O95628 (CNOT4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: CCR4-NOT transcription complex subunit 4 EC=6.3.2.- Alternative name(s): CCR4-associated factor 4 E3 ubiquitin-protein ligase CNOT4 Potential transcriptional repressor NOT4Hp | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 575 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has E3 ubiquitin ligase activity. Involved in activation of the JAK/STAT pathway. Ref.8 Ref.14 |
| Pathway | |
| Subunit structure | Interacts with CNOT1 via its C-terminus but does not stably associate with the CCR4-NOT complex. Binds E2 ubiquitin ligases via its RING domain. Interacts (via RING domain) with UBE2D2. Ref.8 Ref.9 |
| Subcellular location | |
| Post-translational modification | Autoubiquitinated. |
| Sequence similarities | Contains 1 C3H1-type zinc finger. Contains 1 RING-type zinc finger. Contains 1 RRM (RNA recognition motif) domain. |
| Sequence caution | The sequence AAC72963.1 differs from that shown. Reason: Frameshift at several positions. The sequence AAC72963.1 differs from that shown. Reason: Sequencing errors. The sequence AAD00180.1 differs from that shown. Reason: Frameshift at positions 358 and 400. The sequence BAC11125.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95628-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95628-2) The sequence of this isoform differs from the canonical sequence as follows: 271-274: RYDT → S | ||||||
| Isoform 3 (identifier: O95628-3) The sequence of this isoform differs from the canonical sequence as follows: 1-17: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O95628-4) The sequence of this isoform differs from the canonical sequence as follows: 544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...LLQSSTLDRH | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O95628-5) The sequence of this isoform differs from the canonical sequence as follows: 419-433: IEKELSVQDQPSLSP → TEPIERKRLAVLKRR 434-575: Missing. | ||||||
| Isoform 6 (identifier: O95628-6) The sequence of this isoform differs from the canonical sequence as follows: 543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSIESLN...HLFINCKNFC | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: O95628-7) The sequence of this isoform differs from the canonical sequence as follows: 544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...PTAPFSSLMF | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: O95628-8) The sequence of this isoform differs from the canonical sequence as follows: 271-274: RYDT → S 544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...LLQSSTLDRH | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 9 (identifier: O95628-9) The sequence of this isoform differs from the canonical sequence as follows: 271-274: RYDT → S 543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSVESLN...LLQSSTLDRH | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 575 | 575 | CCR4-NOT transcription complex subunit 4 | PRO_0000081679 | |||||||||||||
Regions | |||||||||||||||||
| Domain | 109 – 189 | 81 | RRM | ||||||||||||||
| Zinc finger | 14 – 57 | 44 | RING-type; degenerate | ||||||||||||||
| Zinc finger | 190 – 217 | 28 | C3H1-type | ||||||||||||||
| Coiled coil | 68 – 104 | 37 | Potential | ||||||||||||||
Amino acid modifications | |||||||||||||||||
| Modified residue | 71 | 1 | Phosphoserine Ref.10 | ||||||||||||||
| Modified residue | 324 | 1 | Phosphoserine Ref.11 Ref.12 Ref.13 | ||||||||||||||
| Modified residue | 432 | 1 | Phosphoserine Ref.12 | ||||||||||||||
| Modified residue | 490 | 1 | Phosphoserine Ref.12 | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 1 – 17 | 17 | Missing in isoform 3. | VSP_009923 | |||||||||||||
| Alternative sequence | 271 – 274 | 4 | RYDT → S in isoform 2, isoform 8 and isoform 9. | VSP_009924 | |||||||||||||
| Alternative sequence | 419 – 433 | 15 | IEKEL…PSLSP → TEPIERKRLAVLKRR in isoform 5. | VSP_009925 | |||||||||||||
| Alternative sequence | 434 – 575 | 142 | Missing in isoform 5. | VSP_009926 | |||||||||||||
| Alternative sequence | 543 – 575 | 33 | GEEEV…HTTVA → DNSSSIESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSLSWDS PGSWTDPAIITGIPASSGNS LDSLQDDNPPHWLKSLQALT EMDGPSAAPSQTHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPQIYYRVQHWTAIRQ RGATIRKCRICPTLFSPSQP TTHSSLLISYVLKNPVPDQF FFSLTPDAMRSQGHYHLFIN CKNFC in isoform 6. | VSP_009927 | |||||||||||||
