Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95628

- CNOT4_HUMAN

UniProt

O95628 - CNOT4_HUMAN

Protein

CCR4-NOT transcription complex subunit 4

Gene

CNOT4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 137 (01 Oct 2014)
      Sequence version 3 (03 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Has E3 ubiquitin ligase activity. Involved in activation of the JAK/STAT pathway.2 Publications

    Pathwayi

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri14 – 5744RING-type; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri190 – 21728C3H1-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ligase activity Source: UniProtKB-KW
    2. nucleotide binding Source: InterPro
    3. poly(A) RNA binding Source: UniProtKB
    4. protein binding Source: UniProtKB
    5. ubiquitin-protein transferase activity Source: UniProtKB
    6. zinc ion binding Source: InterPro

    GO - Biological processi

    1. gene expression Source: Reactome
    2. mRNA metabolic process Source: Reactome
    3. nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Source: Reactome
    4. nuclear-transcribed mRNA poly(A) tail shortening Source: Reactome
    5. protein autoubiquitination Source: UniProtKB
    6. RNA metabolic process Source: Reactome

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Ubl conjugation pathway

    Keywords - Ligandi

    Metal-binding, RNA-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_20514. Deadenylation of mRNA.
    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    CCR4-NOT transcription complex subunit 4 (EC:6.3.2.-)
    Alternative name(s):
    CCR4-associated factor 4
    E3 ubiquitin-protein ligase CNOT4
    Potential transcriptional repressor NOT4Hp
    Gene namesi
    Name:CNOT4
    Synonyms:NOT4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:7880. CNOT4.

    Subcellular locationi

    Cytoplasm Curated. Nucleus Curated

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi16 – 161L → A or E: Abolishes interaction with E2 ubiquitin ligases. 1 Publication
    Mutagenesisi17 – 171C → A: Abolishes interaction with E2 ubiquitin ligases. 1 Publication
    Mutagenesisi18 – 181M → A: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication
    Mutagenesisi33 – 331C → R: Abolishes interaction with E2 ubiquitin ligases. 1 Publication
    Mutagenesisi42 – 421W → A: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication
    Mutagenesisi44 – 441R → A or E: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication
    Mutagenesisi45 – 451I → A or W: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication
    Mutagenesisi49 – 491E → A: Strongly reduces interaction with E2 ubiquitin ligases. 2 Publications
    Mutagenesisi49 – 491E → K: Strongly reduced interaction with UBE2D2. 2 Publications
    Mutagenesisi54 – 541P → A: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication
    Mutagenesisi57 – 571R → A or E: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication

    Organism-specific databases

    PharmGKBiPA26675.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 575575CCR4-NOT transcription complex subunit 4PRO_0000081679Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei71 – 711Phosphoserine1 Publication
    Modified residuei324 – 3241Phosphoserine3 Publications
    Modified residuei432 – 4321Phosphoserine1 Publication
    Modified residuei490 – 4901Phosphoserine1 Publication

    Post-translational modificationi

    Autoubiquitinated.2 Publications

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiO95628.
    PaxDbiO95628.
    PRIDEiO95628.

    PTM databases

    PhosphoSiteiO95628.

    Expressioni

    Gene expression databases

    ArrayExpressiO95628.
    BgeeiO95628.
    CleanExiHS_CNOT4.
    GenevestigatoriO95628.

    Organism-specific databases

    HPAiHPA005737.

    Interactioni

    Subunit structurei

    Interacts with CNOT1 via its C-terminus but does not stably associate with the CCR4-NOT complex. Binds E2 ubiquitin ligases via its RING domain. Interacts (via RING domain) with UBE2D2.3 Publications

    Protein-protein interaction databases

    BioGridi110912. 17 interactions.
    IntActiO95628. 9 interactions.
    STRINGi9606.ENSP00000354673.

