Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95644 (NFAC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 155. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Nuclear factor of activated T-cells, cytoplasmic 1

Short name=NF-ATc1
Short name=NFATc1
Alternative name(s):
NFAT transcription complex cytosolic component
Short name=NF-ATc
Short name=NFATc
Gene names
Name:NFATC1
Synonyms:NFAT2, NFATC
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length943 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells.

Subunit structure

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.

Subcellular location

Cytoplasm. Nucleus. Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. Ref.15

Tissue specificity

Expressed in thymus, peripheral leukocytes as T-cells and spleen. Isoforms A are preferentially expressed in effector T-cells (thymus and peripheral leukocytes) whereas isoforms B and isoforms C are preferentially expressed in naive T-cells (spleen). Isoforms B are expressed in naive T-cells after first antigen exposure and isoforms A are expressed in effector T-cells after second antigen exposure. Isoforms IA are widely expressed but not detected in liver nor pancreas, neural expression is strongest in corpus callosum. Isoforms IB are expressed mostly in muscle, cerebellum, placenta and thymus, neural expression in fetal and adult brain, strongest in corpus callosum. Ref.5

Induction

Only isoforms A are inducibly expressed in T lymphocytes upon activation of the T-cell receptor (TCR) complex. Induced after co-addition of phorbol 12-myristate 13-acetate (PMA) and ionomycin. Also induced after co-addition of 12-O-tetradecanoylphorbol-13-acetate (TPA) and ionomycin. Weakly induced with PMA, ionomycin and cyclosporin A.

Domain

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.

The N-terminal transactivation domain (TAD-A) binds to and is activated by Cbp/p300. The dephosphorylated form contains two unmasked nuclear localization signals (NLS), which allow translocation of the protein to the nucleus.

Isoforms C have a C-terminal part with an additional trans-activation domain, TAD-B, which acts as a transcriptional activator. Isoforms B have a shorter C-terminal part without complete TAD-B which acts as a transcriptional repressor.

Post-translational modification

Phosphorylated by NFATC-kinase and GSK3B; phosphorylation induces NFATC1 nuclear exit and dephosphorylation by calcineurin promotes nuclear import. Phosphorylation by PKA and DYRK2 negatively modulates nuclear accumulation, and promotes subsequent phosphorylation by GSK3B or casein kinase 1. Ref.10 Ref.14 Ref.15

Sequence similarities

Contains 1 RHD (Rel-like) domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative initiation
Alternative splicing
Polymorphism
   DomainRepeat
   LigandDNA-binding
   Molecular functionActivator
Repressor
   PTMPhosphoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processFc-epsilon receptor signaling pathway

Traceable author statement. Source: Reactome

G1/S transition of mitotic cell cycle

Inferred from electronic annotation. Source: Ensembl

calcium ion transport

Inferred from electronic annotation. Source: Ensembl

epithelial to mesenchymal transition

Inferred from electronic annotation. Source: Ensembl

heart development

Inferred from electronic annotation. Source: Ensembl

innate immune response

Traceable author statement. Source: Reactome

intracellular signal transduction

Inferred from direct assay PubMed 14749367. Source: MGI

osteoclast differentiation

Inferred from electronic annotation. Source: Ensembl

positive regulation of transcription from RNA polymerase II promoter

Inferred from sequence or structural similarity. Source: BHF-UCL

positive regulation of transcription, DNA-templated

Inferred from direct assay PubMed 1497875. Source: UniProtKB

transcription from RNA polymerase II promoter

Traceable author statement Ref.2. Source: ProtInc

   Cellular_componentcytoplasm

Inferred from sequence or structural similarity. Source: BHF-UCL

cytosol

Traceable author statement. Source: Reactome

nuclear chromatin

Inferred from direct assay PubMed 15304486. Source: BHF-UCL

nucleoplasm

Traceable author statement. Source: Reactome

transcription factor complex

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionFK506 binding

Traceable author statement Ref.2. Source: ProtInc

RNA polymerase II distal enhancer sequence-specific DNA binding

Inferred from sequence or structural similarity. Source: BHF-UCL

RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity

Inferred from sequence or structural similarity. Source: BHF-UCL

RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription

Inferred from sequence or structural similarity. Source: BHF-UCL

RNA polymerase II transcription factor binding

Inferred from sequence or structural similarity. Source: BHF-UCL

mitogen-activated protein kinase p38 binding

Inferred from sequence or structural similarity. Source: BHF-UCL

protein binding

Inferred from physical interaction PubMed 14979875. Source: UniProtKB

sequence-specific DNA binding transcription factor activity

Traceable author statement PubMed 10821850Ref.17. Source: ProtInc

transcription regulatory region DNA binding

Inferred from direct assay PubMed 14979875. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

