Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95644

- NFAC1_HUMAN

UniProt

O95644 - NFAC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear factor of activated T-cells, cytoplasmic 1

Gene

NFATC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi439 – 4468

GO - Molecular functioni

  1. FK506 binding Source: ProtInc
  2. mitogen-activated protein kinase p38 binding Source: BHF-UCL
  3. RNA polymerase II core promoter sequence-specific DNA binding Source: Ensembl
  4. RNA polymerase II distal enhancer sequence-specific DNA binding Source: BHF-UCL
  5. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity Source: BHF-UCL
  6. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
  7. RNA polymerase II transcription factor binding Source: BHF-UCL
  8. sequence-specific DNA binding transcription factor activity Source: ProtInc
  9. transcription regulatory region DNA binding Source: UniProtKB

GO - Biological processi

  1. calcium ion transport Source: Ensembl
  2. epithelial to mesenchymal transition Source: Ensembl
  3. Fc-epsilon receptor signaling pathway Source: Reactome
  4. G1/S transition of mitotic cell cycle Source: Ensembl
  5. heart development Source: Ensembl
  6. innate immune response Source: Reactome
  7. intracellular signal transduction Source: MGI
  8. osteoclast differentiation Source: Ensembl
  9. positive regulation of transcription, DNA-templated Source: UniProtKB
  10. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  11. transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_163834. FCERI mediated Ca+2 mobilization.
REACT_172761. Ca2+ pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 1
Short name:
NF-ATc1
Short name:
NFATc1
Alternative name(s):
NFAT transcription complex cytosolic component
Short name:
NF-ATc
Short name:
NFATc
Gene namesi
Name:NFATC1
Synonyms:NFAT2, NFATC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 18

Organism-specific databases

HGNCiHGNC:7775. NFATC1.

Subcellular locationi

Cytoplasm 1 Publication. Nucleus 1 Publication
Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

GO - Cellular componenti

  1. cytoplasm Source: BHF-UCL
  2. cytosol Source: Reactome
  3. nuclear chromatin Source: BHF-UCL
  4. nucleoplasm Source: Reactome
  5. transcription factor complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi169 – 1691S → A: No effect on subcellular localization.
Mutagenesisi172 – 1721S → A: Partial nuclear translocation. 1 Publication
Mutagenesisi187 – 1871S → A: No effect on subcellular localization. 1 Publication

Organism-specific databases

PharmGKBiPA31582.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 943943Nuclear factor of activated T-cells, cytoplasmic 1PRO_0000030329Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei245 – 2451Phosphoserine; by PKA1 Publication
Modified residuei269 – 2691Phosphoserine; by PKA1 Publication
Modified residuei294 – 2941Phosphoserine; by PKA1 Publication

Post-translational modificationi

Phosphorylated by NFATC-kinase and GSK3B; phosphorylation induces NFATC1 nuclear exit and dephosphorylation by calcineurin promotes nuclear import. Phosphorylation by PKA and DYRK2 negatively modulates nuclear accumulation, and promotes subsequent phosphorylation by GSK3B or casein kinase 1.3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO95644.
PaxDbiO95644.
PRIDEiO95644.

PTM databases

PhosphoSiteiO95644.

Expressioni

Tissue specificityi

Expressed in thymus, peripheral leukocytes as T-cells and spleen. Isoforms A are preferentially expressed in effector T-cells (thymus and peripheral leukocytes) whereas isoforms B and isoforms C are preferentially expressed in naive T-cells (spleen). Isoforms B are expressed in naive T-cells after first antigen exposure and isoforms A are expressed in effector T-cells after second antigen exposure. Isoforms IA are widely expressed but not detected in liver nor pancreas, neural expression is strongest in corpus callosum. Isoforms IB are expressed mostly in muscle, cerebellum, placenta and thymus, neural expression in fetal and adult brain, strongest in corpus callosum.1 Publication

Inductioni

Only isoforms A are inducibly expressed in T lymphocytes upon activation of the T-cell receptor (TCR) complex. Induced after co-addition of phorbol 12-myristate 13-acetate (PMA) and ionomycin. Also induced after co-addition of 12-O-tetradecanoylphorbol-13-acetate (TPA) and ionomycin. Weakly induced with PMA, ionomycin and cyclosporin A.

