
Last modified: November 30, 2016
This is version 179 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.