OGTO152942EBI-6907210,EBI-539828

Alternative products

This entry describes 10 isoforms produced by alternative splicing and alternative initiation. [Align] [Select]

Note: Isoform C-alpha and isoform C-beta are the strongest activator of gene transcription, followed by isoform A-alpha and isoform A-beta, whereas isoform B-alpha and isoform B-beta are the weakest. Isoform B-alpha, isoform B-beta, isoform C-alpha and isoform C-beta, both present in T-cells, can modulate their transcriptional activity.
Isoform C-alpha (identifier: O95644-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform A-alpha (identifier: O95644-2)

Also known as: IA-VIII;

The sequence of this isoform differs from the canonical sequence as follows:
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.
Isoform A-beta (identifier: O95644-3)

Also known as: IB-VIII;

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.
Isoform B-alpha (identifier: O95644-4)

Also known as: IA-IXS;

The sequence of this isoform differs from the canonical sequence as follows:
     826-943: Missing.
Isoform B-beta (identifier: O95644-5)

Also known as: IB-IXS;

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     826-943: Missing.
Isoform C-beta (identifier: O95644-6)

Also known as: IB-IXL;

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
Isoform A-alpha' (identifier: O95644-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.
Note: Produced by alternative initiation at Met-37 of isoform A-alpha. No experimental confirmation available.
Isoform IA-deltaIX (identifier: O95644-10)

The sequence of this isoform differs from the canonical sequence as follows:
     698-927: Missing.
Isoform IB-deltaIX (identifier: O95644-11)

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     698-927: Missing.
Isoform 10 (identifier: O95644-17)

The sequence of this isoform differs from the canonical sequence as follows:
     1-472: Missing.
     826-943: Missing.
Note: No experimental evidence available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 943943Nuclear factor of activated T-cells, cytoplasmic 1
PRO_0000030329

Regions

Repeat203 – 219171
Repeat233 – 249172
Repeat282 – 298173
Domain410 – 592183RHD
DNA binding439 – 4468
Region118 – 1236Calcineurin-binding
Region126 – 21893Trans-activation domain A (TAD-A)
Region203 – 298963 X SP repeats
Region703 – 943241Trans-activation domain B (TAD-B)
Motif265 – 2673Nuclear localization signal
Motif310 – 32112Nuclear export signal
Motif682 – 6843Nuclear localization signal
Motif924 – 93310Nuclear export signal

Amino acid modifications

Modified residue2451Phosphoserine; by PKA Ref.14
Modified residue2691Phosphoserine; by PKA Ref.14
Modified residue2941Phosphoserine; by PKA Ref.14

Natural variations

Alternative sequence1 – 472472Missing in isoform 10.
VSP_053806
Alternative sequence1 – 4242MPSTS…KSAEE → MTGLEDQEFDFEFLFEFNQR DEGAAAAAP in isoform A-beta, isoform B-beta, isoform C-beta and isoform IB-deltaIX.
VSP_005590
Alternative sequence1 – 3636Missing in isoform A-alpha'.
VSP_018978
Alternative sequence698 – 927230Missing in isoform IA-deltaIX and isoform IB-deltaIX.
VSP_047820
Alternative sequence698 – 71619VPIIK…APTCG → GNAIFLTVSREHERVGCFF in isoform A-alpha, isoform A-alpha' and isoform A-beta.
VSP_005591
Alternative sequence717 – 943227Missing in isoform A-alpha, isoform A-alpha' and isoform A-beta.
VSP_005592
Alternative sequence826 – 943118Missing in isoform B-alpha, isoform B-beta and isoform 10.
VSP_005593
Natural variant681P → T.
Corresponds to variant rs1051978 [ dbSNP | Ensembl ].
VAR_057145
Natural variant3151A → T in a colorectal cancer sample; somatic mutation. Ref.18
VAR_036529
Natural variant7511C → G.
Corresponds to variant rs754093 [ dbSNP | Ensembl ].
VAR_057146

Experimental info

Mutagenesis1691S → A: No effect on subcellular localization.
Mutagenesis1721S → A: Partial nuclear translocation. Ref.13
Mutagenesis1871S → A: No effect on subcellular localization. Ref.13
Sequence conflict2321G → S in AAC50869. Ref.2
Sequence conflict2351R → Q in AAA19601. Ref.1

Secondary structure

............................. 943
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform C-alpha [UniParc].