Gene expression databases

BgeeiO95644.
CleanExiHS_NFATC1.
ExpressionAtlasiO95644. baseline and differential.
GenevestigatoriO95644.

Organism-specific databases

HPAiCAB004513.

Interactioni

Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
OGTO152942EBI-6907210,EBI-539828

Protein-protein interaction databases

BioGridi110845. 25 interactions.
DIPiDIP-44311N.
IntActiO95644. 4 interactions.
MINTiMINT-3319641.
STRINGi9606.ENSP00000327850.

Structurei

Secondary structure

1
943
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi426 – 4327
Beta strandi443 – 4453
Beta strandi454 – 4563
Beta strandi460 – 4656
Beta strandi468 – 4703
Beta strandi472 – 4809
Beta strandi483 – 4853
Beta strandi509 – 5113
Beta strandi514 – 5218
Beta strandi523 – 5253
Helixi541 – 5455
Beta strandi551 – 5533
Beta strandi559 – 57012
Turni571 – 5733
Beta strandi574 – 58613

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1A66NMR-A414-591[»]
1NFANMR-A416-591[»]
ProteinModelPortaliO95644.
SMRiO95644. Positions 415-695.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95644.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati203 – 219171Add
BLAST
Repeati233 – 249172Add
BLAST
Repeati282 – 298173Add
BLAST
Domaini410 – 592183RHDPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni118 – 1236Calcineurin-binding
Regioni126 – 21893Trans-activation domain A (TAD-A)Add
BLAST
Regioni203 – 298963 X SP repeatsAdd
BLAST
Regioni703 – 943241Trans-activation domain B (TAD-B)Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi265 – 2673Nuclear localization signal
Motifi310 – 32112Nuclear export signalAdd
BLAST
Motifi682 – 6843Nuclear localization signal
Motifi924 – 93310Nuclear export signal

Domaini

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.
The N-terminal transactivation domain (TAD-A) binds to and is activated by Cbp/p300. The dephosphorylated form contains two unmasked nuclear localization signals (NLS), which allow translocation of the protein to the nucleus.
Isoforms C have a C-terminal part with an additional trans-activation domain, TAD-B, which acts as a transcriptional activator. Isoforms B have a shorter C-terminal part without complete TAD-B which acts as a transcriptional repressor.

Sequence similaritiesi

Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG87292.
GeneTreeiENSGT00550000074562.
HOGENOMiHOG000231780.
HOVERGENiHBG069754.
InParanoidiO95644.
KOiK04446.
OMAiHNNNQFF.
OrthoDBiEOG79PJND.
PhylomeDBiO95644.
TreeFamiTF326480.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR015647. NFAT1.
IPR008967. p53-like_TF_DNA-bd.
IPR011539. RHD.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PTHR12533:SF5. PTHR12533:SF5. 1 hit.
PfamiPF00554. RHD. 1 hit.
PF01833. TIG. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing and alternative initiation. Align

Note: Isoform C-alpha and isoform C-beta are the strongest activator of gene transcription, followed by isoform A-alpha and isoform A-beta, whereas isoform B-alpha and isoform B-beta are the weakest. Isoform B-alpha, isoform B-beta, isoform C-alpha and isoform C-beta, both present in T-cells, can modulate their transcriptional activity.