    Structurei

    Secondary structure

    1
    575
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni15 – 173
    Turni23 – 275
    Helixi39 – 457
    Turni54 – 563

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1E4UNMR-A1-78[»]
    1UR6NMR-B12-63[»]
    ProteinModelPortaliO95628.
    SMRiO95628. Positions 1-78, 103-198.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO95628.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini109 – 18981RRMPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili68 – 10437Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C3H1-type zinc finger.PROSITE-ProRule annotation
    Contains 1 RING-type zinc finger.PROSITE-ProRule annotation
    Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri14 – 5744RING-type; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri190 – 21728C3H1-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5175.
    HOVERGENiHBG051043.
    KOiK10643.
    OMAiKNPVPDQ.
    OrthoDBiEOG790G0K.
    PhylomeDBiO95628.
    TreeFamiTF106134.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    3.30.70.330. 1 hit.
    InterProiIPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    IPR000571. Znf_CCCH.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    SMARTiSM00184. RING. 1 hit.
    SM00360. RRM. 1 hit.
    [Graphical view]
    PROSITEiPS50102. RRM. 1 hit.
    PS50103. ZF_C3H1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (10)i

    Sequence statusi: Complete.

    This entry describes 10 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95628-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSRSPDAKED PVECPLCMEP LEIDDINFFP CTCGYQICRF CWHRIRTDEN    50
    GLCPACRKPY PEDPAVYKPL SQEELQRIKN EKKQKQNERK QKISENRKHL 100
    ASVRVVQKNL VFVVGLSQRL ADPEVLKRPE YFGKFGKIHK VVINNSTSYA 150
    GSQGPSASAY VTYIRSEDAL RAIQCVNNVV VDGRTLKASL GTTKYCSYFL 200
    KNMQCPKPDC MYLHELGDEA ASFTKEEMQA GKHQEYEQKL LQELYKLNPN 250
    FLQLSTGSVD KNKNKVTPLQ RYDTPIDKPS DSLSIGNGDN SQQISNSDTP 300
    SPPPGLSKSN PVIPISSSNH SARSPFEGAV TESQSLFSDN FRHPNPIPSG 350
    LPPFPSSPQT SSDWPTAPEP QSLFTSETIP VSSSTDWQAA FGFGSSKQPE 400
    DDLGFDPFDV TRKALADLIE KELSVQDQPS LSPTSLQNSS SHTTTAKGPG 450
    SGFLHPAAAT NANSLNSTFS VLPQRFPQFQ QHRAVYNSFS FPGQAARYPW 500
    MAFPRNSIMH LNHTANPTSN SNFLDLNLPP QHNTGLGGIP VAGEEEVKVS 550
    TMPLSTSSHS LQQGQQPTSL HTTVA 575
    Length:575
    Mass (Da):63,510
    Last modified:October 3, 2006 - v3
    Checksum:iC41762D4EC4222BC
    GO
    Isoform 2 (identifier: O95628-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         271-274: RYDT → S

    Show »
    Length:572
    Mass (Da):63,062
    Checksum:i717835C74D66B540
    GO
    Isoform 3 (identifier: O95628-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-17: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:558
    Mass (Da):61,651
    Checksum:iDAE0356900B05FE4
    GO
    Isoform 4 (identifier: O95628-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...LLQSSTLDRH

    Note: No experimental confirmation available.

    Show »
    Length:642
    Mass (Da):70,787
    Checksum:i3D432CA88242C77E
    GO
    Isoform 5 (identifier: O95628-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         419-433: IEKELSVQDQPSLSP → TEPIERKRLAVLKRR
         434-575: Missing.

    Show »
    Length:433
    Mass (Da):48,485
    Checksum:i8B120FF952B46883
    GO
    Isoform 6 (identifier: O95628-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSIESLN...HLFINCKNFC

    Note: No experimental confirmation available.

    Show »
    Length:767
    Mass (Da):84,747
    Checksum:i43A198C595008B1C
    GO
    Isoform 7 (identifier: O95628-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...PTAPFSSLMF

    Note: No experimental confirmation available.

    Show »
    Length:675
    Mass (Da):74,524
    Checksum:iFA54396714B4A41B
    GO
    Isoform 8 (identifier: O95628-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         271-274: RYDT → S
         544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...LLQSSTLDRH

    Note: No experimental confirmation available.

    Show »
    Length:639
    Mass (Da):70,339
    Checksum:iC22E9F609FFFF456
    GO
    Isoform 9 (identifier: O95628-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         271-274: RYDT → S
         543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSVESLN...LLQSSTLDRH

    Note: No experimental confirmation available.Curated

    Show »
    Length:710
    Mass (Da):77,809
    Checksum:i118DE9B8D4B7AD79
    GO
    Isoform 10 (identifier: O95628-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSVESLN...LLQSSTLDRH

    Note: No experimental confirmation available.