Last modified December 1, 2000. Version 3.
Checksum: E72FAB10ECEB2D66

FASTA943101,243
        10         20         30         40         50         60 
MPSTSFPVPS KFPLGPAAAV FGRGETLGPA PRAGGTMKSA EEEHYGYASS NVSPALPLPT 

        70         80         90        100        110        120 
AHSTLPAPCH NLQTSTPGII PPADHPSGYG AALDGGPAGY FLSSGHTRPD GAPALESPRI 

       130        140        150        160        170        180 
EITSCLGLYH NNNQFFHDVE VEDVLPSSKR SPSTATLSLP SLEAYRDPSC LSPASSLSSR 

       190        200        210        220        230        240 
SCNSEASSYE SNYSYPYASP QTSPWQSPCV SPKTTDPEEG FPRGLGACTL LGSPRHSPST 

       250        260        270        280        290        300 
SPRASVTEES WLGARSSRPA SPCNKRKYSL NGRQPPYSPH HSPTPSPHGS PRVSVTDDSW 

       310        320        330        340        350        360 
LGNTTQYTSS AIVAAINALT TDSSLDLGDG VPVKSRKTTL EQPPSVALKV EPVGEDLGSP 

       370        380        390        400        410        420 
PPPADFAPED YSSFQHIRKG GFCDQYLAVP QHPYQWAKPK PLSPTSYMSP TLPALDWQLP 

       430        440        450        460        470        480 
SHSGPYELRI EVQPKSHHRA HYETEGSRGA VKASAGGHPI VQLHGYLENE PLMLQLFIGT 

       490        500        510        520        530        540 
ADDRLLRPHA FYQVHRITGK TVSTTSHEAI LSNTKVLEIP LLPENSMRAV IDCAGILKLR 

       550        560        570        580        590        600 
NSDIELRKGE TDIGRKNTRV RLVFRVHVPQ PSGRTLSLQV ASNPIECSQR SAQELPLVEK 

       610        620        630        640        650        660 
QSTDSYPVVG GKKMVLSGHN FLQDSKVIFV EKAPDGHHVW EMEAKTDRDL CKPNSLVVEI 

       670        680        690        700        710        720 
PPFRNQRITS PVHVSFYVCN GKRKRSQYQR FTYLPANVPI IKTEPTDDYE PAPTCGPVSQ 

       730        740        750        760        770        780 
GLSPLPRPYY SQQLAMPPDP SSCLVAGFPP CPQRSTLMPA APGVSPKLHD LSPAAYTKGV 

       790        800        810        820        830        840 
ASPGHCHLGL PQPAGEAPAV QDVPRPVATH PGSPGQPPPA LLPQQVSAPP SSSCPPGLEH 

       850        860        870        880        890        900 
SLCPSSPSPP LPPATQEPTC LQPCSPACPP ATGRPQHLPS TVRRDESPTA GPRLLPEVHE 

       910        920        930        940 
DGSPNLAPIP VTVKREPEEL DQLYLDDVNE IIRNDLSSTS THS 

« Hide

Isoform A-alpha (IA-VIII) [UniParc].

Checksum: C02F3B03F2019BB1
Show »

FASTA71677,785
Isoform A-beta (IB-VIII) [UniParc].

Checksum: 57650B6E2A9A219C
Show »

FASTA70376,879
Isoform B-alpha (IA-IXS) [UniParc].

Checksum: 28469C5BE89B00CC
Show »

FASTA82588,763
Isoform B-beta (IB-IXS) [UniParc].

Checksum: DBF68E35846E998D
Show »

FASTA81287,857
Isoform C-beta (IB-IXL) [UniParc].

Checksum: 8708706F1C8938AC
Show »

FASTA930100,336
Isoform A-alpha' [UniParc].

Checksum: D9D7060FEB4E81DF
Show »

FASTA68074,276
Isoform IA-deltaIX [UniParc].

Checksum: B797CFCFF28F8976
Show »

FASTA71377,376
Isoform IB-deltaIX [UniParc].

Checksum: 4A4F5475DF755F89
Show »

FASTA70076,469
Isoform 10 [UniParc].