Isoform C-alpha (identifier: O95644-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSTSFPVPS KFPLGPAAAV FGRGETLGPA PRAGGTMKSA EEEHYGYASS
60 70 80 90 100
NVSPALPLPT AHSTLPAPCH NLQTSTPGII PPADHPSGYG AALDGGPAGY
110 120 130 140 150
FLSSGHTRPD GAPALESPRI EITSCLGLYH NNNQFFHDVE VEDVLPSSKR
160 170 180 190 200
SPSTATLSLP SLEAYRDPSC LSPASSLSSR SCNSEASSYE SNYSYPYASP
210 220 230 240 250
QTSPWQSPCV SPKTTDPEEG FPRGLGACTL LGSPRHSPST SPRASVTEES
260 270 280 290 300
WLGARSSRPA SPCNKRKYSL NGRQPPYSPH HSPTPSPHGS PRVSVTDDSW
310 320 330 340 350
LGNTTQYTSS AIVAAINALT TDSSLDLGDG VPVKSRKTTL EQPPSVALKV
360 370 380 390 400
EPVGEDLGSP PPPADFAPED YSSFQHIRKG GFCDQYLAVP QHPYQWAKPK
410 420 430 440 450
PLSPTSYMSP TLPALDWQLP SHSGPYELRI EVQPKSHHRA HYETEGSRGA
460 470 480 490 500
VKASAGGHPI VQLHGYLENE PLMLQLFIGT ADDRLLRPHA FYQVHRITGK
510 520 530 540 550
TVSTTSHEAI LSNTKVLEIP LLPENSMRAV IDCAGILKLR NSDIELRKGE
560 570 580 590 600
TDIGRKNTRV RLVFRVHVPQ PSGRTLSLQV ASNPIECSQR SAQELPLVEK
610 620 630 640 650
QSTDSYPVVG GKKMVLSGHN FLQDSKVIFV EKAPDGHHVW EMEAKTDRDL
660 670 680 690 700
CKPNSLVVEI PPFRNQRITS PVHVSFYVCN GKRKRSQYQR FTYLPANVPI
710 720 730 740 750
IKTEPTDDYE PAPTCGPVSQ GLSPLPRPYY SQQLAMPPDP SSCLVAGFPP
760 770 780 790 800
CPQRSTLMPA APGVSPKLHD LSPAAYTKGV ASPGHCHLGL PQPAGEAPAV
810 820 830 840 850
QDVPRPVATH PGSPGQPPPA LLPQQVSAPP SSSCPPGLEH SLCPSSPSPP
860 870 880 890 900
LPPATQEPTC LQPCSPACPP ATGRPQHLPS TVRRDESPTA GPRLLPEVHE
910 920 930 940
DGSPNLAPIP VTVKREPEEL DQLYLDDVNE IIRNDLSSTS THS
Length:943
Mass (Da):101,243
Last modified:December 1, 2000 - v3
Checksum:iE72FAB10ECEB2D66
GO
Isoform A-alpha (identifier: O95644-2) [UniParc]FASTAAdd to Basket

Also known as: IA-VIII

The sequence of this isoform differs from the canonical sequence as follows:
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.

Show »
Length:716
Mass (Da):77,785
Checksum:iC02F3B03F2019BB1
GO
Isoform A-beta (identifier: O95644-3) [UniParc]FASTAAdd to Basket

Also known as: IB-VIII

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.

Show »
Length:703
Mass (Da):76,879
Checksum:i57650B6E2A9A219C
GO
Isoform B-alpha (identifier: O95644-4) [UniParc]FASTAAdd to Basket

Also known as: IA-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     826-943: Missing.

Show »
Length:825
Mass (Da):88,763
Checksum:i28469C5BE89B00CC
GO
Isoform B-beta (identifier: O95644-5) [UniParc]FASTAAdd to Basket

Also known as: IB-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     826-943: Missing.

Show »
Length:812
Mass (Da):87,857
Checksum:iDBF68E35846E998D
GO
Isoform C-beta (identifier: O95644-6) [UniParc]FASTAAdd to Basket

Also known as: IB-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP

Show »
Length:930
Mass (Da):100,336
Checksum:i8708706F1C8938AC
GO
Isoform A-alpha' (identifier: O95644-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.
     698-716: VPIIKTEPTDDYEPAPTCG → GNAIFLTVSREHERVGCFF
     717-943: Missing.

