Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95628 (CNOT4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 135. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
CCR4-NOT transcription complex subunit 4

EC=6.3.2.-
Alternative name(s):
CCR4-associated factor 4
E3 ubiquitin-protein ligase CNOT4
Potential transcriptional repressor NOT4Hp
Gene names
Name:CNOT4
Synonyms:NOT4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length575 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Has E3 ubiquitin ligase activity. Involved in activation of the JAK/STAT pathway. Ref.8 Ref.14

Pathway

Protein modification; protein ubiquitination.

Subunit structure

Interacts with CNOT1 via its C-terminus but does not stably associate with the CCR4-NOT complex. Binds E2 ubiquitin ligases via its RING domain. Interacts (via RING domain) with UBE2D2. Ref.8 Ref.9

Subcellular location

Cytoplasm Probable. Nucleus Probable.

Post-translational modification

Autoubiquitinated.

Sequence similarities

Contains 1 C3H1-type zinc finger.

Contains 1 RING-type zinc finger.

Contains 1 RRM (RNA recognition motif) domain.

Sequence caution

The sequence AAC72963.1 differs from that shown. Reason: Frameshift at several positions.

The sequence AAC72963.1 differs from that shown. Reason: Sequencing errors.

The sequence AAD00180.1 differs from that shown. Reason: Frameshift at positions 358 and 400.

The sequence BAC11125.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 10 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O95628-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O95628-2)

The sequence of this isoform differs from the canonical sequence as follows:
     271-274: RYDT → S
Isoform 3 (identifier: O95628-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: O95628-4)

The sequence of this isoform differs from the canonical sequence as follows:
     544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...LLQSSTLDRH
Note: No experimental confirmation available.
Isoform 5 (identifier: O95628-5)

The sequence of this isoform differs from the canonical sequence as follows:
     419-433: IEKELSVQDQPSLSP → TEPIERKRLAVLKRR
     434-575: Missing.
Isoform 6 (identifier: O95628-6)

The sequence of this isoform differs from the canonical sequence as follows:
     543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSIESLN...HLFINCKNFC
Note: No experimental confirmation available.
Isoform 7 (identifier: O95628-7)

The sequence of this isoform differs from the canonical sequence as follows:
     544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...PTAPFSSLMF
Note: No experimental confirmation available.
Isoform 8 (identifier: O95628-8)

The sequence of this isoform differs from the canonical sequence as follows:
     271-274: RYDT → S
     544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...LLQSSTLDRH
Note: No experimental confirmation available.
Isoform 9 (identifier: O95628-9)

The sequence of this isoform differs from the canonical sequence as follows:
     271-274: RYDT → S
     543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSVESLN...LLQSSTLDRH
Note: No experimental confirmation available.
Isoform 10 (identifier: O95628-10)

The sequence of this isoform differs from the canonical sequence as follows:
     543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSVESLN...LLQSSTLDRH
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 575575CCR4-NOT transcription complex subunit 4
PRO_0000081679

Regions

Domain109 – 18981RRM
Zinc finger14 – 5744RING-type; degenerate
Zinc finger190 – 21728C3H1-type
Coiled coil68 – 10437 Potential

Amino acid modifications

Modified residue711Phosphoserine Ref.10
Modified residue3241Phosphoserine Ref.11 Ref.12 Ref.13
Modified residue4321Phosphoserine Ref.12
Modified residue4901Phosphoserine Ref.12