Checksum: AB8DEB0C451190DD
Show »

FASTA35338,626

References

« Hide 'large scale' references
[1]"NF-AT components define a family of transcription factors targeted in T-cell activation."
Northrop J.P., Ho S.N., Chen L., Thomas D.J., Timmerman L.A., Nolan G.P., Admon A., Crabtree G.R.
Nature 369:497-502(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A-ALPHA).
Tissue: Peripheral blood lymphocyte and T-cell.
[2]"Characterization of a new isoform of the NFAT (nuclear factor of activated T cells) gene family member NFATc."
Park J., Takeuchi A., Sharma S.
J. Biol. Chem. 271:20914-20921(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B-BETA).
Tissue: B-cell.
[3]Erratum
Park J., Takeuchi A., Sharma S.
J. Biol. Chem. 271:33705-33705(1996)
[4]"Alternative polyadenylation events contribute to the induction of NF-ATc in effector T cells."
Chuvpilo S., Zimmer M., Kerstan A., Gloeckner J., Avots A., Escher C., Fischer C., Inashkina I., Jankevics E., Berberich-Siebelt F., Schmitt E., Serfling E.
Immunity 10:261-269(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A-ALPHA; B-ALPHA AND C-BETA).
Tissue: B-cell lymphoma.
[5]"Alternative splicing and expression of human and mouse NFAT genes."
Vihma H., Pruunsild P., Timmusk T.
Genomics 92:279-291(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS C-ALPHA; IA-DELTAIX AND IB-DELTAIX), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
[6]"DNA sequence and analysis of human chromosome 18."
Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. expand/collapse author list , Cook A., DeCaprio D., Engels R., Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T., Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E., Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H., O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K., Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R., Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.
Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A-ALPHA).
Tissue: Brain.
[9]"Expression of NFAT-family proteins in normal human T cells."
Lyakh L., Ghosh P., Rice N.R.
Mol. Cell. Biol. 17:2475-2484(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION OF ISOFORM A-ALPHA'.
[10]"Nuclear export of NF-ATc enhanced by glycogen synthase kinase-3."
Beals C.R., Sheridan C.M., Turck C.W., Gardner P., Crabtree G.R.
Science 275:1930-1934(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION BY GSK3B.
[11]"Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT."
Crabtree G.R.
Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[12]"Multiple NF-ATc isoforms with individual transcriptional properties are synthesized in T lymphocytes."
Chuvpilo S., Avots A., Berberich-Siebelt F., Gloeckner J., Fischer C., Kerstan A., Escher C., Inashkina I., Hlubek F., Jankevics E., Brabletz T., Serfling E.
J. Immunol. 162:7294-7301(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING, CHARACTERIZATION.
[13]"Identification of amino acid residues and protein kinases involved in the regulation of NFATc subcellular localization."
Porter C.M., Havens M.A., Clipstone N.A.
J. Biol. Chem. 275:3543-3551(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: MUTAGENESIS OF SER-172 AND SER-187.
[14]"Protein kinase A negatively modulates the nuclear accumulation of NF-ATc1 by priming for subsequent phosphorylation by glycogen synthase kinase-3."
Sheridan C.M., Heist E.K., Beals C.R., Crabtree G.R., Gardner P.
J. Biol. Chem. 277:48664-48676(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION AT SER-245; SER-269 AND SER-294.
[15]"A genome-wide Drosophila RNAi screen identifies DYRK-family kinases as regulators of NFAT."
Gwack Y., Sharma S., Nardone J., Tanasa B., Iuga A., Srikanth S., Okamura H., Bolton D., Feske S., Hogan P.G., Rao A.
Nature 441:646-650(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION.
[16]"Unusual Rel-like architecture in the DNA-binding domain of the transcription factor NFATc."
Wolfe S.A., Zhou P., Dotsch V., Chen L., You A., Ho S.N., Crabtree G.R., Wagner G., Verdine G.L.
Nature 385:172-176(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 416-591.
[17]"Solution structure of the core NFATC1/DNA complex."
Zhou P., Sun L.J., Dotsch V., Wagner G., Verdine G.L.
Cell 92:687-696(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 416-591 IN COMPLEX WITH DNA.
[18]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-315.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U08015 mRNA. Translation: AAA19601.1.
U59736 mRNA. Translation: AAC50869.1.
U80917 mRNA. Translation: AAD00450.1.
U80918 mRNA. Translation: AAD00451.1.
U80919 mRNA. Translation: AAD00452.1.
EU887559 mRNA. Translation: ACG55579.1.
EU887560 mRNA. Translation: ACG55580.1.
EU887561 mRNA. Translation: ACG55581.1.
EU887562 mRNA. Translation: ACG55582.1.
EU887563 mRNA. Translation: ACG55583.1.
EU887564 mRNA. Translation: ACG55584.1.
EU887565 mRNA. Translation: ACG55585.1.
EU887566 mRNA. Translation: ACG55586.1.
AC018445 Genomic DNA. No translation available.
AC023090 Genomic DNA. No translation available.
CH471117 Genomic DNA. Translation: EAW66621.1.
CH471117 Genomic DNA. Translation: EAW66622.1.
BC104753 mRNA. Translation: AAI04754.1.
BC112243 mRNA. Translation: AAI12244.1.
CCDSCCDS12015.1. [O95644-4]
CCDS32850.1. [O95644-6]
CCDS59326.1. [O95644-2]
CCDS59327.1. [O95644-5]
CCDS62467.1. [O95644-1]
CCDS62468.1. [O95644-10]
CCDS62469.1. [O95644-11]
CCDS62470.1. [O95644-3]
PIRS45262.
RefSeqNP_001265598.1. NM_001278669.1. [O95644-1]
NP_001265599.1. NM_001278670.1. [O95644-10]
NP_001265601.1. NM_001278672.1. [O95644-11]
NP_001265602.1. NM_001278673.1.
NP_001265604.1. NM_001278675.1. [O95644-3]
NP_006153.2. NM_006162.4. [O95644-4]
NP_765975.1. NM_172387.2. [O95644-6]
NP_765976.1. NM_172388.2. [O95644-17]
NP_765977.1. NM_172389.2. [O95644-5]
NP_765978.1. NM_172390.2. [O95644-2]
UniGeneHs.534074.
Hs.701518.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1A66NMR-A414-591[»]
1NFANMR-A416-591[»]
ProteinModelPortalO95644.
SMRO95644. Positions 415-695.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110845. 24 interactions.
DIPDIP-44311N.
IntActO95644. 4 interactions.
MINTMINT-3319641.
STRING9606.ENSP00000327850.