    Show »
    Length:713
    Mass (Da):78,257
    Checksum:iA66182988D096173
    GO

    Sequence cautioni

    The sequence AAC72963.1 differs from that shown. Reason: Sequencing errors.
    The sequence AAC72963.1 differs from that shown. Reason: Frameshift at several positions.
    The sequence AAD00180.1 differs from that shown. Reason: Frameshift at positions 358 and 400.
    The sequence BAC11125.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti178 – 1781N → D in BAH13270. (PubMed:14702039)Curated
    Sequence conflicti201 – 2011K → R in BAH13270. (PubMed:14702039)Curated
    Sequence conflicti340 – 3401N → I in AAH35590. (PubMed:15489334)Curated
    Sequence conflicti570 – 5701L → F in AAD00179. 1 PublicationCurated
    Sequence conflicti570 – 5701L → F in AAD00180. 1 PublicationCurated
    Isoform 9 (identifier: O95628-9)
    Sequence conflicti545 – 5451V → I in BAH13270. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti7 – 71A → G.1 Publication
    Corresponds to variant rs17480616 [ dbSNP | Ensembl ].
    VAR_027833

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1717Missing in isoform 3. 1 PublicationVSP_009923Add
    BLAST
    Alternative sequencei271 – 2744RYDT → S in isoform 2, isoform 8 and isoform 9. 3 PublicationsVSP_009924
    Alternative sequencei419 – 43315IEKEL…PSLSP → TEPIERKRLAVLKRR in isoform 5. 1 PublicationVSP_009925Add
    BLAST
    Alternative sequencei434 – 575142Missing in isoform 5. 1 PublicationVSP_009926Add
    BLAST
    Alternative sequencei543 – 57533GEEEV…HTTVA → DNSSSIESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSLSWDS PGSWTDPAIITGIPASSGNS LDSLQDDNPPHWLKSLQALT EMDGPSAAPSQTHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPQIYYRVQHWTAIRQ RGATIRKCRICPTLFSPSQP TTHSSLLISYVLKNPVPDQF FFSLTPDAMRSQGHYHLFIN CKNFC in isoform 6. 1 PublicationVSP_009927Add
    BLAST
    Alternative sequencei543 – 57533GEEEV…HTTVA → DNSSSVESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSLSWDS PGSWTDPAIITGIPASSGNS LDSLQDDNPPHWLKSLQALT EMDGPSAAPSQTHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPGFQTAFRPPSKTPT DLLQSSTLDRH in isoform 9 and isoform 10. 1 PublicationVSP_045469Add
    BLAST
    Alternative sequencei544 – 57532EEEVK…HTTVA → IPASSGNSLDSLQDDNPPHW LKSLQALTEMDGPSAAPSQT HHSAPFSTQIPLHRASWNPY PPPSNPSSFHSPPPGFQTAF RPPSKTPTDLLQSSTLDRH in isoform 4 and isoform 8. 1 PublicationVSP_009928Add
    BLAST
    Alternative sequencei544 – 57532EEEVK…HTTVA → IPASSGNSLDSLQDDNPPHW LKSLQALTEMDGQRCSITDP PQRPLQHTDPAAQSQLESLP SSFKPFQLPLPTPRLSDGLQ TPQQNPHRFTTEFNTGPPLG KEEQPLENAGFVPLCFLPLS PPPTAPFSSLMF in isoform 7. 1 PublicationVSP_009929Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U71267 mRNA. Translation: AAD00179.1. Frameshift.
    U71268 mRNA. Translation: AAD00180.1. Frameshift.
    AF180475 mRNA. Translation: AAF29829.1.
    AL389980 mRNA. Translation: CAB97536.1.
    AK074671 mRNA. Translation: BAC11125.1. Different initiation.
    AK300365 mRNA. Translation: BAH13270.1.
    AC083871 Genomic DNA. No translation available.
    AC074002 Genomic DNA. No translation available.
    BC035590 mRNA. Translation: AAH35590.1.
    AF091094 mRNA. Translation: AAC72963.1. Sequence problems.
    CCDSiCCDS43650.1. [O95628-8]
    CCDS47719.1. [O95628-2]
    CCDS55164.1. [O95628-4]
    CCDS55165.1. [O95628-10]
    CCDS55166.1. [O95628-1]
    CCDS55167.1. [O95628-9]
    RefSeqiNP_001008226.1. NM_001008225.2. [O95628-2]
    NP_001177776.1. NM_001190847.1. [O95628-4]
    NP_001177777.1. NM_001190848.1. [O95628-1]
    NP_001177778.1. NM_001190849.1. [O95628-9]
    NP_001177779.1. NM_001190850.1. [O95628-10]
    NP_037448.2. NM_013316.3. [O95628-8]
    UniGeneiHs.490224.