Note: Produced by alternative initiation at Met-37 of isoform A-alpha. No experimental confirmation available.

Show »
Length:680
Mass (Da):74,276
Checksum:iD9D7060FEB4E81DF
GO
Isoform IA-deltaIX (identifier: O95644-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     698-927: Missing.

Show »
Length:713
Mass (Da):77,376
Checksum:iB797CFCFF28F8976
GO
Isoform IB-deltaIX (identifier: O95644-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEE → MTGLEDQEFDFEFLFEFNQRDEGAAAAAP
     698-927: Missing.

Show »
Length:700
Mass (Da):76,469
Checksum:i4A4F5475DF755F89
GO
Isoform 10 (identifier: O95644-17) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-472: Missing.
     826-943: Missing.

Note: No experimental evidence available.

Show »
Length:353
Mass (Da):38,626
Checksum:iAB8DEB0C451190DD
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti232 – 2321G → S in AAC50869. (PubMed:8702849)Curated
Sequence conflicti235 – 2351R → Q in AAA19601. (PubMed:8202141)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti68 – 681P → T.
Corresponds to variant rs1051978 [ dbSNP | Ensembl ].
VAR_057145
Natural varianti315 – 3151A → T in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_036529
Natural varianti751 – 7511C → G.
Corresponds to variant rs754093 [ dbSNP | Ensembl ].
VAR_057146

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 472472Missing in isoform 10. CuratedVSP_053806Add
BLAST
Alternative sequencei1 – 4242MPSTS…KSAEE → MTGLEDQEFDFEFLFEFNQR DEGAAAAAP in isoform A-beta, isoform B-beta, isoform C-beta and isoform IB-deltaIX. 3 PublicationsVSP_005590Add
BLAST
Alternative sequencei1 – 3636Missing in isoform A-alpha'. CuratedVSP_018978Add
BLAST
Alternative sequencei698 – 927230Missing in isoform IA-deltaIX and isoform IB-deltaIX. 1 PublicationVSP_047820Add
BLAST
Alternative sequencei698 – 71619VPIIK…APTCG → GNAIFLTVSREHERVGCFF in isoform A-alpha, isoform A-alpha' and isoform A-beta. 3 PublicationsVSP_005591Add
BLAST
Alternative sequencei717 – 943227Missing in isoform A-alpha, isoform A-alpha' and isoform A-beta. 3 PublicationsVSP_005592Add
BLAST
Alternative sequencei826 – 943118Missing in isoform B-alpha, isoform B-beta and isoform 10. 2 PublicationsVSP_005593Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U08015 mRNA. Translation: AAA19601.1.
U59736 mRNA. Translation: AAC50869.1.
U80917 mRNA. Translation: AAD00450.1.
U80918 mRNA. Translation: AAD00451.1.
U80919 mRNA. Translation: AAD00452.1.
EU887559 mRNA. Translation: ACG55579.1.
EU887560 mRNA. Translation: ACG55580.1.
EU887561 mRNA. Translation: ACG55581.1.
EU887562 mRNA. Translation: ACG55582.1.
EU887563 mRNA. Translation: ACG55583.1.
EU887564 mRNA. Translation: ACG55584.1.
EU887565 mRNA. Translation: ACG55585.1.
EU887566 mRNA. Translation: ACG55586.1.
AC018445 Genomic DNA. No translation available.
AC023090 Genomic DNA. No translation available.
CH471117 Genomic DNA. Translation: EAW66621.1.
CH471117 Genomic DNA. Translation: EAW66622.1.
BC104753 mRNA. Translation: AAI04754.1.
BC112243 mRNA. Translation: AAI12244.1.
CCDSiCCDS12015.1. [O95644-4]
CCDS12016.1. [O95644-17]
CCDS32850.1. [O95644-6]
CCDS59326.1. [O95644-2]
CCDS59327.1. [O95644-5]
CCDS62467.1. [O95644-1]
CCDS62468.1. [O95644-10]
CCDS62469.1. [O95644-11]
CCDS62470.1. [O95644-3]
PIRiS45262.
RefSeqiNP_001265598.1. NM_001278669.1. [O95644-1]
NP_001265599.1. NM_001278670.1. [O95644-10]
NP_001265601.1. NM_001278672.1. [O95644-11]
NP_001265602.1. NM_001278673.1.
NP_001265604.1. NM_001278675.1. [O95644-3]
NP_006153.2. NM_006162.4. [O95644-4]
NP_765975.1. NM_172387.2. [O95644-6]
NP_765976.1. NM_172388.2. [O95644-17]
NP_765977.1. NM_172389.2. [O95644-5]
NP_765978.1. NM_172390.2. [O95644-2]
UniGeneiHs.534074.
Hs.701518.