Natural variations

Alternative sequence1 – 1717Missing in isoform 3.
VSP_009923
Alternative sequence271 – 2744RYDT → S in isoform 2, isoform 8 and isoform 9.
VSP_009924
Alternative sequence419 – 43315IEKEL…PSLSP → TEPIERKRLAVLKRR in isoform 5.
VSP_009925
Alternative sequence434 – 575142Missing in isoform 5.
VSP_009926
Alternative sequence543 – 57533GEEEV…HTTVA → DNSSSIESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSLSWDS PGSWTDPAIITGIPASSGNS LDSLQDDNPPHWLKSLQALT EMDGPSAAPSQTHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPQIYYRVQHWTAIRQ RGATIRKCRICPTLFSPSQP TTHSSLLISYVLKNPVPDQF FFSLTPDAMRSQGHYHLFIN CKNFC in isoform 6.
VSP_009927
Alternative sequence543 – 57533GEEEV…HTTVA → DNSSSVESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSLSWDS PGSWTDPAIITGIPASSGNS LDSLQDDNPPHWLKSLQALT EMDGPSAAPSQTHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPGFQTAFRPPSKTPT DLLQSSTLDRH in isoform 9 and isoform 10.
VSP_045469
Alternative sequence544 – 57532EEEVK…HTTVA → IPASSGNSLDSLQDDNPPHW LKSLQALTEMDGPSAAPSQT HHSAPFSTQIPLHRASWNPY PPPSNPSSFHSPPPGFQTAF RPPSKTPTDLLQSSTLDRH in isoform 4 and isoform 8.
VSP_009928
Alternative sequence544 – 57532EEEVK…HTTVA → IPASSGNSLDSLQDDNPPHW LKSLQALTEMDGQRCSITDP PQRPLQHTDPAAQSQLESLP SSFKPFQLPLPTPRLSDGLQ TPQQNPHRFTTEFNTGPPLG KEEQPLENAGFVPLCFLPLS PPPTAPFSSLMF in isoform 7.
VSP_009929
Natural variant71A → G. Ref.3
Corresponds to variant rs17480616 [ dbSNP | Ensembl ].
VAR_027833

Experimental info

Mutagenesis161L → A or E: Abolishes interaction with E2 ubiquitin ligases. Ref.8
Mutagenesis171C → A: Abolishes interaction with E2 ubiquitin ligases. Ref.8
Mutagenesis181M → A: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8
Mutagenesis331C → R: Abolishes interaction with E2 ubiquitin ligases. Ref.8
Mutagenesis421W → A: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8
Mutagenesis441R → A or E: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8
Mutagenesis451I → A or W: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8
Mutagenesis491E → A: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8 Ref.9
Mutagenesis491E → K: Strongly reduced interaction with UBE2D2. Ref.8 Ref.9
Mutagenesis541P → A: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8
Mutagenesis571R → A or E: Strongly reduces interaction with E2 ubiquitin ligases. Ref.8
Sequence conflict1781N → D in BAH13270. Ref.4
Sequence conflict2011K → R in BAH13270. Ref.4
Sequence conflict3401N → I in AAH35590. Ref.6
Sequence conflict5701L → F in AAD00179. Ref.1
Sequence conflict5701L → F in AAD00180. Ref.1
Isoform 9:
Sequence conflict5451V → I in BAH13270. Ref.4

Secondary structure

......... 575
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 3, 2006. Version 3.
Checksum: C41762D4EC4222BC

FASTA57563,510
        10         20         30         40         50         60 
MSRSPDAKED PVECPLCMEP LEIDDINFFP CTCGYQICRF CWHRIRTDEN GLCPACRKPY 

        70         80         90        100        110        120 
PEDPAVYKPL SQEELQRIKN EKKQKQNERK QKISENRKHL ASVRVVQKNL VFVVGLSQRL 

       130        140        150        160        170        180 
ADPEVLKRPE YFGKFGKIHK VVINNSTSYA GSQGPSASAY VTYIRSEDAL RAIQCVNNVV 

       190        200        210        220        230        240 
VDGRTLKASL GTTKYCSYFL KNMQCPKPDC MYLHELGDEA ASFTKEEMQA GKHQEYEQKL 

       250        260        270        280        290        300 
LQELYKLNPN FLQLSTGSVD KNKNKVTPLQ RYDTPIDKPS DSLSIGNGDN SQQISNSDTP 

       310        320        330        340        350        360 
SPPPGLSKSN PVIPISSSNH SARSPFEGAV TESQSLFSDN FRHPNPIPSG LPPFPSSPQT 

       370        380        390        400        410        420 
SSDWPTAPEP QSLFTSETIP VSSSTDWQAA FGFGSSKQPE DDLGFDPFDV TRKALADLIE 

       430        440        450        460        470        480 
KELSVQDQPS LSPTSLQNSS SHTTTAKGPG SGFLHPAAAT NANSLNSTFS VLPQRFPQFQ 

       490        500        510        520        530        540 
QHRAVYNSFS FPGQAARYPW MAFPRNSIMH LNHTANPTSN SNFLDLNLPP QHNTGLGGIP 

       550        560        570 
VAGEEEVKVS TMPLSTSSHS LQQGQQPTSL HTTVA 

« Hide

Isoform 2 [UniParc].