    Genome annotation databases

    EnsembliENST00000315544; ENSP00000326731; ENSG00000080802. [O95628-1]
    ENST00000356162; ENSP00000348485; ENSG00000080802. [O95628-5]
    ENST00000361528; ENSP00000354673; ENSG00000080802. [O95628-8]
    ENST00000414802; ENSP00000416532; ENSG00000080802. [O95628-5]
    ENST00000423368; ENSP00000406777; ENSG00000080802. [O95628-4]
    ENST00000428680; ENSP00000399108; ENSG00000080802. [O95628-2]
    ENST00000451834; ENSP00000388491; ENSG00000080802. [O95628-9]
    ENST00000541284; ENSP00000445508; ENSG00000080802. [O95628-10]
    GeneIDi4850.
    KEGGihsa:4850.
    UCSCiuc003vss.3. human. [O95628-8]
    uc003vst.3. human. [O95628-4]
    uc003vsu.2. human. [O95628-2]
    uc003vsv.2. human. [O95628-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U71267 mRNA. Translation: AAD00179.1 . Frameshift.
    U71268 mRNA. Translation: AAD00180.1 . Frameshift.
    AF180475 mRNA. Translation: AAF29829.1 .
    AL389980 mRNA. Translation: CAB97536.1 .
    AK074671 mRNA. Translation: BAC11125.1 . Different initiation.
    AK300365 mRNA. Translation: BAH13270.1 .
    AC083871 Genomic DNA. No translation available.
    AC074002 Genomic DNA. No translation available.
    BC035590 mRNA. Translation: AAH35590.1 .
    AF091094 mRNA. Translation: AAC72963.1 . Sequence problems.
    CCDSi CCDS43650.1. [O95628-8 ]
    CCDS47719.1. [O95628-2 ]
    CCDS55164.1. [O95628-4 ]
    CCDS55165.1. [O95628-10 ]
    CCDS55166.1. [O95628-1 ]
    CCDS55167.1. [O95628-9 ]
    RefSeqi NP_001008226.1. NM_001008225.2. [O95628-2 ]
    NP_001177776.1. NM_001190847.1. [O95628-4 ]
    NP_001177777.1. NM_001190848.1. [O95628-1 ]
    NP_001177778.1. NM_001190849.1. [O95628-9 ]
    NP_001177779.1. NM_001190850.1. [O95628-10 ]
    NP_037448.2. NM_013316.3. [O95628-8 ]
    UniGenei Hs.490224.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1E4U NMR - A 1-78 [» ]
    1UR6 NMR - B 12-63 [» ]
    ProteinModelPortali O95628.
    SMRi O95628. Positions 1-78, 103-198.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110912. 17 interactions.
    IntActi O95628. 9 interactions.
    STRINGi 9606.ENSP00000354673.

    PTM databases

    PhosphoSitei O95628.

    Proteomic databases

    MaxQBi O95628.
    PaxDbi O95628.
    PRIDEi O95628.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000315544 ; ENSP00000326731 ; ENSG00000080802 . [O95628-1 ]
    ENST00000356162 ; ENSP00000348485 ; ENSG00000080802 . [O95628-5 ]
    ENST00000361528 ; ENSP00000354673 ; ENSG00000080802 . [O95628-8 ]
    ENST00000414802 ; ENSP00000416532 ; ENSG00000080802 . [O95628-5 ]
    ENST00000423368 ; ENSP00000406777 ; ENSG00000080802 . [O95628-4 ]
    ENST00000428680 ; ENSP00000399108 ; ENSG00000080802 . [O95628-2 ]
    ENST00000451834 ; ENSP00000388491 ; ENSG00000080802 . [O95628-9 ]
    ENST00000541284 ; ENSP00000445508 ; ENSG00000080802 . [O95628-10 ]
    GeneIDi 4850.
    KEGGi hsa:4850.
    UCSCi uc003vss.3. human. [O95628-8 ]
    uc003vst.3. human. [O95628-4 ]
    uc003vsu.2. human. [O95628-2 ]
    uc003vsv.2. human. [O95628-1 ]