Genome annotation databases

EnsembliENST00000253506; ENSP00000253506; ENSG00000131196. [O95644-4]
ENST00000318065; ENSP00000316553; ENSG00000131196. [O95644-5]
ENST00000329101; ENSP00000327850; ENSG00000131196. [O95644-6]
ENST00000397790; ENSP00000380892; ENSG00000131196. [O95644-17]
ENST00000427363; ENSP00000389377; ENSG00000131196. [O95644-1]
ENST00000542384; ENSP00000442435; ENSG00000131196. [O95644-10]
ENST00000586434; ENSP00000466489; ENSG00000131196. [O95644-11]
ENST00000591814; ENSP00000466194; ENSG00000131196. [O95644-2]
ENST00000592223; ENSP00000467181; ENSG00000131196. [O95644-3]
GeneIDi4772.
KEGGihsa:4772.
UCSCiuc002lnc.1. human.
uc002lnd.3. human. [O95644-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U08015 mRNA. Translation: AAA19601.1 .
U59736 mRNA. Translation: AAC50869.1 .
U80917 mRNA. Translation: AAD00450.1 .
U80918 mRNA. Translation: AAD00451.1 .
U80919 mRNA. Translation: AAD00452.1 .
EU887559 mRNA. Translation: ACG55579.1 .
EU887560 mRNA. Translation: ACG55580.1 .
EU887561 mRNA. Translation: ACG55581.1 .
EU887562 mRNA. Translation: ACG55582.1 .
EU887563 mRNA. Translation: ACG55583.1 .
EU887564 mRNA. Translation: ACG55584.1 .
EU887565 mRNA. Translation: ACG55585.1 .
EU887566 mRNA. Translation: ACG55586.1 .
AC018445 Genomic DNA. No translation available.
AC023090 Genomic DNA. No translation available.
CH471117 Genomic DNA. Translation: EAW66621.1 .
CH471117 Genomic DNA. Translation: EAW66622.1 .
BC104753 mRNA. Translation: AAI04754.1 .
BC112243 mRNA. Translation: AAI12244.1 .
CCDSi CCDS12015.1. [O95644-4 ]
CCDS12016.1. [O95644-17 ]
CCDS32850.1. [O95644-6 ]
CCDS59326.1. [O95644-2 ]
CCDS59327.1. [O95644-5 ]
CCDS62467.1. [O95644-1 ]
CCDS62468.1. [O95644-10 ]
CCDS62469.1. [O95644-11 ]
CCDS62470.1. [O95644-3 ]
PIRi S45262.
RefSeqi NP_001265598.1. NM_001278669.1. [O95644-1 ]
NP_001265599.1. NM_001278670.1. [O95644-10 ]
NP_001265601.1. NM_001278672.1. [O95644-11 ]
NP_001265602.1. NM_001278673.1.
NP_001265604.1. NM_001278675.1. [O95644-3 ]
NP_006153.2. NM_006162.4. [O95644-4 ]
NP_765975.1. NM_172387.2. [O95644-6 ]
NP_765976.1. NM_172388.2. [O95644-17 ]
NP_765977.1. NM_172389.2. [O95644-5 ]
NP_765978.1. NM_172390.2. [O95644-2 ]
UniGenei Hs.534074.
Hs.701518.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1A66 NMR - A 414-591 [» ]
1NFA NMR - A 416-591 [» ]
ProteinModelPortali O95644.
SMRi O95644. Positions 415-695.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110845. 25 interactions.
DIPi DIP-44311N.
IntActi O95644. 4 interactions.
MINTi MINT-3319641.
STRINGi 9606.ENSP00000327850.