Checksum: 717835C74D66B540
Show »

FASTA57263,062
Isoform 3 [UniParc].

Checksum: DAE0356900B05FE4
Show »

FASTA55861,651
Isoform 4 [UniParc].

Checksum: 3D432CA88242C77E
Show »

FASTA64270,787
Isoform 5 [UniParc].

Checksum: 8B120FF952B46883
Show »

FASTA43348,485
Isoform 6 [UniParc].

Checksum: 43A198C595008B1C
Show »

FASTA76784,747
Isoform 7 [UniParc].

Checksum: FA54396714B4A41B
Show »

FASTA67574,524
Isoform 8 [UniParc].

Checksum: C22E9F609FFFF456
Show »

FASTA63970,339
Isoform 9 [UniParc].

Checksum: 118DE9B8D4B7AD79
Show »

FASTA71077,809
Isoform 10 [UniParc].

Checksum: A66182988D096173
Show »

FASTA71378,257

References

« Hide 'large scale' references
[1]"Isolation and characterization of human and murine homologues of yeast NOT4 gene."
Chiang P.-W.
Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
[2]"Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits."
Albert T.K., Lemaire M., van Berkum N.L., Gentz R., Collart M.A., Timmers H.T.M.
Nucleic Acids Res. 28:809-817(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
[3]The European IMAGE consortium
Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLY-7.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 149-575 (ISOFORM 6).
Tissue: Mammary gland and Placenta.
[5]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[7]"Full-insert sequence of mapped XREF EST."
Barrow I.K.-P., Boguski M.S., Touchman J.W., Spencer F.
Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 294-575 (ISOFORM 7).
[8]"Identification of a ubiquitin-protein ligase subunit within the CCR4-NOT transcription repressor complex."
Albert T.K., Hanzawa H., Legtenberg Y.I.A., de Ruwe M.J., van den Heuvel F.A.J., Collart M.A., Boelens R., Timmers H.T.M.
EMBO J. 21:355-364(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, UBIQUITINATION, INTERACTION WITH CNOT1 AND UBIQUITIN E2 LIGASES, MUTAGENESIS OF LEU-16; CYS-17; MET-18; CYS-33; TRP-42; ARG-44; ILE-45; GLU-49; PRO-54 AND ARG-57, STRUCTURE BY NMR OF 1-78.
[9]"An altered-specificity ubiquitin-conjugating enzyme/ubiquitin-protein ligase pair."
Winkler G.S., Albert T.K., Dominguez C., Legtenberg Y.I., Boelens R., Timmers H.T.
J. Mol. Biol. 337:157-165(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH UBE2D2, AUTOUBIQUITINATION, MUTAGENESIS OF GLU-49.
[10]"ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage."
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.
Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic kidney.
[11]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324; SER-432 AND SER-490, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[13]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[14]"Not4 enhances JAK/STAT pathway-dependent gene expression in Drosophila and in human cells."
Gronholm J., Kaustio M., Myllymaki H., Kallio J., Saarikettu J., Kronhamn J., Valanne S., Silvennoinen O., Ramet M.
FASEB J. 26:1239-1250(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[15]"The structure of the C4C4 ring finger of human NOT4 reveals features distinct from those of C3HC4 RING fingers."
Hanzawa H., de Ruwe M.J., Albert T.K., van Der Vliet P.C., Timmers H.T.M., Boelens R.
J. Biol. Chem. 276:10185-10190(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 1-78 IN COMPLEX WITH ZINC IONS.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U71267 mRNA. Translation: AAD00179.1. Frameshift.
U71268 mRNA. Translation: AAD00180.1. Frameshift.
AF180475 mRNA. Translation: AAF29829.1.
AL389980 mRNA. Translation: CAB97536.1.
AK074671 mRNA. Translation: BAC11125.1. Different initiation.
AK300365 mRNA. Translation: BAH13270.1.
AC083871 Genomic DNA. No translation available.
AC074002 Genomic DNA. No translation available.
BC035590 mRNA. Translation: AAH35590.1.
AF091094 mRNA. Translation: AAC72963.1. Sequence problems.
CCDSCCDS43650.1. [O95628-8]
CCDS47719.1. [O95628-2]
CCDS55164.1. [O95628-4]
CCDS55165.1. [O95628-10]
CCDS55166.1. [O95628-1]
CCDS55167.1. [O95628-9]
RefSeqNP_001008226.1. NM_001008225.2. [O95628-2]
NP_001177776.1. NM_001190847.1. [O95628-4]
NP_001177777.1. NM_001190848.1. [O95628-1]
NP_001177778.1. NM_001190849.1. [O95628-9]
NP_001177779.1. NM_001190850.1. [O95628-10]
NP_037448.2. NM_013316.3. [O95628-8]
UniGeneHs.490224.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1E4UNMR-A1-78[»]
1UR6NMR-B12-63[»]
ProteinModelPortalO95628.
SMRO95628. Positions 1-78, 103-198.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110912. 17 interactions.
IntActO95628. 9 interactions.
STRING9606.ENSP00000354673.