    Organism-specific databases

    CTDi 4850.
    GeneCardsi GC07M135046.
    H-InvDB HIX0007112.
    HGNCi HGNC:7880. CNOT4.
    HPAi HPA005737.
    MIMi 604911. gene.
    neXtProti NX_O95628.
    PharmGKBi PA26675.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5175.
    HOVERGENi HBG051043.
    KOi K10643.
    OMAi KNPVPDQ.
    OrthoDBi EOG790G0K.
    PhylomeDBi O95628.
    TreeFami TF106134.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .
    Reactomei REACT_20514. Deadenylation of mRNA.

    Miscellaneous databases

    EvolutionaryTracei O95628.
    GenomeRNAii 4850.
    NextBioi 18678.
    PROi O95628.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95628.
    Bgeei O95628.
    CleanExi HS_CNOT4.
    Genevestigatori O95628.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    3.30.70.330. 1 hit.
    InterProi IPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    IPR000571. Znf_CCCH.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    SMARTi SM00184. RING. 1 hit.
    SM00360. RRM. 1 hit.
    [Graphical view ]
    PROSITEi PS50102. RRM. 1 hit.
    PS50103. ZF_C3H1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and characterization of human and murine homologues of yeast NOT4 gene."
      Chiang P.-W.
      Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
    2. "Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits."
      Albert T.K., Lemaire M., van Berkum N.L., Gentz R., Collart M.A., Timmers H.T.M.
      Nucleic Acids Res. 28:809-817(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
    3. The European IMAGE consortium
      Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLY-7.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 149-575 (ISOFORM 6).
      Tissue: Mammary gland and Placenta.
    5. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    7. "Full-insert sequence of mapped XREF EST."
      Barrow I.K.-P., Boguski M.S., Touchman J.W., Spencer F.
      Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 294-575 (ISOFORM 7).
    8. "Identification of a ubiquitin-protein ligase subunit within the CCR4-NOT transcription repressor complex."
      Albert T.K., Hanzawa H., Legtenberg Y.I.A., de Ruwe M.J., van den Heuvel F.A.J., Collart M.A., Boelens R., Timmers H.T.M.
      EMBO J. 21:355-364(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, UBIQUITINATION, INTERACTION WITH CNOT1 AND UBIQUITIN E2 LIGASES, MUTAGENESIS OF LEU-16; CYS-17; MET-18; CYS-33; TRP-42; ARG-44; ILE-45; GLU-49; PRO-54 AND ARG-57, STRUCTURE BY NMR OF 1-78.
    9. "An altered-specificity ubiquitin-conjugating enzyme/ubiquitin-protein ligase pair."
      Winkler G.S., Albert T.K., Dominguez C., Legtenberg Y.I., Boelens R., Timmers H.T.
      J. Mol. Biol. 337:157-165(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH UBE2D2, AUTOUBIQUITINATION, MUTAGENESIS OF GLU-49.
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324; SER-432 AND SER-490, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. "Not4 enhances JAK/STAT pathway-dependent gene expression in Drosophila and in human cells."
      Gronholm J., Kaustio M., Myllymaki H., Kallio J., Saarikettu J., Kronhamn J., Valanne S., Silvennoinen O., Ramet M.
      FASEB J. 26:1239-1250(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    15. "The structure of the C4C4 ring finger of human NOT4 reveals features distinct from those of C3HC4 RING fingers."
      Hanzawa H., de Ruwe M.J., Albert T.K., van Der Vliet P.C., Timmers H.T.M., Boelens R.
      J. Biol. Chem. 276:10185-10190(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 1-78 IN COMPLEX WITH ZINC IONS.

    Entry informationi

    Entry nameiCNOT4_HUMAN
    AccessioniPrimary (citable) accession number: O95628
    Secondary accession number(s): B7Z6I4
    , E7ET38, F8VQP3, O95339, O95627, Q8IYM7, Q8NCL0, Q9NPQ1, Q9NZN6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 13, 2004
    Last sequence update: October 3, 2006
    Last modified: October 1, 2014
    This is version 137 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3