Chemistry

BindingDBi O95644.
ChEMBLi CHEMBL3876.
DrugBanki DB00852. Pseudoephedrine.

PTM databases

PhosphoSitei O95644.

Proteomic databases

MaxQBi O95644.
PaxDbi O95644.
PRIDEi O95644.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000253506 ; ENSP00000253506 ; ENSG00000131196 . [O95644-4 ]
ENST00000318065 ; ENSP00000316553 ; ENSG00000131196 . [O95644-5 ]
ENST00000329101 ; ENSP00000327850 ; ENSG00000131196 . [O95644-6 ]
ENST00000397790 ; ENSP00000380892 ; ENSG00000131196 . [O95644-17 ]
ENST00000427363 ; ENSP00000389377 ; ENSG00000131196 . [O95644-1 ]
ENST00000542384 ; ENSP00000442435 ; ENSG00000131196 . [O95644-10 ]
ENST00000586434 ; ENSP00000466489 ; ENSG00000131196 . [O95644-11 ]
ENST00000591814 ; ENSP00000466194 ; ENSG00000131196 . [O95644-2 ]
ENST00000592223 ; ENSP00000467181 ; ENSG00000131196 . [O95644-3 ]
GeneIDi 4772.
KEGGi hsa:4772.
UCSCi uc002lnc.1. human.
uc002lnd.3. human. [O95644-1 ]

Organism-specific databases

CTDi 4772.
GeneCardsi GC18P077155.
HGNCi HGNC:7775. NFATC1.
HPAi CAB004513.
MIMi 600489. gene.
neXtProti NX_O95644.
PharmGKBi PA31582.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG87292.
GeneTreei ENSGT00550000074562.
HOGENOMi HOG000231780.
HOVERGENi HBG069754.
InParanoidi O95644.
KOi K04446.
OMAi HNNNQFF.
OrthoDBi EOG79PJND.
PhylomeDBi O95644.
TreeFami TF326480.

Enzyme and pathway databases

Reactomei REACT_163834. FCERI mediated Ca+2 mobilization.
REACT_172761. Ca2+ pathway.

Miscellaneous databases

ChiTaRSi NFATC1. human.
EvolutionaryTracei O95644.
GeneWikii NFATC1.
GenomeRNAii 4772.
NextBioi 18388.
PROi O95644.
SOURCEi Search...