Chemistry

BindingDBO95644.
ChEMBLCHEMBL3876.

PTM databases

PhosphoSiteO95644.

Proteomic databases

MaxQBO95644.
PaxDbO95644.
PRIDEO95644.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000253506; ENSP00000253506; ENSG00000131196. [O95644-4]
ENST00000318065; ENSP00000316553; ENSG00000131196. [O95644-5]
ENST00000329101; ENSP00000327850; ENSG00000131196. [O95644-6]
ENST00000397790; ENSP00000380892; ENSG00000131196.
ENST00000427363; ENSP00000389377; ENSG00000131196. [O95644-1]
ENST00000542384; ENSP00000442435; ENSG00000131196. [O95644-10]
ENST00000586434; ENSP00000466489; ENSG00000131196. [O95644-11]
ENST00000591814; ENSP00000466194; ENSG00000131196. [O95644-2]
ENST00000592223; ENSP00000467181; ENSG00000131196. [O95644-3]
GeneID4772.
KEGGhsa:4772.
UCSCuc002lnc.1. human.
uc002lnd.3. human. [O95644-1]

Organism-specific databases

CTD4772.
GeneCardsGC18P077155.
HGNCHGNC:7775. NFATC1.
HPACAB004513.
MIM600489. gene.
neXtProtNX_O95644.
PharmGKBPA31582.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG87292.
HOGENOMHOG000231780.
HOVERGENHBG069754.
KOK04446.
OMAHNNNQFF.
OrthoDBEOG79PJND.
PhylomeDBO95644.
TreeFamTF326480.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
REACT_118664. Calcineurin dephosphorylates NFATC1,2,3.
REACT_6900. Immune System.

Gene expression databases

ArrayExpressO95644.
BgeeO95644.
CleanExHS_NFATC1.
GenevestigatorO95644.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR015647. NFAT1.
IPR008967. p53-like_TF_DNA-bd.
IPR011539. RHD.
[Graphical view]
PANTHERPTHR12533. PTHR12533. 1 hit.
PTHR12533:SF5. PTHR12533:SF5. 1 hit.
PfamPF00554. RHD. 1 hit.
PF01833. TIG. 1 hit.
[Graphical view]
PRINTSPR01789. NUCFACTORATC.
SMARTSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEPS50254. REL_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNFATC1. human.
EvolutionaryTraceO95644.
GeneWikiNFATC1.
GenomeRNAi4772.
NextBio18388.
PROO95644.
SOURCESearch...

Entry information

Entry nameNFAC1_HUMAN
AccessionPrimary (citable) accession number: O95644
Secondary accession number(s): B5B2M4 expand/collapse secondary AC list , B5B2M5, B5B2M6, B5B2M7, B5B2M8, B5B2M9, B5B2N1, Q12865, Q15793, Q2M1S3
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: December 1, 2000
Last modified: July 9, 2014
This is version 155 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 18

Human chromosome 18: entries, gene names and cross-references to MIM