| Alternative sequence | 543 – 575 | 33 | GEEEV…HTTVA → DNSSSVESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSLSWDS PGSWTDPAIITGIPASSGNS LDSLQDDNPPHWLKSLQALT EMDGPSAAPSQTHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPGFQTAFRPPSKTPT DLLQSSTLDRH in isoform 9. | VSP_045469 | |||||||||||||
| Alternative sequence | 544 – 575 | 32 | EEEVK…HTTVA → IPASSGNSLDSLQDDNPPHW LKSLQALTEMDGPSAAPSQT HHSAPFSTQIPLHRASWNPY PPPSNPSSFHSPPPGFQTAF RPPSKTPTDLLQSSTLDRH in isoform 4 and isoform 8. | VSP_009928 | |||||||||||||
| Alternative sequence | 544 – 575 | 32 | EEEVK…HTTVA → IPASSGNSLDSLQDDNPPHW LKSLQALTEMDGQRCSITDP PQRPLQHTDPAAQSQLESLP SSFKPFQLPLPTPRLSDGLQ TPQQNPHRFTTEFNTGPPLG KEEQPLENAGFVPLCFLPLS PPPTAPFSSLMF in isoform 7. | VSP_009929 | |||||||||||||
| Natural variant | 7 | 1 | A → G. Ref.3 Corresponds to variant rs17480616 [ dbSNP | Ensembl ]. | VAR_027833 | |||||||||||||
Experimental info | |||||||||||||||||
| Mutagenesis | 16 | 1 | L → A or E: Abolishes interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Mutagenesis | 17 | 1 | C → A: Abolishes interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Mutagenesis | 18 | 1 | M → A: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Mutagenesis | 33 | 1 | C → R: Abolishes interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Mutagenesis | 42 | 1 | W → A: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Mutagenesis | 44 | 1 | R → A or E: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Mutagenesis | 45 | 1 | I → A or W: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Mutagenesis | 49 | 1 | E → A: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8 Ref.9 | ||||||||||||||
| Mutagenesis | 49 | 1 | E → K: Strongly reduced interaction with UBE2D2. Ref.8 Ref.9 | ||||||||||||||
| Mutagenesis | 54 | 1 | P → A: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Mutagenesis | 57 | 1 | R → A or E: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8 | ||||||||||||||
| Sequence conflict | 178 | 1 | N → D in BAH13270. Ref.4 | ||||||||||||||
| Sequence conflict | 201 | 1 | K → R in BAH13270. Ref.4 | ||||||||||||||
| Sequence conflict | 340 | 1 | N → I in AAH35590. Ref.6 | ||||||||||||||
| Sequence conflict | 570 | 1 | L → F in AAD00179. Ref.1 | ||||||||||||||
| Sequence conflict | 570 | 1 | L → F in AAD00180. Ref.1 | ||||||||||||||
| Isoform 9: | |||||||||||||||||
| Sequence conflict | 545 | 1 | V → I in BAH13270. Ref.4 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Turn | 15 – 17 | 3 | |||||||||||||||
| Turn | 23 – 27 | 5 | |||||||||||||||
| Helix | 39 – 45 | 7 | |||||||||||||||
| Turn | 54 – 56 | 3 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of human and murine homologues of yeast NOT4 gene." Chiang P.-W. Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4). |
| [2] | "Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits." Albert T.K., Lemaire M., van Berkum N.L., Gentz R., Collart M.A., Timmers H.T.M. Nucleic Acids Res. 28:809-817(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). |
| [3] | The European IMAGE consortium Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLY-7. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 149-575 (ISOFORM 6). Tissue: Mammary gland and Placenta. |
| [5] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [7] | "Full-insert sequence of mapped XREF EST." Barrow I.K.-P., Boguski M.S., Touchman J.W., Spencer F. Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 294-575 (ISOFORM 7). |
| [8] | "Identification of a ubiquitin-protein ligase subunit within the CCR4-NOT transcription repressor complex." Albert T.K., Hanzawa H., Legtenberg Y.I.A., de Ruwe M.J., van den Heuvel F.A.J., Collart M.A., Boelens R., Timmers H.T.M. EMBO J. 21:355-364(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, UBIQUITINATION, INTERACTION WITH CNOT1 AND UBIQUITIN E2 LIGASES, MUTAGENESIS OF LEU-16; CYS-17; MET-18; CYS-33; TRP-42; ARG-44; ILE-45; GLU-49; PRO-54 AND ARG-57, STRUCTURE BY NMR OF 1-78. |
| [9] | "An altered-specificity ubiquitin-conjugating enzyme/ubiquitin-protein ligase pair." Winkler G.S., Albert T.K., Dominguez C., Legtenberg Y.I., Boelens R., Timmers H.T. J. Mol. Biol. 337:157-165(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH UBE2D2, AUTOUBIQUITINATION, MUTAGENESIS OF GLU-49. |
| [10] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324; SER-432 AND SER-490, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Not4 enhances JAK/STAT pathway-dependent gene expression in Drosophila and in human cells." Gronholm J., Kaustio M., Myllymaki H., Kallio J., Saarikettu J., Kronhamn J., Valanne S., Silvennoinen O., Ramet M. FASEB J. 26:1239-1250(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [15] | "The structure of the C4C4 ring finger of human NOT4 reveals features distinct from those of C3HC4 RING fingers." Hanzawa H., de Ruwe M.J., Albert T.K., van Der Vliet P.C., Timmers H.T.M., Boelens R. J. Biol. Chem. 276:10185-10190(2001) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1-78 IN COMPLEX WITH ZINC IONS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U71267 mRNA. Translation: AAD00179.1. Frameshift. U71268 mRNA. Translation: AAD00180.1. Frameshift. AF180475 mRNA. Translation: AAF29829.1. AL389980 mRNA. Translation: CAB97536.1. AK074671 mRNA. Translation: BAC11125.1. Different initiation. AK300365 mRNA. Translation: BAH13270.1. AC083871 Genomic DNA. No translation available. AC074002 Genomic DNA. No translation available. BC035590 mRNA. Translation: AAH35590.1. AF091094 mRNA. Translation: AAC72963.1. Sequence problems. | ||||||||||||||||||
| IPI | IPI00002436. IPI00410681. IPI00410682. IPI00410683. IPI00410684. IPI00410685. IPI00410686. IPI00925697. IPI01026266. | ||||||||||||||||||
| RefSeq | NP_001008226.1. NM_001008225.2. NP_001177776.1. NM_001190847.1. NP_001177777.1. NM_001190848.1. NP_001177778.1. NM_001190849.1. NP_001177779.1. NM_001190850.1. NP_037448.2. NM_013316.3. | ||||||||||||||||||
| UniGene | Hs.490224. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O95628. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | O95628. 9 interactions. | ||||||||||||||||||
| STRING | 9606.ENSP00000354673. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O95628. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | O95628. | ||||||||||||||||||
| PRIDE | O95628. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000315544; ENSP00000326731; ENSG00000080802. ENST00000356162; ENSP00000348485; ENSG00000080802. ENST00000361528; ENSP00000354673; ENSG00000080802. ENST00000414802; ENSP00000416532; ENSG00000080802. ENST00000423368; ENSP00000406777; ENSG00000080802. ENST00000428680; ENSP00000399108; ENSG00000080802. ENST00000451834; ENSP00000388491; ENSG00000080802. | ||||||||||||||||||
| GeneID | 4850. | ||||||||||||||||||
| KEGG | hsa:4850. | ||||||||||||||||||
| UCSC | uc003vss.3. human. uc003vst.3. human. uc003vsu.2. human. uc003vsv.2. human. uc011kpz.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 4850. | ||||||||||||||||||
| GeneCards | GC07M135046. | ||||||||||||||||||
| H-InvDB | HIX0007112. | ||||||||||||||||||
| HGNC | HGNC:7880. CNOT4. | ||||||||||||||||||
| HPA | HPA005737. | ||||||||||||||||||
| MIM | 604911. gene. | ||||||||||||||||||
| neXtProt | NX_O95628. | ||||||||||||||||||
| PharmGKB | PA26675. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG5175. | ||||||||||||||||||
| HOVERGEN | HBG051043. | ||||||||||||||||||
| KO | K10643. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_21257. Metabolism of RNA. REACT_71. Gene Expression. | ||||||||||||||||||
| UniPathway | UPA00143. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O95628. | ||||||||||||||||||
| Bgee | O95628. | ||||||||||||||||||
| CleanEx | HS_CNOT4. | ||||||||||||||||||
| Genevestigator | O95628. | ||||||||||||||||||
| GermOnline | ENSG00000080802. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 3.30.40.10. 1 hit. 3.30.70.330. 1 hit. | ||||||||||||||||||
| InterPro | IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. IPR000571. Znf_CCCH. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] | ||||||||||||||||||
| SMART | SM00184. RING. 1 hit. SM00360. RRM. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50102. RRM. 1 hit. PS50103. ZF_C3H1. 1 hit. PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | O95628. | ||||||||||||||||||
| GenomeRNAi | 4850. | ||||||||||||||||||
| NextBio | 18678. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | CNOT4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95628 Secondary accession number(s): B7Z6I4 Q9NZN6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