Gene expression databases

Bgeei O95644.
CleanExi HS_NFATC1.
ExpressionAtlasi O95644. baseline and differential.
Genevestigatori O95644.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProi IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR015647. NFAT1.
IPR008967. p53-like_TF_DNA-bd.
IPR011539. RHD.
[Graphical view ]
PANTHERi PTHR12533. PTHR12533. 1 hit.
PTHR12533:SF5. PTHR12533:SF5. 1 hit.
Pfami PF00554. RHD. 1 hit.
PF01833. TIG. 1 hit.
[Graphical view ]
PRINTSi PR01789. NUCFACTORATC.
SMARTi SM00429. IPT. 1 hit.
[Graphical view ]
SUPFAMi SSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEi PS50254. REL_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "NF-AT components define a family of transcription factors targeted in T-cell activation."
    Northrop J.P., Ho S.N., Chen L., Thomas D.J., Timmerman L.A., Nolan G.P., Admon A., Crabtree G.R.
    Nature 369:497-502(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A-ALPHA).
    Tissue: Peripheral blood lymphocyte and T-cell.
  2. "Characterization of a new isoform of the NFAT (nuclear factor of activated T cells) gene family member NFATc."
    Park J., Takeuchi A., Sharma S.
    J. Biol. Chem. 271:20914-20921(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B-BETA).
    Tissue: B-cell.
  3. Erratum
    Park J., Takeuchi A., Sharma S.
    J. Biol. Chem. 271:33705-33705(1996)
  4. "Alternative polyadenylation events contribute to the induction of NF-ATc in effector T cells."
    Chuvpilo S., Zimmer M., Kerstan A., Gloeckner J., Avots A., Escher C., Fischer C., Inashkina I., Jankevics E., Berberich-Siebelt F., Schmitt E., Serfling E.
    Immunity 10:261-269(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A-ALPHA; B-ALPHA AND C-BETA).
    Tissue: B-cell lymphoma.
  5. "Alternative splicing and expression of human and mouse NFAT genes."
    Vihma H., Pruunsild P., Timmusk T.
    Genomics 92:279-291(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS C-ALPHA; IA-DELTAIX AND IB-DELTAIX), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A-ALPHA).
    Tissue: Brain.
  9. "Expression of NFAT-family proteins in normal human T cells."
    Lyakh L., Ghosh P., Rice N.R.
    Mol. Cell. Biol. 17:2475-2484(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION OF ISOFORM A-ALPHA'.
  10. "Nuclear export of NF-ATc enhanced by glycogen synthase kinase-3."
    Beals C.R., Sheridan C.M., Turck C.W., Gardner P., Crabtree G.R.
    Science 275:1930-1934(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION BY GSK3B.
  11. "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT."
    Crabtree G.R.
    Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  12. "Multiple NF-ATc isoforms with individual transcriptional properties are synthesized in T lymphocytes."
    Chuvpilo S., Avots A., Berberich-Siebelt F., Gloeckner J., Fischer C., Kerstan A., Escher C., Inashkina I., Hlubek F., Jankevics E., Brabletz T., Serfling E.
    J. Immunol. 162:7294-7301(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, CHARACTERIZATION.
  13. "Identification of amino acid residues and protein kinases involved in the regulation of NFATc subcellular localization."
    Porter C.M., Havens M.A., Clipstone N.A.
    J. Biol. Chem. 275:3543-3551(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS OF SER-172 AND SER-187.
  14. "Protein kinase A negatively modulates the nuclear accumulation of NF-ATc1 by priming for subsequent phosphorylation by glycogen synthase kinase-3."
    Sheridan C.M., Heist E.K., Beals C.R., Crabtree G.R., Gardner P.
    J. Biol. Chem. 277:48664-48676(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-245; SER-269 AND SER-294.
  15. "A genome-wide Drosophila RNAi screen identifies DYRK-family kinases as regulators of NFAT."
    Gwack Y., Sharma S., Nardone J., Tanasa B., Iuga A., Srikanth S., Okamura H., Bolton D., Feske S., Hogan P.G., Rao A.
    Nature 441:646-650(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION.
  16. "Unusual Rel-like architecture in the DNA-binding domain of the transcription factor NFATc."
    Wolfe S.A., Zhou P., Dotsch V., Chen L., You A., Ho S.N., Crabtree G.R., Wagner G., Verdine G.L.
    Nature 385:172-176(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 416-591.
  17. "Solution structure of the core NFATC1/DNA complex."
    Zhou P., Sun L.J., Dotsch V., Wagner G., Verdine G.L.
    Cell 92:687-696(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 416-591 IN COMPLEX WITH DNA.
  18. Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-315.

Entry informationi

Entry nameiNFAC1_HUMAN
AccessioniPrimary (citable) accession number: O95644
Secondary accession number(s): B5B2M4
, B5B2M5, B5B2M6, B5B2M7, B5B2M8, B5B2M9, B5B2N1, Q12865, Q15793, Q2M1S3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: December 1, 2000
Last modified: October 29, 2014
This is version 158 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3