O95551 (TYDP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tyrosyl-DNA phosphodiesterase 2 Short name=Tyr-DNA phosphodiesterase 2 EC=3.1.4.- Alternative name(s): 5'-tyrosyl-DNA phosphodiesterase Short name=5'-Tyr-DNA phosphodiesterase ETS1-associated protein 2 ETS1-associated protein II Short name=EAPII TRAF and TNF receptor-associated protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 362 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 5'-phosphodiester bond, giving rise to DNA with a free 5' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase 2 (TOP2) active site tyrosine residue. Hydrolyzes 5'-phosphoglycolates on protruding 5' ends on DNA double-strand breaks (DSBs) due to DNA damage by radiation and free radicals. The 5'-tyrosyl DNA phosphodiesterase activity can enable the repair of TOP2-induced DSBs without the need for nuclease activity, creating a 'clean' DSB with 5'-phosphate termini that are ready for ligation. Has also 3'-tyrosyl DNA phosphodiesterase activity, but less efficiently and much slower than TDP1. May also act as a negative regulator of ETS1 and may inhibit nuclear factor-kappa-B activation. Ref.10 |
| Cofactor | Magnesium Probable. Ref.10 |
| Subunit structure | Interacts with TRAF2, TRAF3, TRAF5, TRAF6, TNFRSF8/CD30, TNFRSF5/CD40, TNFRSF1B/TNF-R75, ETS1, ETS2, FLI1, SMAD3 and ACVR1B/ALK4. Ref.1 Ref.2 Ref.8 |
| Subcellular location | |
| Tissue specificity | Widely expressed. Ref.1 |
| Sequence similarities | Belongs to the CCR4/nocturin family. |
| Sequence caution | The sequence BAG59230.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage DNA repair |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Magnesium Metal-binding |
| Molecular function | Hydrolase Nuclease |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell surface receptor linked signaling pathway Traceable author statement. Source: ProtInc double-strand break repairInferred from direct assay Ref.10. Source: UniProtKB |
| Cellular component | PML body Inferred from direct assay Ref.10. Source: UniProtKB |
| Molecular function | 5'-tyrosyl-DNA phosphodiesterase activity Inferred from direct assay Ref.10. Source: UniProtKB magnesium ion bindingTraceable author statement Ref.10. Source: UniProtKB nuclease activityInferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from physical interaction Ref.8. Source: UniProtKB transcription corepressor activityTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95551-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95551-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRERHDTGACAEPRVGLLFRLKGRCRGGRKM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O95551-3) The sequence of this isoform differs from the canonical sequence as follows: 60-137: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 362 | 362 | Tyrosyl-DNA phosphodiesterase 2 | PRO_0000065678 | |||||
Sites | |||||||||
| Active site | 351 | 1 | Proton acceptor By similarity | ||||||
| Metal binding | 120 | 1 | Magnesium By similarity | ||||||
| Metal binding | 152 | 1 | Magnesium By similarity | ||||||
| Metal binding | 262 | 1 | Magnesium By similarity | ||||||
| Metal binding | 264 | 1 | Magnesium By similarity | ||||||
| Metal binding | 350 | 1 | Magnesium By similarity | ||||||
| Metal binding | 351 | 1 | Magnesium By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.9 | ||||||
| Modified residue | 88 | 1 | Phosphothreonine; by ACVR1B Ref.8 | ||||||
| Modified residue | 92 | 1 | Phosphothreonine; by ACVR1B Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MRERHDTGACAEPRVGLLFR LKGRCRGGRKM in isoform 2. | VSP_038523 | |||||
| Alternative sequence | 60 – 137 | 78 | Missing in isoform 3. | VSP_038524 | |||||
| Natural variant | 166 | 1 | S → G. Corresponds to variant rs35977478 [ dbSNP | Ensembl ]. | VAR_051464 | |||||
| Natural variant | 249 | 1 | Q → E. Ref.5 Corresponds to variant rs2294689 [ dbSNP | Ensembl ]. | VAR_022634 | |||||
| Natural variant | 268 | 1 | R → Q. Ref.5 Corresponds to variant rs17249952 [ dbSNP | Ensembl ]. | VAR_022635 | |||||
Experimental info | |||||||||
| Mutagenesis | 88 | 1 | T → A: Abolishes function, but retains ability to interact with SMAD3; when associated with A-92. Ref.8 | ||||||
| Mutagenesis | 92 | 1 | T → A: Abolishes function, but retains ability to interact with SMAD3; when associated with A-88. Ref.8 | ||||||
| Mutagenesis | 152 | 1 | E → A: Loss of phosphodiesterase activity. Ref.10 | ||||||
| Mutagenesis | 262 | 1 | D → A: Loss of phosphodiesterase activity. Ref.10 | ||||||
| Sequence conflict | 31 | 1 | E → R in AAF64144. Ref.3 | ||||||
| Sequence conflict | 61 | 1 | Y → C in BAA92119. Ref.4 | ||||||
| Sequence conflict | 72 | 1 | E → G in BAG60857. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "TTRAP, a novel protein that associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor-associated factors (TRAFs), and that inhibits nuclear factor-kappa B activation." Pype S., Declercq W., Ibrahimi A., Michiels C., Van Rietschoten J.G.I., Dewulf N., de Boer M., Vandenabeele P., Huylebroeck D., Remacle J.E. J. Biol. Chem. 275:18586-18593(2000) [PubMed: 10764746] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH TNFRSF5; TNFRSF8; TNFRSF1B; TRAF2; TRAF3; TRAF5 AND TRAF6, TISSUE SPECIFICITY. Tissue: Umbilical vein. |
| [2] | "EAPII interacts with ETS1 and modulates its transcriptional function." Pei H., Yordy J.S., Leng Q., Zhao Q., Watson D.K., Li R. Oncogene 22:2699-2709(2003) [PubMed: 12743594] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH ETS1; ETS2 AND FLI1, SUBCELLULAR LOCATION. |
| [3] | "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed: 10931946] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Adrenal gland. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 23-362 (ISOFORM 3). Tissue: Colon and Placenta. |
| [5] | SeattleSNPs variation discovery resource Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLU-249 AND GLN-268. |
| [6] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed: 14574404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Duodenum and Skin. |
| [8] | "Ttrap is an essential modulator of Smad3-dependent Nodal signaling during zebrafish gastrulation and left-right axis determination." Esguerra C.V., Nelles L., Vermeire L., Ibrahimi A., Crawford A.D., Derua R., Janssens E., Waelkens E., Carmeliet P., Collen D., Huylebroeck D. Development 134:4381-4393(2007) [PubMed: 18039968] [Abstract] Cited for: INTERACTION WITH ACVR1B AND SMAD3, PHOSPHORYLATION AT THR-88 AND THR-92, MUTAGENESIS OF THR-88 AND THR-92. |
| [9] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [10] | "A human 5'-tyrosyl DNA phosphodiesterase that repairs topoisomerase-mediated DNA damage." Ledesma F.C., El Khamisy S.F., Zuma M.C., Osborn K., Caldecott K.W. Nature 461:674-678(2009) [PubMed: 19794497] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, COFACTOR, MUTAGENESIS OF GLU-152 AND ASP-262. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ269473 mRNA. Translation: CAB92966.1. AF201687 mRNA. Translation: AAG35600.1. AF223469 mRNA. Translation: AAF64144.1. AK002168 mRNA. Translation: BAA92119.1. AK296623 mRNA. Translation: BAG59230.1. Different initiation. AK298699 mRNA. Translation: BAG60857.1. AY613922 Genomic DNA. Translation: AAT09764.1. AL031775 Genomic DNA. Translation: CAA21141.1. AL031775 Genomic DNA. Translation: CAD92510.1. Sequence problems. BC017553 mRNA. Translation: AAH17553.1. BC110375 mRNA. Translation: AAI10376.1. |
| IPI | IPI00009913. IPI00954485. IPI00954580. |
| RefSeq | NP_057698.2. NM_016614.2. |
| UniGene | Hs.728795. |
3D structure databases | |
| ProteinModelPortal | O95551. |
| SMR | O95551. Positions 26-64. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O95551. 12 interactions. |
| MINT | MINT-5005899. |
| STRING | O95551. |
PTM databases | |
| PhosphoSite | O95551. |
Proteomic databases | |
| PRIDE | O95551. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000378198; ENSP00000367440; ENSG00000111802. |
| GeneID | 51567. |
| KEGG | hsa:51567. |
| UCSC | uc003nei.1. human. |
Organism-specific databases | |
| CTD | 51567. |
| GeneCards | GC06M024651. |
| H-InvDB | HIX0005625. |
| HGNC | HGNC:17768. TDP2. |
| MIM | 605764. gene. |
| neXtProt | NX_O95551. |
| PharmGKB | PA134971108. PA165618310. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG13984. |
| GeneTree | ENSGT00390000014242. |
| HOVERGEN | HBG079625. |
| InParanoid | O95551. |
| OMA | LITWNID. |
| OrthoDB | EOG4HQDJR. |
| PhylomeDB | O95551. |
Gene expression databases | |
| ArrayExpress | O95551. |
| Bgee | O95551. |
| CleanEx | HS_TTRAP. |
| Genevestigator | O95551. |
| GermOnline | ENSG00000111802. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005135. Endo/exonuclease/phosphatase. IPR009060. UBA-like. [Graphical view] |
| Pfam | PF03372. Exo_endo_phos. 1 hit. [Graphical view] |
| SUPFAM | SSF56219. Exo_endo_phos. 1 hit. SSF46934. UBA_like. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 55388. |
| SOURCE | Search... |
Entry information
| Entry name | TYDP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95551 Secondary accession number(s): B4DKL8 Q9NYY9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with