PTM databases

PhosphoSiteO95628.

Proteomic databases

MaxQBO95628.
PaxDbO95628.
PRIDEO95628.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000315544; ENSP00000326731; ENSG00000080802. [O95628-1]
ENST00000356162; ENSP00000348485; ENSG00000080802. [O95628-5]
ENST00000361528; ENSP00000354673; ENSG00000080802. [O95628-8]
ENST00000414802; ENSP00000416532; ENSG00000080802. [O95628-5]
ENST00000423368; ENSP00000406777; ENSG00000080802. [O95628-4]
ENST00000428680; ENSP00000399108; ENSG00000080802. [O95628-2]
ENST00000451834; ENSP00000388491; ENSG00000080802. [O95628-9]
ENST00000541284; ENSP00000445508; ENSG00000080802. [O95628-10]
GeneID4850.
KEGGhsa:4850.
UCSCuc003vss.3. human. [O95628-8]
uc003vst.3. human. [O95628-4]
uc003vsu.2. human. [O95628-2]
uc003vsv.2. human. [O95628-1]

Organism-specific databases

CTD4850.
GeneCardsGC07M135046.
H-InvDBHIX0007112.
HGNCHGNC:7880. CNOT4.
HPAHPA005737.
MIM604911. gene.
neXtProtNX_O95628.
PharmGKBPA26675.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5175.
HOVERGENHBG051043.
KOK10643.
OMAKNPVPDQ.
OrthoDBEOG790G0K.
PhylomeDBO95628.
TreeFamTF106134.

Enzyme and pathway databases

ReactomeREACT_21257. Metabolism of RNA.
REACT_71. Gene Expression.
UniPathwayUPA00143.

Gene expression databases

ArrayExpressO95628.
BgeeO95628.
CleanExHS_CNOT4.
GenevestigatorO95628.

Family and domain databases

Gene3D3.30.40.10. 1 hit.
3.30.70.330. 1 hit.
InterProIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR000571. Znf_CCCH.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
SMARTSM00184. RING. 1 hit.
SM00360. RRM. 1 hit.
[Graphical view]
PROSITEPS50102. RRM. 1 hit.
PS50103. ZF_C3H1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceO95628.
GenomeRNAi4850.
NextBio18678.
PROO95628.
SOURCESearch...

Entry information

Entry nameCNOT4_HUMAN
AccessionPrimary (citable) accession number: O95628
Secondary accession number(s): B7Z6I4 expand/collapse secondary AC list , E7ET38, F8VQP3, O95339, O95627, Q8IYM7, Q8NCL0, Q9NPQ1, Q9NZN6
Entry history
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: October 3, 2006
Last modified: July 9, 2014
This is version 135 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM